EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00460 alignment
(16 sequences with 32 aa)


FLHP_BACSU/5-35 MLTASTTLNQLQQQIDTISSNLSNSN-TTGYK
FLHO_BACSU/5-35 LYTATSAMIAQQRRTEMLSNNIANAN-TSGYK
FLGG_CAUCR/4-34 LRTAASGMAAQQLNVEVISNNIANMN-TVGFK
FLGG_SALTY/5-35 LWIAKTGLDAQQTNMDVIANNLANVS-TNGFK
FLGG_BACSU/5-35 LYSGISGMKNFQTKLDVIGNNIANVN-TVGFK
FLGE_SALTY/2-32 FSQAVSGLNAAATNLDVIGNNIANSA-TYGFK
FLGE_CAUCR/7-37 MLAGVSGLIANSSALAAISDNIANVN-TVGFK
FLGF_CAUCR/5-35 LYVGLSRQMTLRRELDIVANNIANAN-TTGFK
FLGK_SALTY/4-34 INHAMSGLNAAQAALNTVSNNINNYN-VAGYT
FLGK_BACSU/8-38 LETARRALSAQQAALSTTANNVANAN-TDGYT
FLGC_SALTY/7-38 FDIAGSALAAQSKRLNVAASNLANADSVTGPD
FLGC_BACSU/7-37 LNVSASALTAQRVRMDVVSSNLANMD-TTRAK
FLGF_SALTY/5-35 IYTAMGAASQTLNQQAVTASNLANAS-TPGFR
FLGB_BACSU/8-38 IQNLENALSRADIKQKVITNNIANID-TPNYK
FLGB_SALTY/8-38 LRFQQEALNLRAQRQEILAANIANAD-TPGYQ
FLA1_BORBU/173-204 LRVHVGANQDEAIAVNIYAANVANLFSGEGAQ