EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00570 alignment
(28 sequences with 83 aa)


Q9SLI9_ARATH/336-414 VQLSIVALQGLCEWRDRIARADDES.TGYVLPNKTLFDIAKEMPIVVAQLRRLLKSKLPYLERNFDAVISVIR.RS--MQNAA
RRP6_YEAST/435-515 PPEREVLVRELYQWRDLIARRDDES.PRFVMPNQLLAALVAYTPTDVIGVVSLTNGVTEHVRQNAKLLANLIR.DALRNIKNT
Q17951_CAEEL/489-569 NTRQDYALTHLFKWRDVVARAEDES.PHFVLPNHMMLSLSETLPRDVGGIYACCNPLPYFVKQRTGDILKIIV.EARDVKLEK
Q9VFF3_DROME/485-565 DNRQLYALRGIFEWRDATARSEDES.YGYVLPNHMMLQIAESLPREMQGILACCNPIPPLVRQQLHTLHQIVL.KARDQPLVK
PMC2_HUMAN/503-583 NTQQLTAFQLLFAWRDKTARREDES.YGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQ.QAREMPLLK
O69858_STRCO/214-293 RRRQLAVVRELWQARDRIAQRRDVS.PGKVLGDAAIVEAALALPPNAHALAALNGFGRVNRRQLEQ-WQLSVD.RARALSESQ
O07183_MYCTU/245-325 DRRGLAAVRELWTARDRIAQRRDIA.PRRILPDSAIIDAAIADPKSVDDLVALPVFGGRNQRRSAAVWWAALA.AARESPDPP
RND_HAEIN/239-318 NPLELSRLRVLAQWRQNVAIERDLA.LSYIVKSEHLWKVAKNNPRNTSEMLEM-GLTENEVRVRGKEILQLLS.QARRISSND
RND_ECOLI/210-289 RTRQLACLQLLADWRLRKARERDLA.VNFVVREEHLWSVARYMPGSLGELDSL-GLSGSEIRFHGKTLLALVE.KAQTLPEDA
SGS1_YEAST/1272-1351 LNNLRMTYERLRELSLNLGNRMVPP.VGNFMPDSILKKMAAILPMNDSAFATL-GTVEDKYRRRFKYFKATIA.DLSKKRSSE
Q9ZHY4_NEIGO/692-766 AKHKRCLMRALIQWCNETAKHEQSE.PYRILSKAALRAIAAKQPEGLAELAAVYGVGEEKAARYGAAVSAVLE.------RDA
Q9XAR9_STRCO/556-635 PAELVPAFEALRAWRAEQAREQGVP.AYVIFHDATLREIVTVWPTSVGQLGGISGVGEKKLATYGEGVVEAL-.AGLEGPGSA
Q9RUU2_DEIRA/534-614 DSHDAPLFEALRAWRLQKAKELSLP.PYTIFHDATLKTIAELRPGSHATLGTVSGVGGRKLAAYGDEVLQVVR.DSSGGGQAG
Q49764_MYCLE/161-242 ADVDEELLLQLKAWRLSTAKEQNVP.AYVVLTDNTLIAIAELLPADEAALIAVPGMSVRKIEQYGSDVLQLVRcRAVAVRTQT
RECQ_HAEIN/535-615 ANYDKDLFARLRFLRKQIADKENIP.PYIVFNDATLQEMAQYMPTSNIEMLQINGVGSIKLERFGQPFMALIQ.EHKAILANA
RECQ_ECOLI/528-608 GNYDRKLFAKLRKLRKSIADESNVP.PYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMALIR.AHVDGDDEE
O34748_BACSU/513-591 ITENDELFERLRMVRKEIAAEQGVP.PFVVFSDQTLKEMSGKQPVNDDELLSIKGVGEQKRAKYGRLFLQEIQ.AYARMT--D
Q9RUU2_DEIRA/750-824 PNAD--LSEALRELRRELMKETGYS.AFVVFTNATLEALAARQPRTLAELAEVPGLGEKRIEAYGERILDAIN.TVLD----G
Q9RUU2_DEIRA/652-732 KPAHPGVLGALRELRRTLAAEQGRS.LSWVFPEATIDELARKLPTRSEELKDVFGLGGQRIQAFGDRILATIR.AELTGGAPS
Q9ZHY4_NEIGO/613-691 REQQ--LRQKLEAWRYEQARAENCA.LHTVLSDESLADMLAATPETETDLEAVHGLGSVRAAKYGRDILAVCR.PFSDGIDET
Q9ZHY4_NEIGO/525-605 TEREERLWQALRVWRMKQAEAEGIP.AYMIFGDKTLRDLVEKMPQNLNGLHDIYGLGEAKTERFGHGILKVCQ.NAADFSHDA
WRN_HUMAN/1150-1229 QETQIVLYGKLVEARQKHANKMDVP.PAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAP-LLEVIK.HFCQTNSVQ
WRN_MOUSE/1115-1194 LDARTGLYARLVEARQKHANKMDVP.PAILATNKVLLDMAKMRPTTVENMKQIDGVSEGKAALLAP-LVGVIK.HFCQVTSVQ
WRN_XENLA/1098-1177 RELQTTLYGRLVVARQKIASERDIL.PAVLATNKVLVDMAKLRPTTSENMKKLDGVSEAKSAMLAP-LLEVVK.EFCIANSLK
HUS2_SCHPO/1115-1195 IDVMTRCLKDLKLLRSNLMAIDDSR.VSSYFTDSVLLSMAKKLPRNVKELKEIHGVSNEKAVNLGPKFLQVIQ.KFIDEKEQN
BLM_DROME/1283-1363 REIHERCYTDLLDLCRTIASQRNVT.MASIMNIQALKSMAETLPITEKDMCSIPHVTKANFDKYGAKLLEITS.NYASEKLLM
BLM_CAEEL/807-888 GDVFTRCLQDLTHLITAVAESSGLSgPYSIVSREGIEQIAALLPRTNSDLLRIDSMTQIKVTKYGRLIMELLA.TYWKQVDER
BLM_HUMAN/1212-1292 EEMVKKCLGELTEVCKSLGKVFGVH.YFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQ.KYSEWTSPA