EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00440 alignment
(112 sequences with 49 aa)


Q51730_PSEFL/22-68 IIISAIETLK.ECGYSGLSIEAVARRAGASKPTIYRWWG.NKAALIAEV
P72185_9ACTO/45-91 ILDAGWRELA.GAGYAGLTFEAVAERAHTGKAALYRRWP.NKESLVLAV
O50423_MYCTU/23-69 LYDATLAELE.SAGYGGLTMEGIAARAQTGKAALYRRWA.GKRELVLAA
Q54288_STRHY/25-71 ITEAAFAELA.DAGYARMSMESVARRAGVGKAALYRRWP.SKQAMVTEL
Y1581_MYCBO/25-71 LLAVTLRLLQ.EHGYDRLTVDAVAASARASKATVYRRWP.SKAELVLAA
O53317_MYCTU/26-72 ILSATAELLV.QIGYSNLSLAAVAERAGTTKSALYRRWS.SKAELVHEA
Q9ZFC1_MYCSM/18-64 LLDAAEALMI.DEGYAAVTSRRVAERAGLKPQLVHYYFR.TMDDLFLAV
O54102_STRCO/20-66 LIDAAEELLE.EGGAEALTAGAVAARAGIARNSIYRYFN.SIDDLLELV
O69909_STRCO/12-58 LLDAARSLLS.DGGTEALTFPALAERTGLARSSVYEYFR.SRAAVVEEL
Y790_MYCBO/35-81 VLAAAMATLR.EKSYADLTVRLVAARAKVAPATAYTYFS.SKNHLIAEV
P96856_MYCTU/21-67 ILDATMAIAS.KGGYEAVQMRAVADRADVAVGTLYRYFP.SKVHLLVSA
YDH1_XANAU/20-66 ILDVALELLE.TEGEFGLTMRQVATQADMSLSNVQYYFK.SEDLLLVAM
O32228_BACSU/5-50 ILAETFRLIK.QKGFS-FTMNDLAAALGTSKRTLYAYYS.SKDQLVEAV
O07254_MYCTU/13-59 IVAASARVFI.AHGYQRTQVQDVADALALAKGTLYGYAQ.GKAALFAAA
O87854_STRCO/12-58 ILDAAAELLL.AGDAETFSVRKLAASLGTDSSSLYRHFR.NKTELLRAV
Q9Z480_9RHIZ/8-54 IVDEALRLLN.EVGIDKLSTRKLAERLGVQQPALYWHFR.NKAELLDAI
TER3_ECOLI/9-55 VIRTALELLN.DVGMEGLTTRRLAERLGVQQPALYWHFK.NKRALLDAL
TER4_ECOLI/8-54 VIDAALELLN.ETGIDGLTTRKLAQKLGIEQPTLYWHVK.NKRALLDAL
TER5_ECOLI/9-55 VISMALTLLD.SEGLEGLTTRKLAQSLKIEQPTLYWHVR.NKQTLMNML
Q9Z551_STRCO/18-64 IVATARELAE.QQGWDAVTTRRLAERIEYSQPVLYSHFR.GKREIIGAV
O52558_AMYMD/34-80 IVATAVRVLD.AEGDAKFSMRLLAEELNVTPMSVYWYVA.NKDDLLELA
Q53901_STRCO/36-82 IVVTALGILD.AEGLDALSMRRLAQELKTGHASLYAHVG.NRDELLDLV
Y1388_MYCBO/21-67 IISGAFELAQ.QVSIDNLSMPLLGKHLGVGVTSIYWYFR.KKDDLLNAM
O53165_MYCTU/16-62 ILDGARRCFA.EYGYDKATVRRLEQAIGMSRGAIFHHFR.DKDALFFAL
O54185_STRCO/76-120 ILATARRELG.-RNPD-TTLEELARAAGVVRRTLFGHFP.GRAALLEAL
TTK_ECOLI/16-62 LQSLALMLES.SDGSQRITTAKLAASVGVSEAALYRHFP.SKTRMFDSL
TTK_HAEIN/36-82 LTVLIHMLHS.ERGMERMTTARLAKEVGVSEAALYRYFP.SKTKMFEAL
O08335_BACSU/12-58 IMKASVSLFT.ERGFDATTIPMIAERAHVGTGTIYRYFD.SKETLVNVL
BM3R_BACME/11-57 IFSASLLLFA.ERGFDATTMPMIAENAKVGAGTIYRYFK.NKESLVNEL
Q59306_CLOPA/8-54 IFYSAIKVFS.NNGYNGATMDEIASNAGVAKGTLYYHFK.SKEEIFKYI
YHGD_BACSU/9-55 ILEAATKSFT.QFGYKATTMDLVAKLANVGKGTIYTFFK.NKEELFDEI
O27135_METTH/17-63 IIRAAEKAFF.ARGYDRVTMDEIAEEAEVNKALLYYYFK.NKESLFFAV
O34643_BACSU/8-54 ILDAAMQLLV.KKGYRATTTKEIAEKANVSEATIFRNFK.NKQGLVEAL
O27815_METTH/18-64 ITNAARELFI.KRGYRGTATREIASRAGVSEVTVFRKFG.SKKNLLKRI
P73186_SYNY3/47-93 ILKGALKLFG.TKGYEGTTTKDLAQAANVAEGTLFRYFT.NKKAILVEV
Q59213_BACME/8-54 ILGHTHQLFM.EKGYVDTSVQDILERSGISKGTFYKYFS.SKSELLISL
O53054_LISIV/8-54 IIKSAKEVFQ.KQGYLKTSVQDIVDAAEISKGTFYNYFT.SKEELAIVI
O67157_AQUAE/7-53 ILEVSKELFF.EKGYQGTSVEEIVKRANLSKGAFYFHFK.SKEELITEI
QACR_STAAM/7-53 ILGVAKELFI.KNGYNATTTGEIVKLSESSKGNLYYHFK.TKENLFLEI
O66658_AQUAE/15-61 IMRVACKLFA.QKGYHNTTMPDIAKALGMSVGNLYNYFS.SKEELAKEI
P94423_BACSU/8-54 ILLAARKLFS.EKDFTSVSMQAIAEECKMSKASIYKLFQ.SKEDLLLEL
O67927_AQUAE/18-64 ILSSALKLFS.KKGFKETTIKDIAKEVGITEGAIYRHFT.SKEEIIKSL
YERO_BACSU/8-54 IIKTSIRLFA.KKGFAATTIQEIASECGISKGAFYLHFK.SKEALLLSA
YUXN_BACSU/8-54 IIETALKLFA.QKGYNSTSVQEIAKECKISKGAFYIYFP.SKEALLLSM
O34619_BACSU/10-57 ILSAATRLFQ.LQGYYGTGLNQIIKESGAPKGSLYYHFPgGKEQLAIEA
YXAF_BACSU/11-58 ILHTASRLSQ.LQGYHATGLNQIVKESGAPKGSLYHFFPnGKEELAIEA
O85706_CLOAB/14-60 LIECAAKLFL.QKGYNGTGINDILSGTGLPKGSFYFHFA.SKKDLAISV
YPB3_LACLA/13-59 ILTATEQLIY.KKGYTGTSINDILDETATGKGQFYYYFD.SKKEACLAV
Q9ZN97_ECOLI/22-68 LLKVAYRFFV.DKGFKNTSLEDITSSVGIAKSSFYIFFE.SKEILYMEL
Q9Z601_NOSPU/12-57 ILEAARQVFL.QQGFGAS-TLEIAQQAGISEASIFKRFS.TKEELFFAA
Q9Z3X8_9PSED/7-53 ILECALQLFN.QKGEPNVSTMEVANEMGISPGNLYYHFH.GKEPLILGL
Q51516_PSEAE/7-53 ILECSLLLFN.EQGEPNVSTLEIANELGISPGNLYYHFH.GKEPLVMAL
Q9ZGB7_STRCY/16-62 IQSVALELFI.ERGYEKTSMREIAEGLGITKAALYYHFK.AKEEILVAI
O08306_NOCSI/21-64 ILAAATRLFA.THGVSGTSLQQIADAAGITKAAVYHHFP.TKEEVV---
O53310_MYCTU/15-61 ILGAAAELIA.LRGYSSTSTRDIAAAVGVEQPAIYKHFS.AKRDILAAL
P95251_MYCTU/19-65 ILDQAVGLFI.ERGFHSVKLEDIAEAAGVTARALYRHYD.NKQALLAEA
O06169_MYCTU/30-76 LLAAAERLFA.ERGFLAVRLEDIGAAAGVSGPAIYRHFP.NKESLLVEL
O68442_9RHIZ/15-61 ILQAAETLFL.DKGYDNVSLEEIAALSGVTRGAIHWHFK.NKHGLLLAL
MTRR_NEIGO/15-61 LMLAALETFY.RKGIARTSLNEIAQAAGVTRGALYWHFK.NKEDLFDAL
ACRR_ECOLI/16-62 ILDVALRLFS.QQGVSSTSLGEIAKAAGVTRGAIYWHFK.DKSDLFSEI
ENVR_ECOLI/16-62 LIETAIAQFA.QHGVSKTTLNDIADAANVTRGAIYWHFE.NKTQLFNEM
Q9ZHP8_STRFR/13-59 TIVAAAAVFD.ELGYEATTIAEILKRSGVTKGALYFHFT.SKEQLAQEV
O86852_STRCO/14-60 ILDAAAQVFE.KQGYQAATITEILKVAGVTKGALYFHFQ.SKEELALGV
O66121_STRCO/14-60 IVRAAADLFD.RHGYESTSLSEIVAHAGVTKGALYFHFA.AKEDLAHAI
AFRP_STRGR/14-60 IVDAAASVFD.DYGYERAAISEILRRAKVTKGALYFHFA.SKEAIAQAI
O24739_STRVG/15-61 LVLSAAEAFD.RQGFATASLTAISNSAGVSNGALHFHFE.SKEALAAAV
TETC_ECOLI/18-64 LVNSARILFV.EKGYQAVSIDEISGKALVTKGAFYHHFK.NKKQLLSAC
O05858_MYCTU/44-90 LLVVASDVFV.DRGYHAAGMDEIADRAGVSKPVLYQHFS.SKLELYLAV
O53612_MYCTU/19-64 VLEVAYQTFA.ADGLS-VPVDEIARRAGVGAGTVYRHFP.TKEALFQAV
P94548_BACSU/11-57 IIDAAVEVIA.ENGYHQSQVSKIAKQAGVADGTIYLYFK.NKEDILISL
O08377_MYCTU/24-70 ILAAAKIVFA.HKGFHATTVADIAKQAGLAYGLIYWYFD.SKDDLFHAL
P96701_BACSU/12-58 LLKAAANEFS.VRGFHDAKVSEIVKKAGFTQPSFYLYFQ.SKEAIFAEL
O66635_AQUAE/12-58 IIKAAAKEFA.EKGFYNTQISHIVESAGVARGTFYIYFK.SKEEVFEEI
O07001_BACSU/12-58 ILQAAIEVIS.EKGLDKASISDIVKKAGTAQGTFYLYFS.SKNALIPAI
UIDR_ECOLI/16-62 ILNAAREIFS.ENGFHSASMKAICKSCAISPGTLYHHFI.SKEALIQAI
O31560_BACSU/17-63 ILEAAKTVFK.RKGFELTTMKDVVEESGFSRGGVYLYFS.STEEMFRRI
O69500_MYCLE/17-63 MLDAAVQMFS.VNGYHKTSMDAIAAEAQISKPMLYLYYG.SKEDLFGAC
O53323_MYCTU/22-68 ILKAAAELFY.CEGINATGVELIANKASVSKRTLYQHFP.SKSALVEEY
O86514_STRCO/19-65 VLAAAERLFY.EHGIHAVGVDTIAAEAGVTKKTLYDRFG.SKEQIVVEY
P96839_MYCTU/15-61 LLELAAAMFA.ERGLRATTVRDIADGAGILSGSLYHHFA.SKEEMVDEL
P96812_MYCTU/20-66 LLDGLVASIG.ERGYRATTVSDIVRHARTSKRTFYDRFT.SKEQCFLEL
P95251_MYCTU/223-269 LLAAGARLFR.AQGYPAVNTSEIGKGAGIAGPGLYRSFS.SKQAILDAL
O07229_MYCTU/19-65 ILDATERLMA.TKGYAATSISDIRDACGLAPSSIYWHFG.SKEGVLAAM
YJGJ_ECOLI/21-67 AISAAKVLFH.QKGFDAVSVAEVTDYLGINPPSLYAAFG.SKAGLFSRV
YCFQ_ECOLI/24-70 ALDKAMKLFW.QHGYEATSLADLVEATGAKAPTLYAEFT.NKEGLFRAV
P96821_MYCTU/93-139 ILHAARQVFS.ERGYDGATFQEIAVRADLTRPAINHYFA.NKRVLYQEV
O53119_MYCLE/19-65 LTLARHRLWR.LRGYAEVGTPEIAKEADTTRGAVYHQFT.DKAALFRDV
O53623_MYCTU/19-65 LITGARKLWG.LRGYAEVGTPEIATEAGVTRGAMYHQFA.DKAALFRDV
P72624_SYNY3/24-70 ILDRARHLFA.TKGYAATGTEEIISELAITRGALYHQFG.DKRGLFKAV
O07252_MYCTU/11-57 LLDGALACLR.ERGYGNTSSRDIARAAGVNIASINYHFG.SKDALLDDA
YBIH_ECOLI/17-62 LIAAALAQFG.EYGMNAT-TREIAAQAGQNIAAITYYFG.SKEDLYLAC
BETI_RHIME/14-60 LVDAALRVIG.DQGTLAVTMSEIARTAGVSPALAHHYFG.SKEQLLIAT
BETI_ECOLI/14-60 LIDATLEAIN.EVGMHDATIAQIARRAGVSTGIISHYFR.DKNGLLEAT
O33453_PSEPU/19-65 LIAAALGVLR.EKGYAGFRIADVPGAAGVSRGAQSHHFP.TKLELLLAT
O28458_ARCFU/8-54 IIEAALRLYM.KKPPHEVSIEEIAREAKVSKSLIFYHFE.SKQKLLEEA
O86312_MYCTU/12-57 IREAAIEQFG.RHGFGVG-LRAIAEAAGVSAALVIHHFG.SKEGLRKAC
LUXR_VIBHA/21-67 LMEIALEVFA.RRGIGRGGHADIAEIAQVSVATVFNYFP.TREDLVDEV
O33187_MYCTU/24-70 ILSSARELFA.HNGIDRTSIRAVAAKAGVDAALVHHYFG.TKQQLFAAA
Y3439_MYCBO/23-69 ILQAATDLFA.ERGPAATSIRDIAARSKVNHGLVFRHFG.TKDQLVGAV
TCMR_STRGA/32-78 LIREALELFL.AQGYEHTTVEQIAEAVEVHPRTFFRHFA.SKEEVALTP
Q53772_STAAU/14-60 IIQYAFDSIV.EKGVKGSTVRQIAKLADMTPGQIRYYFP.NHSELLNAV
YTTP_BACSU/9-55 IIESAVMLFN.QKGFSGTSVREIAKSADVNVAHISYYFK.GKGGLMEHL
Q55363_SYNY3/17-63 LLTAANQVIV.SQGVDALTLDAVASEAGVSKGGLLHYFP.TKEALIAGM
O86510_STRCO/15-61 VLAAAMEMIA.ERGLEKLTMAALGREVGMSSGHLLYYFG.SKDELLLRT
PKSA_BACSU/14-57 IAEATWRVIL.ERGMEGASARNIAKEAGLSLGALRHYFS.TQDELL---
Y893_HAEIN/12-58 IFSATDRLMA.REGLNQLSMLKLAKEANVAAGTIYLYFK.NKDELLEQF
P96222_MYCTU/29-75 ILATAENLLE.DRPLADISVDDLAKGAGISRPTFYFYFP.SKEAVLLTL
P95100_MYCTU/26-72 ILRAARELLE.ETPFAELSVRAISLRAGVARSGFYFYFD.SKYSVLAQI
YWCC_BACSU/17-63 FIDAGVNLLI.DRAYDPVSVEDISRAAGYSKGAFYVHFV.SKDDFLLYL
O53295_MYCTU/35-80 -IVDAAFRAI.DRLGPELSVRQIAEEAGTAKPKIYRHFT.DKSDLLEAI
YIJC_ECOLI/15-62 LVEAAFSQLSaERSFASLSLREVAREAGIAPTSFYRHFR.DVDELGLTM
O67930_AQUAE/8-54 ILKVGAEVIA.HEGLRRFTAKNLASKIGISDAAIFKHFS.SMEEIAEEI