EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00522 alignment
(12 sequences with 100 aa)


VPX_SIVM1/5-99 RERIPPGNSGEETIGEAF-EWLNRTVEEINREAVNHLPRELIFQVWQRSWEYWHDEQGMSQSYTKYRYLCLIQKALFMHCKKGCRCLG----EGHGAGGW
VPX_HV2BE/5-99 RERVPPGNSGEETIGEAF-EWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWG----EDMGREGL
VPX_HV2NZ/5-99 RETVPPGNSGEETIEEAF-AWLDRTVEAINREAVNHHPRELIFQVWQRSWRYWHDEQGMSTSYTKYRYLCLIQMAMYMHAKRDGTCLG----GGMGQKGG
VPX_HV2D2/4-98 RERVPPGNSDEETVGEAF-AWLERTITELNRVAVNHLPRELIFQVWQRSWAYWREEQGMSISYTKYRYLLLMQKAMFVHYTKGCRCLQ----EGHGPGGW
VPX_SIVAI/8-106 REPLPGWLEIWDLDREPWDEWLQDMLRDLNEEARRHFGMNMLIRVWNYCVEEG-RRHNTPWNEIGYKYYRIVQKSMFVHFRCGCRRRGPFSPYEERRNGQ
VPX_SIVA1/8-106 REERPGGLEIWDLSREPWDEWLRDMVEEINNEAKLHFGRELLYQVWNYCQEEG-ERQGRPIAERAYKYYRLVQKALFVHFRCGCRRRQPFEPYEERRNGQ
VPR_SIVM1/2-84 EERPPEN---EGPQREPWDEWVVEVLKELKEEALKHFDPRLLTALGNHIYNRHGDTLEG-----AGELIRILQRALFIHFRSGCS---------HSRIGQ
VPR_HV2D2/6-88 PEIPPEN---ENPQREPWEEWIGEILEEIKQEALKHFDPRLLTALGNFIYSRHGDTLAG-----AGELIKILQRALFLHFRAGCQ---------HSRIGQ
VPR_HV2D1/6-88 TEFPPED---GTPRRELGSTWVIETLKEIKEEALKHFDPCLLIALGNYIYNRHGDTLEG-----ARELIRVLQRALFVHIRAGCD---------RSRKGQ
VPR_HV2CA/6-88 TELPPED---GTPPREPGDEWVIEILRDIKEEALKHFDPRLLTALGGHIYARHGDTLER-----ARELIRVLQRALFTHFRAGCN---------HSRIGQ
VPR_HV1A2/1-83 MEQAPED---QGPQREPYNEWTLELLEELKREAVRHFPRPWLHSLGQYIYETYGDTWAG-----VEAIIRILQQLLFIHFRIGCQ---------HSRIGI
VPR_SIVGB/6-84 DEQVSED---QGPPREPYNQWLADTMEEIKEEARKHFPLIILNAVSEYCVQNTGSEEEA-----CEKFITLMNRAIWVHLAQGCD-------------GT