EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00666 alignment
(7 sequences with 68 aa)


SC51_SHEEP/31-98 VLSYREAVLRAADQLNEKSSEANLYRLLELDPPpKQDDENSNIPKPVSFRVKETVCPRTSQQPAEQCD
BCTN5_BOVIN/31-97 ALSYREAVLRAVDQFNERSSEANLYRLLELDPT.PNDDLDPGTRKPVSFRVKETDCPRTSQQPLEQCD
BCTN1_BOVIN/31-97 ALSYREAVLRAVDQLNEQSSEPNIYRLLELDQP.PQDDEDPDSPKRVSFRVKETVCSRTTQQPPEQCD
FAL39_HUMAN/32-98 VLSYKEAVLRAIDGINQRSSDANLYRLLDLDPR.PTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCD
CAP18_RABIT/31-97 DLTYREAVLRAVDAFNQQSSEANLYRLLSMDPQ.QLEDAKPYTPQPVSFTVKETECPRTTWKLPEQCD
CRAMP_MOUSE/29-95 TPSYRDAVLRAVDDFNQQSLDTNLYRLLDLDPE.PQGDEDPDTPKSVRFRVKETVCGKAERQLPEQCA
P15A_RABIT/25-89 RLRYEEVVAQALQFYNEGQQGQPLFRLLEATPP.PSLNSKS--RIPLNFRIKETVCIFTLDRQPGNCA