EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00508 alignment
(24 sequences with 206 aa)


VE2_PAPVE/3-205 MSAASDHLLAAQETQMQCIEKDSRLLQDHACYWGAVRREKLLLYAARTKGLKTIGCVPVPPCSVTAEQAKQAICMQLIVEELLHSPWAKEPWSLTDLSWERYQAAPKGCLKKGARVVEVEYDGNSSNKTWYTAWSTVYVRGTEEEGWETAVCAADGQGIYYCAGMSS.KVYFETFETDARRWSR-TGHWTVRDN-DVIYHSTFGAP
VE2_PAPVD/1-202 MSAAKEQLLAAQETQMTLIEKDSTDLKDHIDSWGPVRREHGLLYAARHKGLIWLGLNPVPPCSVKCLEARQAIEMQLLGNSLKESPWCNEPWSLCDLSWGRYQAPPAETLKKGARLVEVEYDGSSTNKTWYTAWNSLYLRKPDEEGWETATGGADADGLFYTTMSGT.RVYYELFERDAARYST-TGTWTVRDN-DRTYHSHS-AP
VE2_BPV1/1-202 METACERLHVAQETQMQLIEKSSDKLQDHILYWTAVRTENTLLYAARKKGVTVLGHCRVPHSVVCQERAKQAIEMQLSLQELSKTEFGDEPWSLLDTSWDRYMSEPKRCFKKGARVVEVEFDGNASNTNWYTVYSNLYMR--TEDGWQLAKAGADGTGLYYCTMAGAgRIYYSRFGDEAARFST-TGHYSVRDQ-DRVYAGVSSTS
VE2_HPV63/1-203 MESLNNRLDWLQEQLLTLYEKDSKDIEDQIMQWNLLRQEQVLFHYARKKGIMRLGLQVVPSLAASQDKAKTAIEMTLYLSGLRDSQYGSEQWSLQDTSREIFLAPPDHTFKKGGQTIEVIYDEDPNNSTRHTVWRHIYYQN-GDNRWRKAASDVDVHGVFYLEYDGV.KNYYVDFQEEANRYSK-TGRYTVQYEGKRFTNVMSPVN
VE2_HPV1A/1-203 MENLSSRLDLLQEQLMNLYEQDSKLIEDQIKQWNLIRQEQVLFHFARKNGVMRIGLQAVPSLASSQEKAKTAIEMVLHLESLKDSPYGTEDWSLQDTSRELFLAPPAGTFKKSGSTLEVTYDNNPDNQTRHTIWNHVYYQN-GDDVWRKVSSGVDAVGVYYLEHDGY.KNYYVLFAEEASKYST-TGQYAVNYRGKRFTNVMSSTS
VE2_CRPVK/1-203 MEALSQRLDSIQEELLSLYEKESTSLESQLQHWNLLRKEQVLLHFCKKHGIRQLGYTPVPSLLTSQECAKQAIEMVLYIESLLRSPYSDEPWTLQDTSRERFESPPQKTFKKNPAIVEVYYDGDRGNNNEYTLWGIFIIGN-ADGEWVKTESGVDYRGIYYVDSEGN.YVYYVDFSTDAGRFAA-NGHYDVVFQNMRLSSSVTSSP
VE2_HPV49/1-202 MEALNARFNVLQEMLMDIYESGKEDLETQIEHWKLLRQEQALLFFARKHSIMRLGYQPVPPMAVSETKAKQAIGMMLTLQSLQKSPFGKEKWTLVNTSLETYNAPPAQCFKKGPYNIEVIFDGDPENLMVYTAWKEIYFVD-SDDMWQKVQGEVDYAGAYYKDGT-I.KQYYVTFADDAVRYGT-SGQYEVRINNETVFAPVTSST
VE2_HPV09/1-202 METLSARFNALQETLMDLYESGREDLQSQIDHWQTLRQEQILLHYARKNGVMRLGYQPVPPLATSEQKAKDAIGMVLLLQSLQRSAYGQEPWTLAQTSLEAVRSPPAYAFKKGPQNIEVVYDGDPDNVMSYTIWNFIYYQT-VNDTWEKVQGHVDYFGAYYFEGT-V.KTYYINFDKDAARYGR-TGVWEVHVNKDIVFAPVTSSS
VE2_HPV05/1-202 MENLSERFNALQDQLMNIYEAAEQTLQAQIKHWQTLRKEPVLLYYAREKGVTRLGYQPVPVKAVSETKAKEAIAMVLQLESLQTSDFAHEPWTLVDTSIETFRSAPEGHFKKGPLPVEVIYDNDPDNANLYTMWTYVYYMD-ADDKWHKARSGVNHIGIYYLQGT-F.KNYYVLFADDAKRYGT-TGEWEVKVNKETVFAPVTSST
VE2_HPV04/1-203 MESLVARFDALQEAILTHIESQESTLESQIQYWENIRKENAIMHYARKQGLTKLGLQPLPTLAVTEYNAKQAIQIHLTLQSLLKSPFASERWTLTDVSAELINTSPQNCLKKGGYDVAVWFDNDRQNAMLYTNWDFLYYQD-MNEQWHKVKGEVDYDGLYFTDHTGE.RAYFTLFSSDAQRFSR-TGLWTVHFKTQVISSPIVSST
VE2_HPV52/1-201 MESIPARLNAVQEKILDLYEADSNDLNAQIEHWKLTRMECVLFYKAKELGITHIGHQVVPPMAVSKAKACQAIELQLALEALNKTQYSTDGWTLQQTSLEMWRAEPQKYFKKHGYTITVQYDNDKNNTMDYTNWKEIYLLGECE--CTIVEGQVDYYGLYYWC-DGE.KIYFVKFSNDAKQYCV-TGVWEVHVGGQVIVCPASVSS
VE2_HPV33/1-201 MEEISARLNAVQEKILDLYEADKTDLPSQIEHWKLIRMECALLYTAKQMGFSHLCHQVVPSLLASKTKAFQVIELQMALETLSKSQYSTSQWTLQQTSLEVWLCEPPKCFKKQGETVTVQYDNDKKNTMDYTNWGEIYIIEEDT--CTMVTGKVDYIGMYYIH-NCE.KVYFKYFKEDAAKYSK-TQMWEVHVGGQVIVCPTSISS
VE2_HPV35/2-202 METLSQRLSVCQDKILEHYETDSTCLSDHIQYWKLIRLECAVFYKAREMGIKTLNHQVVPTQAISKAKAMQAIELQLMLETLNTTEYSTETWTLQETSIELYTTVPQGCFKKHGVTVEVQFDGDKQNTMHYTNWTHIYILEDSI--CTVVKGLVNYKGIYYVH-QGV.ETYYVTFREEAKKYGK-KNIWEVHVGGQVIVCPESVFS
VE2_HPV16/1-201 METLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLECAIYYKAREMGFKHINHQVVPTLAVSKNKALQAIELQLTLETIYNSQYSNEKWTLQDVSLEVYLTAPTGCIKKHGYTVEVQFDGDICNTMHYTNWTHIYICEEAS--VTVVEGQVDYYGLYYVH-EGI.RTYFVQFKDDAEKYSK-NKVWEVHAGGQVILCPTSVFS
VE2_HPV51/1-200 METLCHRLNVCQEKILDCYELDSDKLVDQINYWTLLRYEAAMFYAARERNLRTINHQVVPATTVSKQKACQAIEMHMALQSLNKSDYNMEPWTMRETCYELWCVAPKQCFKKGGITVTVIFDGNKDNAMDYTSWKFIYIYDNDK--WVKTNGNVDYTGIYYTV-NSK.KEYYVQFKDEAKIYG--AQQWEVYMYGTVITCPEYVSS
VE2_HPV26/1-201 MENLCQRLNACQEKILDYYELDSNKLTDQIDYWKLVRYECAIFYKAREGNMQCINHQVVPSTVVCKQKAWQAIEIHIALQSLINTDYNTEAWTMRDTSYEMYMTEPKHCFKKEGTTVTVVFDCNKENTMDYIRWKYVYYKTDIG--WCKGTGDVDAKGIYYTQ-GAY.KQYYVDFKQEAEKYGT-GVQWAVHVCGQVICCPEFVSS
VE2_HPV34/2-202 METLCKRLSACQDAILELYERDSIHLSDHIDHWKHVRLENVLLHKAREMGLQSVNQQAVPSLAVSRSKGHNAIELQLALESLNESSYNTEEWTLQQTSWEQWVTDPKQCFKKGGKTVEVRYDCDKDNTMQYVVWTFVYYWLEGK--WYKVSSHVDYNGIYYETQDNE.KVYYTQFDRDAKRYG-VKGIWDVCMGG-KVICFAPVFS
VE2_HPV30/1-201 METLCQRLDACQEKILDCFENDSKKIEDHIVYWKAVRHENVVLYKARQNNITKLRHQVVPCLQVCKAKACVAIEIQMALESLYKTEYKVEEWTLKDVCENMWHTAPKQCFKKSGKRIEVWFDGKKDNRTEYVVWQWVYYCGDNG--WTKVPSVVDYKGIYYVH-DGN.KVYYTDFNDEAVKYGY-KGTWEVHMGNESIYCPDSVSS
VE2_HPV32/1-202 METLAKRLDACQEQLLELYEEDSKHLEKHVQHWKCLRIEAALLFKAREMGYAQVGHQIVPALEISRAKAHVAIEIQLALETLLQSTFGTEPWTLQETSYEMWHAEPKKCLKKQGRTVEVVFDGNPENAMHYTAWTFIYVQTLDGT-WCKVYGHVCYAGLYYIV-DNM.KQFYCNFKNEAKKYGV-TGQWEVHDGTQVIVSPASISS
VE2_HPV11/1-201 MEAIAKRLDACQDQLLELYEENSIDIHKHIMHWKCIRLESVLLHKAKQMGLSHIGLQVVPPLTVSETKGHNAIEMQMHLESLAKTQYGVEPWTLQDTSYEMWLTPPKRCFKKQGNTVEVKFDGCEDNVMEYVVWTHIYLQDND-S-WVKVTSSVDAKGIYYTC-GQF.KTYYVNFNKEAQKYGS-TNHWEVCYGSTVICSPASVSS
VE2_HPV07/1-201 MEKLARRLDLCQEQLLELYEQDSKQLQHHILHWKYIRYESVIYYTARQMGIKRLGHQVVPSLDVSKAKAHAAIEMQMCLESLQTTEYNLEPWTLQDTSQELWLAEPKKCFKKGGKTVEVRFDCNEHNAMHYTLWTAVYVQVED-T-WTKVEGQVDHRGLFYTV-HGC.TTYYVDFGKEAHTYGK-TNDWTVIVGSRVICSPSTVEG
VE2_HPV27/1-203 METLANRLDACQETLLELYEKDSNKLEDQIKHWAQVRLENVMLFKARECGMTRVGCTTVPALTVSKAKACQAIEVQLALQTLMQSAYSTEAWTLRDTCLEMWDAPPKKCWKKKGLSVLVKFDGSSDRDMIYTGWHHIYVQDANDDTWHKVPGKVDELGLYYEH-DGV.RVNYVDFGTESLTYG-VTGTWEVHVAGRVIHHTSASVS
VE2_HPV03/1-203 METLANRLDVCQDKILELYEKDSDKLEDQIMHWQLMRLEQALLYKARECGLTHIGHQVVPPLSVTKAKARSAIEVHVSLQQLQHSAHAQDPWTLRDTSREMWDTVPKKCWKKRGLTVEVRYDGDENKAMCYVQWREIIVQNYTDDNWVKVAGLVSHEGLYYMH-EGQ.KTFYVKFKDDARVYG-DTGTWDVHVGGKVIHHDSFDPV
VE2_HPV41/4-206 MERLLERLDYIQEQILTLYEKDSVDLEDHIRLWNLLRRENAIWYVLRQEGHARVGGRAVPAMTVSEANAKFAIEMQIKLESLKASPYAAEGWSLQETTKERYLAEPSRTFKKLGQPVTLMFDNDPENLTEVVLWKWVYYITPTDE-WYKARGGIDDTGIYYIDHESV.KMYYVRFDMEAENFSE-TGTVTYRLGSALVNVPEPVTV