EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00645 alignment
(14 sequences with 94 aa)


PARP1_HUMAN/112-202 FAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEK-PQLGMIDRWYHPGCFVKN--REELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVK
PARP1_MOUSE/112-202 FAAEYAKSNRSMCKGCLEKIEKGQMRLSKKMVDPEK-PQLGMIDRWYHPTCFVKK--RDELGFRPEYSASQLKGFSLLSAEDKEALKKQLPAIK
PARP1_CHICK/113-203 FAAEYAKSNRSTCKGCEQKIEKGQIRISKKMVHPEK-PQLGMIDNWYHPDCFVSR--RAELGFLPAYGATQLLGFSILKAEDKETLKKQLPATK
PARP1_BOVIN/115-205 FGAGYAKSNRSTCKSCMEKIDKGQVRLSKKVVYPDK-PQLGMVDCWYHPKCFVQK--REELGFRPEFSATHLMGFSVLTAEDQETLKKQLPAIK
PARP_SARPE/114-203 FGIEYAKSGRASCRGCEQKILKDQIRIRKTVFDTEVGMKYGGQPLWHHVECFAQL--RGELGWLDTG--ENLPGFQTLKSDDKADVKKALPVIK
PARP_DROME/111-200 FGIEYAKSSRSTCRGCEQKINKDLVRLRKTVYDTEVGMKYGGQPLWHHLECFAQL--RSELGWFASG--EDMPGFQSLADDDQAKVKNAIPPIK
PARP1_HUMAN/8-92 YRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMF---DGKVPHWYHFSCFWK---VGHSIRHPDV---EVDGFSELRWDDQQKVKKTAEAGG
PARP1_MOUSE/8-92 YRVQYAKSGRASCKKCSESIPKDSLRMAIMVQSPMF---DGKVPHWYHFSCFWK---VGQSIRHPDV---EVDGFSELRWDDQQKVKKTAEAGG
PARP1_BOVIN/8-92 YRVEYAKSGRASCKKCKESIPKDSIRMAFMVESPMF---DGKIPHWYHLSCFWK---VGFSIWHPDV---EVEGFSELRWDDQQTIKKMAETGG
PARP1_XENLA/1-78 -----AKSGRASCKKCGDNIAKESLGLAIMVQSPMF---DGKVPHWHHYSCFWK---RARVLSQG-----DIYGYTELRWEDQEMIKKAIETGG
PARP1_CHICK/9-91 YRAEYAKSGRASCKKCGESIAKDSLRLALMVQSPMF---DGKVPHWHHYSCFWK---RARIVSHT-----DIDGFPELRWEDQEKIKKAIETGA
PARP_SARPE/7-89 FKVEYSKSSRASCKGCKNKIEAGILRIAAMVQSAFH---DGKQPNWFHEQCFFQ---KQRPTSAG-----DIENFENIRFEDQERIKKAIDNCT
PARP_DROME/7-89 YLAEYARTGRATCKGCKSTISKDTLRIAVMVQSAFH---DAKVPNWFHKTCFFK---NQRPSSVG-----DIQNIGNLRFADQKELTDLVENIQ
DNL3_HUMAN/6-98 FCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFS-ESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQHIADLS