EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00505 alignment
(30 sequences with 71 aa)


UBF1_HUMAN/112-180 PKKPLTPYFRFFMEKRAKYAKLHP..EMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFR
TFAM_HUMAN/50-118 PKKPVSSYLRFSKEQLPIFKAQNP..DAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFK
TFAM_MOUSE/49-117 PKKPMSSYLRFSTEQLPKFKAKHP..DAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYK
SSRP_HUMAN/547-615 PKRPMSAYMLWLNASREKIKSDHP..GISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYE
HMG1A_CHITE/5-71 PKRPLSAYMLWLNSARESIKKENP..DFKVTEIAKKGGELWRGMKD--KSEWEAKAAKMKEEYEKAMKEFE
SSRP_DROME/555-621 PKRATTAFMLWLNDTRESIKRENP..GIKVTEIAKKGGEMWKELKD--KSKWEDAAAKDKQRYHDEMRNYK
ABF2_YEAST/43-111 PKRPTSAYFLYLQDHRSQFVKENP..TLRPAEISKIAGEKWQNLEADIKEKYISERKKLYSEYQKAKKEFD
HMGL_WHEAT/42-111 PKRAPSAFFVFMGEFREEFKQKNP.kNKSVAAVGKAAGERWKSLSESEKAPYVAKANKLKGEYNKAIAAYN
HMGL_VICFA/45-114 PKRPPSAFFVFMADFREQYKKDHP.nNKSVAAVGKACGEEWKSLSEEEKAPYVDRALKKKEEYEITLQAYN
HMGL_IPONI/36-105 PKRPPSAFFVFMEDFRKTYKEKHP.nNKSVAVVGKAGGDKWKQLTAAEKAPFISKAEKRKQEYEKNLQAYN
HMGL_SOYBN/44-113 PKRPPSAFFVFMEEFRKVFNKEHP.eNKAVSAVGKAAGAKWKTMSDAEKAPYVAKSEKRKVEYEKNMRAYN
HMGH_STRPU/100-168 PKRNLSAFFIFSGENRAAIKSVHP..NWSVGDIAKELAVRWRAMTAGEKIPFDKGAAKDKERYIKAMAEYK
HMG1_RAT/94-162 PKRPPSAFFLFCSEYRPKIKGEHP..GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYR
NHP6A_YEAST/21-89 PKRALSAYMFFANENRDIVRSENP..DITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYN
NHP1_BABBO/23-93 PKRALSSYMFFAKEKRVEIIAENPeiAKDVAAIGKMIGAAWNALSDEEKKPYERMSDEDRVRYEREKAEYA
HMGH_IRV6/54-122 PKRNKSSYLFFCQEIRPSIVAEMP..DIKPNQVMVHLGKKWSELPLEDRKKYDVMAVEDRKRYLASKEANK
HMG_TETPY/11-79 PKRPLSAFFLFKQHNYDQVKKENP..NAKITELTSMIAEKWKHVTEKEKKKYEGLQQEAKAKYEKDMQAYE
HMGB_TETTH/18-86 PKRPQTGFFIYKSEVFAKRRTECP..TLKVPEIVSKISEEYKALPEKEKQKYEEAYRKEKATYDKQNDQWK
HMGL_TRYBR/118-186 PKPAVSSYLLFVADQREELKAKNP..GMQNTAILQTLGKMWSDASDDVKEHYRKKAEEDKARFRREVDEYK
SRY_GORGO/60-128 VKRPMNAFIVWSRDQRRKMALENP..RMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYK
SOX2_CHICK/39-107 VKRPMNAFMVWSRGQRRKMAQENP..KMHNSEISKRLGAEWKLLSEAEKRPFIDEAKRLRALHMKEHPDYK
SOX9_CHICK/106-174 VKRPMNAFMVWAQAARRKLADQYP..HLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKDHPDYK
SOX4_HUMAN/59-127 IKRPMNAFMVWSQIERRKIMEQSP..DMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYK
MAT2_COCHE/131-199 APRPMNCWIIFRDAMHKHLKAEFP..HLTIQEISTRCSHIWHNLSPEAKKPWQDAAQSAKEEHLRQHPNYK
LEF1_MOUSE/297-365 IKKPLNAFMLYMKEMRANVVAECT..LKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWS
SMR2_PODAN/161-229 IRRPRNQFIIYRQWMSARLHEDNP..GLTAGAISSIVAKAWKGETPQVKAHFKALAVEEDRKHKLAYPGYR
MATD_NEUCR/147-215 TSRPRNQFVLYYQWLLDTLFSEDP..SLSARNISQIVAGLWNSEHPAAKARFRELAEMEVHRHRAENPHLY
MTMC_SCHPO/103-171 TPRPPNAFILYRKEKHATLLKSNP..SINNSQVSKLVGEMWRNESKEVRMRYFKMSEFYKAQHQKMYPGYK
MATB_NEUCR/116-184 IPRPPNAYILYRKDHHREIREQNP..GLHNNEISVIVGNMWRDEQPHIREKYFNMSNEIKTRLLLENPDYR
FPR1_PODAN/169-237 IPRPPNAYILYRKDQQAALKAANP..GIPNNDISVMTGGMWKKESPEVRAEYQRRASEIKAKLMSAHPHYR