EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00731 alignment
(13 sequences with 160 aa)


PUR6_YEAST/403-559 PLVGIIMGSDSDLPVMSAACAVLKDFGVPFEVTIVSAHRTPHRMSAYAISASKRGIK-TIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSCLDGVDSLHSIVQMPRGVPVATVAIN--NSTNAALLAVRLLGAYDSSYTTKMEQFLLKQEEEVLVKAQKL
PUR6_DEBOC/393-549 PLVSIIMGSDSDLPVMSVGANILKRFGVPFELTIVSAHRTPHRMTQYAIEAPKRGLK-VIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGIPVATVAIN--NSTNAALLAVRILGAYDYKWLNEMNQYMNNMENEVLAKAERL
PUR6_SCHPO/386-542 PVVGIIMGSDSDLSKMKDAAVILDEFKVPYELTIVSAHRTPDRMVTYARTAASRGLR-VIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGVPVATVAIN--NSQNAGILACRILATFQPSLLAAMESFMDNMKEIVLEKADKL
PUR6_VIGAC/389-545 TLLGFIMGSDSDLPVMKSAAEMMEMFGVPHEVRIVSAHRTPELMFCYASSAHERGYQ-VIIAGAGGAAHLPGMVASLTPLPVVGVPVRASTLDGLDSLLSIVQMPRGVPVATVAVN--NATNAGLLAVRMLGVANDNLLSRMSQYQEDQKEAVLREGDKL
PUR6_MYCLE/5-161 PRVGVIMGSDSDWSVMQDAAHALAEFDIPIEVRVVSAHRTPAEMFDYARNAVDRSIA-VIIAGAGGAAHLPGMVASATPLPVIGVPVPLARLDGLDSLLSIVQMPAGVPVATVSIG--GARNAGLLAVRILGSSDLQLRAQLVAFQDRLADTVRAKDADL
PUR6_HAEIN/5-163 AQIAVVMGSKSDWATMQEATQILDELNVPYHVEVVSAHRTPDKLFEFAENAQKNGYK-VIIAGAGGAAHLPGMIAAKTLVPVLGVPVKSSMLSGVDSLYSIVQMPKGIPVGTLAIGPAGAANAGLLAAQILAGWDDALFTRLQAFRENQTNMVLDNPDPR
PUR6_ECOLI/7-165 ARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQ-VIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPR
PUR6_BRUME/3-161 VDVAIIMGSQSDWETMHHAADTLEALGISFDARIVSAHRTPDRLVAFAKGAKAEGFK-VIIAGAGGAAHLPGMAAAMTPLPVFGVPVQSKALSGQDSLLSIVQMPAGIPVGTLAIGRAGAVNAALLAAAVLALYDEALAARLDEWRKAQTESVAERPSNE
PUR6_BACSU/3-161 PLVGIIMGSTSDWETMKHACDILDELNVPYEKKVVSAHRTPDFMFEYAETARERGIK-VIIAGAGGAAHLPGMTAAKTTLPVIGVPVQSKALNGMDSLLSIVQMPGGVPVATTSIGKAGAVNAGLLAAQILSAFDEDLARKLDERRENTKQTVLESSDQL
PUR6_METTH/3-158 PRVMILLGSASDFRIAEKAMEIFEELRIPYDLRVASAHRTHEKVKAIVSEAVKAGVE-VFIGIAGLSAHLPGMISANTHRPVIGVPVD-VKLGGLDALFACSQMPFPAPVATVGVD--RGENAAILAAQIIGIGDPGVRERVADLRRGFYERVRRDECQV
PUR6_METSM/3-158 PKVMIILGSGSDIAIAEKSMKILEKLEIPYSLKIASAHRTPDLVRELVVQGTNAGIK-VFIGIAGLAAHLPGAIAAYTHKPVIGVPVD-VKVSGLDALYSSVQMPYPSPVATVGID--RGDNGAILAARILGLYDEEIRKKVLESKEGYRQKVIKNNEEI
PUR6_CHICK/267-421 GRVVVLMGSTSDLGHCEKIKKACATFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVVNCPPL-SSDWGAQDVWSSLRLPSGLGCPTTLSP---E-GAAQFAAQIFGLNNHLVWAKLRSNMLNTWISLKQADKKL
PUR6_CAEEL/269-422 CHVLVIMGSGSDGVFARKISDEAKKFGLETTLKVSSAHKTTSDTLEVIADFEESGVPTVVIAVAGRSNGLGPVIAGNSSLPVINCPPP-SEST-SLDIWSSLRMPNGIGCTTVLDP---S-EAALAAAKILASHNHIVFGKVLTAQLKNQINIYNANRKL