EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00687 alignment
(16 sequences with 220 aa)


RL1_THETH/14-221 VDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRS-DQNVRGTVSLPHGLGK-QVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGW------MDFDAVVATPDVMGAVGSKLGRILGP----RGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPS
RL1_THEMA/15-222 VDRTKYYDLDEAIELVKKTATAKFDETIELHIQTGIDYRKP-EQHIRGTIVLPHGTGK-EVKVLVFAKGEKAKEALEAGADYVGAEDLVEKIEKEG-----FLDFDVAIATPDMMRIIG-RLGKILGP----RGLMPSPKSGTVTQEVAEAVKEFKKGRIEVRTDKTGNIHIPVGKRSFDNEKLKENIIAAIKQIMQMKPAGVKGQFIKKVVLASTMGPG
RL1_STRGR/14-220 VDRERNYAPLEAVRLAKETSSTKFDGTVEVAFALGVDPRKA-DQMVRGTVNLPHGTGK-TARVLVFATGDRAAAAEAAGADIVGADELIDEVAKGR------LDFDAVVATPDLMGKVG-RLGRVLGP----RGLMPNPKTGTVTPDVVKAVNDIKGGKIEFRVDKHSNLHFIIGKVSFDETKLVENYAAALEEILRLKPSAAKGRYIKKATLATTMGPG
RL1_BACST/14-220 VDRSKAYPIAEAIELVKKTNVAKFDATVEVAFRLGVDPKKA-DQQIRGAVVLPHGTGK-VARVLVFAKGEKAKEAEAAGADYVGDTEYINKIQQGW------FDFDVVVATPDMMGEVG-KLGRILGP----KGLMPDPKTGTVTFDVAKAVQEIKAGKVEYRVDKAGNIHVPIGKVSFDNEKLAENFAAVYEALIKAKPAAAKGTYVKNVTITSTMGPG
RL1_ECOLI/14-220 VDATKQYDINEAIALLKELATAKFVESVDVAVNLGIDARKS-DQNVRGATVLPHGTGR-SVRVAVFTQGANAEAAKAAGAELVGMEDLADQIKKGE------MNFDVVIASPDAMRVVG-QLGQVLGP----RGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPTQAKGVYIKKVSISTTMGAG
RL1_LIBAS/16-222 IDRSALYGLSDAVVMLKERATARFDETVEIAMNLGIDPRHA-NQMVRGVVTMPNGTGV-NVRVAVFATSSKADEAREAGADIVGGEDLFEIVKGGQ------IDFDRCIATPDMMPLVG-RLGRILGP----RGIMPNLRVGTVTTDVATAVRESKSGAVDFRSEKAGIIHAGIGKVSFENKKIEENVLAFVSAVVKAKPSVAKGDYVKRVTLSSTMGCG
RL1_SYNY3/16-222 VDDSKLYSPLEAMELLKETATAKFDETAEAHIRLGIDPKYS-DQQIRTTVSLPKGTGQ-TVRVAVLARGEKVKEATDAGADIAGSEELIEEIQKGM------MDFDVLIATPDMMPKIA-RLGKQLGP----RGLMPSPKGGTVTADLAAAVNEFKAGKLEFRADRTGIVHVMFGKASFSADDLLANLKALQETIDRNRPSGAKGRFWRTVFVSSSMGPS
RK1_CYAPA/15-220 VEEQ-LYEPLEAIQLLKQISTAKFIETVEVHCRLGIDPKYN-DQQLRATVTLPNGTGQ-TLRVAVITRGEKINEASTAGADLVGAEELIDEIQNGR------LDFDCLIATPDMMPQVA-KLGRVLGP----RGLMPSPKGGTVTFDLAQAINDFKAGKLEFRNDRTGIVHVLFGKANFSEEALLGNLKAVQEAVDRNRPSGVKGKYWKSIYITSTMSPS
RK1_PORPU/15-220 VDPK-LYSLNEAVTILRATSNAKFKETAEAHISLGLNPKYA-DQQLRATVILPKGTGK-LVKVAVIAKGEKLTEAMNAGADISGSEELIDEISKGR------LDFDKLIATPDIMPLIA-KLGRVLGP----RGLMPSPKAGTVTLDITKSINEFKGGKVEYRVDRTGIIHVPFGKSSFPEEDLVMNLQTIKDSIDKNKPSGSKGKYWKTFFLSSTMGPS
RK1_ODOSI/15-221 TKDSIYSNLEDAITILQETATAKFTETVELHANLNIDPKYA-DQQLRTTVTLPHGIGK-TINIAVLTNDSNFTEAREAGADRVGSDDLIEEISQGN------ISFDLLIATPDMMPKLA-KLGRVLGP----KGLMPSPKSGTVSTTLTATLSEFKKGKFEYKADKAGVVHVSFGKSNFTHSQLMENLTALYKSIEQNRPSGVKGKYFKSLFICTTMGPS
RL1_MYCGE/15-219 IDKNKLYPIQEAFELIKKTAITKFVSSVDIAVSLNLDTTKA-EQQLRGAIAFPFSIGK-SIRILAITDDE--KKASEAGADFVGGLDKIEAIKNGW------LDFDLIITSPKFMGALG-KLGKLLGT----RGLMPNPKTETVTDDVVSAIKAYKKGKKEYRTDSFGNIHLSLGKTDTKTEHLVANAMALIDLIKSKRPSTVKGTYIKNIALTTTMGPS
RL1_METVA/6-208 -----IQKAVKEART--LAKPRNFTQSVDLIVNLKELDLTRHENRLKEQIVLPSGKGK-DTKIAVIAKGDLAAQAAEMGLTVIRQEELEELGKNKKAAKRIANEHGFFIAQADMMPLVGKSLGPVLGP----RGKMPTPLP--GNANLAPLVARFKK-TVAINTRDKSLFQVYIGTEAMSDEEIAANAEAILNVVAKKYEKG--LYHVKSAFTKLTMGAA
RL1_METJA/1-208 MDREALLQAVKEARE--LAKPRNFTQSFEFIATLKEIDMRKPENRIKTEVVLPHGRGK-EAKIAVIGTGDLAKQAEELGLTVIRKEEIEELGKNKRKLRKIAKAHDFFIAQADLMPLIGRYMGVILGP----RGKMPKPVP--ANANIKPLVERLKK-TVVINTRDKPYFQVLVGNEKMTDEQIVDNIEAVLNVVAKKYEKG--LYHIKDAYVKLTMGPA
RL1_HALMA/2-207 --DQEIENAVSRALE--DAPERNFRETVDLAVNLRDLDLNDPSNRVDESVVLPAGTGQ-ETTIVVFAEGETALRAEEVADDVLDEDELEELGGDDDAAKDLADDTDFFIAEKGLMQDIGRYLGTVLGP----RGKMPEPLD--PDDDVVEVIERMKN-TVQLRSGERRTFHTRVGAEDMSAENIADNIDVILRRLHADLEKG--PLNIDTVYVKTTMGPA
RL1_HALSA/5-207 -----IEEAVARALE--DAPQRNFRETVDLAVNLRDLDLNDPSQRVDEGVVLPSGTGQ-ETQIVVFADGETAVRADDVADDVLDEDDLSDLADDTDAAKDLADETDFFVAEAPMMQDIAGALGQVLGP----RGKMPTPLQ--PDDDVVDTVNRMKN-TVQIRSRDRRTFHTRVGAEDMSAEDIASNIDVIMRRLHANLEKG--PLNVDSVYVKTTMGPA
RL10A_RAT/4-212 VSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQK-DKRFSGTVRL-KSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIP----RILGPGLNKAGKFPSLLT--HNENMVAKVDEVKS-TIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKN--WQNVRALYIKSTMGKP