EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00684 alignment
(22 sequences with 89 aa)


YNH7_YEAST/193-276 GKTAKLGLNRTRICSVCDGHG---GLK.KCTCKTCKGQGIQTQTRRMGP-LVQSWSQTCADCGGAGVFVKNKDICQQCQGLGFIKERKI
MAS5_YEAST/130-215 GRTAKLALNKQILCKECEGRGGKKG-A.VKKCTSCNGQGIKFVTRQMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKI
DNJA1_HUMAN/121-207 GATRKLALQKNVICDKCEGRGGKKG-A.VECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKI
DNJH1_ALLPO/114-200 GTSKKLSLSRNVICSKCNGKGSKSG-A.SMRCASCQGSGMKVSIRQLGPGMIQQMQHPCNDCKGTGEMINDKDRCPLCKGEKVVQEKKV
DNJH_ARATH/136-222 GTTKKLSLSRKALCSKCNGKGSKSG-A.SMKCGGCQGSGMKISIRQFGPGMMQQVQHACNDCKGTGETINDRDRCPQCKGEKVVSEKKV
SCJ1_YEAST/183-266 GSSIEFTLNLNDECDACHGSGSADG-K.LAQCPDCQGRGVIIQVLRMG-IMTQQIQQMCGRCGGTGQIIK--NECKTCHGKKVTKKNKF
YLW5_CAEEL/665-746 GATKNVSVNVVEDCLKCHGTQVEPGHK.KTSCPYCNGTGAVSQRLQG----GFFYQTTCNRCRGSGHYNK--NPCQECEGEGQTVQRRQ
DNAJ_STRCO/166-246 GATVPLRMSSQAPCKACSGTGDKNG-T.PRVCPTCVGTG-QVARGSGG---GFSLTDPCPDCKGRGLIAE--DPCEVCKGSGRAKSSRT
DNAJ_MYCLE/159-239 GVAMPLRLTSPAPCTNCHGSGARPGIS.PKVCSTCNGSG-VINRNQG----AFGFSEPCTECRGSGSIIE--HPCEECKGTGVTTRTRT
DNAJ_STAAU/136-220 GTTKEISIRKDVTCETCHGDGAKPGTS.KKTCSYCNGAG-HVAVEQNTILGRVRTEQVCPKCNGSGQEFE--EACPTCHGKGTENKTVK
DNAJ_BACSU/132-216 GKETTIEIPREETCETCKGSGAKPGTN.PETCSHCGGSG-QLNVEQNTPFGKVVNRRVCHHCEGTGKIIK--NKCADCGGKGKIKKRKK
DNAJ_METMA/131-215 GVRKDIDIPRTERCSTCSGTGAKPGTS.PKRCPNCGGTG-QVRTTRSTLGMQFVSTTTCSACHGRGQVVE--SPCPTCSGAGRVRSRRK
DNAJ_CLOAB/137-221 GVEKSINITRSENCETCGGTGAKKGTS.PKTCDKCGGTG-TIRVQRNTPLGSFVTQSSCDKCGGRGTIIS--DPCHECHGAGHVRKKRK
DNAJ_LEGPN/135-215 GKEVEITVPRHGTCTVCEGSGAKKGTS.PKTCETCQGMG-QVRIQQG----FFSIQQTCPTCHGEGKIIS--DPCASCHGQGRVRESKK
DNAJ_ECOLI/130-210 GVTKEIRIPTLEECDVCHGSGAKPGTQ.PQTCPTCHGSG-QVQMRQG----FFAVQQTCPHCQGRGTLIK--DPCNKCHGHGRVERSKT
DNAJ_COXBU/133-212 GLSRTIKVPTWINCKTCNGSGAK-GSS.PATCPRCNGSG-QMRMQHG----FLQVQQTCSVCRGRGQVIK--DPCTDCHGQGRQQQTKT
DNAJ_FRATU/127-206 GVEKEITIPRMESCDSCDGTGSKSRS-.KTTCHACHGQG-TIRRQQG----FFAFEQTCPVCNGTGYSIT--DPCDACYGNGKVKKQKT
DNAJ_HAEIN/134-214 GTTKDIQINTLAHCDSCGGSGAEKGSK.VETCPHCHGSG-RIRRQQG----FFVSESICPTCHGSGKKIE--KPCRNCHGEGRVHKKEN
DNAJ_HAEDU/134-214 GCKKDIRLSTLAECDNCHGTGAEAGTK.VENCPHCHGAG-RIRRQQG----FFVTEAVCPSCHGTGKKIE--KPCHSCHGDGRVQKAKN
DNAJ_BORBU/135-215 GYKNNINITRQMLCDSCLGKKSEKGTS.PSICNMCNGSG---RVVQG--GGFFRVTTTCSKCYGEGKIIS--NPCKSCKGKGSLTKQET
DNAJ_ERYRH/134-217 GANKSVTLNVDEECTSCHGSGAHSKDD.IKTCSRCGGTG-QTVTQQRTPFGVFQSQATCPDCGGSGKTIT--KRCGECHGKGFNTKRV-
DNAJ_MYCGE/151-236 GCNKTIKYERKVSCHSCNGFGAEGGESgLDLCKDCNGNGFVIKNQRS-IFGTIQSQVLCSTCNGQGKQIK--VKCKTCRSNKYTVTNQI