EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00624 alignment
(5 sequences with 45 aa)


YH13_YEAST/133-177 TTSIVTTTTELWTGTFTSTSTEMTTVTGTNGQPTDETVIVAKAPT
FLO1_YEAST/947-991 SEGLISTTTEPWTGTFTSTSTEVTTITGTNGQPTDETVIVIRTPT
FLO1_YEAST/452-496 TATTAMTTTQPWDDTFTSTSTEMTTVTGTNGLPTDETIIVIRTPT
FLO1_YEAST/317-361 TASTIITTTEPWNSTFTSTSTELTTVTGTNGVRTDETIIVIRTPT
FLO1_YEAST/272-316 AVSTTTTTTEPWTGTFTSTSTEMTTVTGTNGVPTDETVIVIRTPT