EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00708 alignment
(3 sequences with 89 aa)


HYPF_SYNY3/1-88 MLKTVAIQVQGRVQGVGFRPFVYTLAQEMGLNGWVNNSTQG-ATVVITADEKAIADFTERLTKTLPPPGLIEQLAVEQLPLESFTNFTI
ACYP_DROME/4-92 NVHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPLSSIEKVEFSSQRERDRYGYAN
ACYO_HUMAN/5-93 TLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSD