EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00681 alignment
(40 sequences with 45 aa)


PLEC1_HUMAN/3523-3567 ALLLEAQAGTGFLVDPVRNQRLYVHEAVKAGVVGPELHEQLLSAE
PLEC1_RAT/3861-3905 RLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAE
EPIPL_HUMAN/291-335 LPLLEAQAATHTLVDPITGQRLWVDEAVRAGLVSPELHEQLLVAE
PLEC1_RAT/3195-3239 VALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPEMHEKLLSAE
PLEC1_RAT/4104-4148 FELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAE
EPIPL_HUMAN/1252-1296 QRLLEAQVASGFLVDPLNNQRLSVEDAVKVGLVGRELSEQLGQAE
EPIPL_HUMAN/47-91 QALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAE
BP1E_MOUSE/2129-2173 LAFLEAQAATGFIIDPVSGQTYCVEDAVLHGIVDPEFRSRLLEAE
Q8R167_MOUSE/111-155 QKLLEAQAATGGIVDLLSRERYSVHKAVERGLIENTSTQRLLNAQ
DESP_HUMAN/2046-2090 VMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAE
MACF4_HUMAN/1121-1165 LKVLEAQANTGGIIDTATGKRLTLASALEEKLVDENMVRIIASHQ
BP1E_MOUSE/2438-2482 LRCLEAQICTGGIIDPLTGKKYRVAEALHRGLVDEGFAQQLRQCE
EPIPL_HUMAN/1979-2023 LRLLEVQVATGGVIDPQHHHRLPLETAYRRGCLHKDIYALISDQK
EPIPL_HUMAN/1012-1056 ARLLEAQVATGGIIDPTSHHHLPMPVAIQRGYVDQEMETALSSSS
DESP_HUMAN/2365-2409 IRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEELSEILSDPS
EPIPL_MOUSE/6464-6508 IRLLEAQIATGGVIDPVHSHRVPVDVAYQRGYFDQEMNSILADPG
EPIPL_HUMAN/367-411 LRLLDAQLATGGLVCPARRLRLPLEAALRCGCLDEDTQRQLSQAG
PLEC1_RAT/3937-3981 LRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPS
PLEC1_RAT/3271-3315 LRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPR
EPIPL_HUMAN/1328-1372 LPLLQVQLATGGVVDPVHGVHLPQAAACRLGLLDTQTSQVLTAVD
EPIPL_HUMAN/123-167 QSWLEVQLATGGLVDPAQGVLVAPEPACHQGLLDRETWHKLSELE
BP1E_MOUSE/2203-2247 KHILEAQIASGGVIDPVRGVRVPPEMAVQQGLLNNAVLQFLHEPS
MACF4_HUMAN/935-979 VRLLTKQVVDGGIIHHISGMRLSVDNAFRHGLIGEDLAEKLKRVE
BPAEB_HUMAN/1447-1491 FRLLSAQLLSGGLINSNSGQRMTVEEAVREGVIDRDTASSILTYQ
BP1E_MOUSE/2514-2558 MRCLEFQYLTGGLIEPKVFSRLTIEEALHVGIIDVLIATRLKDQK
PLEC1_RAT/4525-4569 QRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVS
DESP_HUMAN/2724-2768 QRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTS
Q8R167_MOUSE/187-231 LPHLLVQHLTGGLIDPKRTGRIPVPQAVLCGMISEDLGQLLQDES
MACF4_HUMAN/725-769 LNVLSAQLLDGGIFHEQTGQKLLLNEAISRGIVPSHTAVKLMEKL
MACF4_HUMAN/241-285 CAILIRQLQTGGIIDTVTGQRLTIDEAVSNDLVAAKIALVILESL
MACF4_HUMAN/12-56 LVLLESQVIMSGLIAPETGENLSLEEGIARNLINPQMYQQLRELQ
MACF4_HUMAN/89-133 LKILEAHLATGGFSLSPSENCINLEEAFHQGLISAWLHSVLESYL
BPAEB_HUMAN/1333-1377 IKVLEILLSTGSLVIPATGEQLTLQKAFQQNLVSSALFSKVLERQ
MACF4_HUMAN/801-845 HNVLMADKAISGVLDPRTQTLCSVKDAVTVGLLDKETATRILERQ
DESP_HUMAN/2458-2500 KNTLRKRRVV--IVDPETNKEMSVQEAYKKGLIDYETFKELCEQE
EPIPL_HUMAN/898-942 RRYLCGLGAVGGVRLLPSGQRLSLYQAMRQKLLGPRVALALLEAQ
EPIPL_HUMAN/578-622 QRYLQGTGCIAGLLLPGSQERLSIYEARCKGLLRPGTALILLEAQ
PLEC1_RAT/2829-2873 RHYLKGGSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQ
PLEC1_RAT/3488-3532 RTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRASTATLLLEAQ
BPAEB_HUMAN/1523-1567 LLVLEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELAYKILNGR