EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00426 alignment
(7 sequences with 790 aa)


VP4_ROTPC/1-736 MASSLYQQLISQNYYSIGNEILTDQQTTETVVDYVDAGNYTYAQLPPTKWGARGTFKSAFNVSNITGPHTNTIIEWSNLLNSNGWVIYQKPANTTKLFKHGPETYNSNLAAFELWYGKAGTSVTSDYYSSLQNNEKTVTATSDSLILFWNEGSTVLANKKVNFSWDMGGMLIKPTRGNRVDICMANMNDFNSSIFNWEEWKHEFPRSDVNINVNMYTDYYLASE--DPYT--ELKALQQ-PNITTFEMKMMKIIR-NGSINLNEVVSKDSLWQEVRYARDITLECKIESEVVKGGGWGYDYTSVAFKTVNHTYTYTRAGEIVNAHVTISFNNMKERSY-GGSLPTDFKIGRFDVIDTDTYMYIDYWDDSEIFKNMVYVRDLSANIGGFFYYAEMSYYFQIPVGAHPGLHSSGVRFVYERCLLSQQFTDQVALNSMRFIFRVTESNGWFMTSGNINTRRIASGTGFAYADG--HTSQTVGNITFISLIPSNPNYQTPIASSSTVRMDLERKINDLRNDFNQLANSVALGDILSLATSPLTFANLLESVPAIASSVKDVAANVMKKFRN----------TKMFKKATKAK------------YSEFIIGD-LLEDVTN--------------------VARNSNG.MNFDDITSAVMVSTTNKLQLTDVDTLSEIVARSADNFIPNRSYRMIEDGIVYEATPK-RTFSYDLTTLQQREFDIDKFMRLASKSPVISAIVDFATLKAMRETYGVGTDVIYKLVASDAPTILSFIDNNNPLIKSRIEELLRQCRL
VP4_ROTB9/1-770 MASLVYRQLLANSYTSDLQDTIDDISAQKTENVTVNPGPFAQTGYALVEWTHGDITTDETVQQTLDGPY-----APSSVIIQPQYWVLMNPETADVIAEA---DATN-KKYACVMLAPNTEEGDKQYTILGRQITINLGNTDQNRYKFFDLASENGE-TYSKIQELLTPNRLNAFMKDQ-GRLYVYHGTVPNISTGYYTLDD-IANVQTNIKCNYYIVPKSQTQQLEDFLKNGLPPIQESRYIMPVERSVQNIY--RAKPNEDIVISKTSLWKEMQYNRDIVIRFKFGNTIIKSGGLGYKWSEISYKPMNYEYTYERDGETVVAHTTCSVAGVNDFGYNSGSLPTDFVVSKYEVLKGNSYVYIDYWDDSQAFKNMVYVRSLSAE-FNAINCTGGTYDFQLPVGQWPQMRGGNVTLNSDAVTLSTQYTDFVSLNSLRFRFKPAIGEPFFEITRTRETRLY--GLPASNPMGGNEYYETAGRFSLISLVPSNDDYQTPIQNSTTVRQDLEQQISDLREEFNQLSSEIAMSQLIDLALLPLDMFSMFSGIKSTIDAVKSVTTSVMKKMKTSTLAKSVSTITEELSDAATSVSRASSIRSN---ASVWNNLVDTRTQTSVATNDIATQTSRIASKLRVKEFATQTEGgLSFNDISAAVLKTKIDKIETVQPKILPTIITESVDKFIPTRQYRIIDKDIAYEISNSGKYFAYRVDTFEEVIFDVEKFADLVTDSPVISAIIDFKTLKNLNDNFGITKEQAYNLLRSDPRVLKDFINQNNPIIRNRIEQLILQCRI
VP4_ROTF1/1-775 MASLIYRQLLSNSYVTNISDEVNEIGTKKTTNVTVNPGPFAQTGYAPVDWGHGELPDSTLVQPTLDGPY-----QPTSLNLPVDYWMLIAPTREGRVAEG---TNTTDRWFACVLVEPNVQNTQRQYVLDGQNVQLQVSNDSSTSWKFILFIKLTPDGTYTQYSTLSTPHKLCSWMKRD-NRVYWYQGSSPNASESYYLTIN-NDNSNVSSDAEFYLIPQSQTAMCTQYINNGLPPIQNTRNIVPVNIASRQIKDIRAQMNEDIVISKTSLWKEMQYNRDIIIRFKFANSIIKSGGLGYKWSEISFKPMNYQYTYTRDGEEVTAHTTCSVNGVNDFNYNGGTLPTDFAISRFEVIKENSYVYVDYWDDSQAFRNMVYVRSLAAN-LNDVVCSGGSYSFALPVGNHPVMSGGAVTLTSAGVTLSTQYTDYVSLNSLRFRFRLAVSEPSFSISRTRMSGIY--GLPAVNPNNNAEYYEIAGRFSLISLVPTNDDYQTPIANSVTVRQDLERQLGELREEFNSLSQEIAVSQLIDLATLPLDMFSMFSGIKSTVEAVKSMTTNVMKRFKTSSLANAISDLTSNMSEAASSV-RLTSVRSIGTVTLPRARVSLQVSDDLRSMQDVSTQVSNVSRNLRLKEFTTQTDT.LSFDDISAAVLKTKLDKSTQISQQTMPDIIAESSEKFIPKRSYRIVDEDTAFETGIDGTFYAYKVDTFNEIPFDMERFNKLITDSPVLSAIIDFKTLKNLNDNYGITKKQAMELLHSNPKTLKEFINNNNPIIRNRIENLISQCRL
VP4_ROTH5/1-775 MASLIYRQLLTNSYSVDLHDEIEQIGSEKTQSVTVNPGPFAQTRYAPVNWGHGEINDSTTVEPVLDGPY-----QPTTFKPPNDYWFLISSNTDGVVYES---TNNNDFWTAVIAVEPHVSQTNRQYILFGENKQFNVENNS-DKWKFFEMFKGSSQGDFSNRRTLTSNNRLVGMLKYG-GRVWTFHGETPRATTDSSNTAD-LNNISIMIHSEFYIIPRSQESKCNEYIKNGLPPIQNTRNVVPLSLSSRSIQYRRAQVNEDITISKTSLWKEMQYNRDIIIRFKFGNSVIKLGGLGYKWSEISYKAANYQYSYSRDGEQVTAHTTCSVNGVNNFSYNGGSLPTDFSISRYEVSKENSYVYIDYWDDSKAFRNMVYVRSLAAN-LNSVKCTGGSYDFRLPVGGWPIMNGGAVSLHFAGVTLSTQFTDFVSLNSLRFRFSLTVDEPSFSIIRTRTINLY--GLPAANPNNGNEYYEMSGRFSLISLVLTNDDYQTPIMNSVTVRQDLERQLNDLREEFNSLSQEIAMSQLIDLALLPLDMFSMFSGIKSTIDLTKSMATSVMKKFRKSKLATSISEMTNSLSDAASSASRSASIRSNLSTISNWTNTSKSVSNVTDSVNDVSTQTSTISKKLRLREMITQTEG.MSFDDISAAVLKTKIDMSTQIGKNTLPDIVTEASEKFIPKRSYRVLKDNEVMEINTEGKFFAYKVDTLNEIPFDINKFAELVTDSPVISAIIDFKTLKNLNDNYGITRIEAFNLIKSNPNVLRNFINQNNPIIRNRIEQLILQCKL
VP4_ROTB4/1-776 MASLIYRQLLANSYAVDLSDEIQSVGSEKNQRVTVDPGPFAQTGYAPVNRGPGEVNDSTVVQPVLDGPY-----QPAPFDLPVGNRMLLAPTGPGVVVEG---TDNSGRWLSVILIEPGVTSETRTYTMFGSSKQVLVSNVSDTKWKLFEMMKTAVDGDYAEWGTLLSDIKIYGMMKYG-ERLFIYEGETPNARTKGYIVTN-YTSVEVRPYSDFYIISRSQESACTEYINNGLPPIQNTRNVVPLAISSRSIKPRKVQPNEDIVVSKTSLWKELQYNRDIIIRFRFDNSIIKAGGLGYKWAEISFKAANYQYNYISDGEEVTAHTTCSVNGVNDFSFNGGSLPTDFAISRYEVIKENSYVYVHYWDDSQAFRNMVYVRSLAAN-LNDVMCSGGDYSFALLVGQWPVMKGGAVTLHTAGVTLSTQFTDFVSLNSLRFRFRLSVEEPSFTITRTRVSKLY--GLPAANPNGGREYYEVAGRFSLISLVPSNDDYQTPIMNSVTVRQDLERRLNELREEFNNLSQEIAVSQLIDLAILPLDMFSMFSGIEGTVNAAKSMATNVIRKFKSSKLASSVSMLTDSLSDAASSISRSTSIRSIGSTASAWTNISKQTQDAVNEVATISSQLSQISGKLRLKEITTQTEG.MSFDDISAAVLKANIDRSIQVDKNALPDVITEASEKFIRNRAYRVIDGDEAFEASTDGRFFAYKVETLEEMPFDIEKFADLVTRSPVISAIIDFKTLKNLNDNYGITREQAFNLLRSNPKVLRGFMDQNNPIIKNRIEQLIMQCRL
VP4_ROTEH/1-776 MASLIYRQLLANSYTVDLSDEIENIGYAKSKNVTINPGPFAQTGYTPVNWGPGEVNDSTTVEPILDGPY-----QPTNFNPPVNYWMLLSPLNAGVVVEG---TNSIDRWLATVLVEPNVLTTVRTYTLFGVQEQISVENNSTTKWKFINLIKTTLSGNFTLYSTLLSEPKLHGIMKHG-GQLWVYNGETPNATTTGYVTSN-YDSLTMTSFCDFYIIPRSQESTCTEYINNGLPPIQNTRNVVSVSISSRNIILNRAQVNKDIVISKTSLWKEVQYNRDITIRFRFANAIIKSGGLGYKWSEISFKPANYQYSYTRDGEEITAHTTCSVNGVNDFSFNGGSNPTDFLISRYEVIKENSYVYVDYWDDSQAFRNMVYVRSLAAN-LNDVLCTGGDYTFALPVGQWPVMTGGAVMLHAAGVTLSTQFTDFVSLNSLRFRFSLSVEEPYFSITRTRVTRLY--GLPAVNPNNNRDYYEIAGRFSLISLVPSNDDYQTPIMNSVTVRQDLERQLGELREEFNTLSQEIAVSQLIDLALLPLDMFSMVSGIKSSIDAAKSMASNVMKKFKKSKLASSISTLTNSLSDASSSVSRNSSIRSVSSSVSAWTDVSNQLTDISNSVNSISTQTSTISRRLRLKEIATQTEG.MNFDDISAAVLKTKIDKSTQIAANNIPDIITEASEKFIPNRAYRVISNDNVFEASTDGRFFAYKVGTFEGIPFDVQKFADLVTDSPVISAIIDFKTLKNLNDNYGITREQAFNLLRSDPRVLREFINQDNPIIKNRIEQLILQCRL
VP41_ROTS1/1-776 MAALIYRQLLTNSYTVELSDEIQEIGSTKTQNVTVNPGPFAQTNYAPVNWGPGETNDSTTVEPVLDGPY-----QPTTFNPPVSYWMLLAPTNAGVVVEG---TNNTNRWLATILIEPNVQQVERTYTLFGQQVQVTVSNDSQTKWKFVDLSKQTQDGNYSQHGSLLSTPKLYGVMKHG-GKIYTYNGETPNANTGYYSTTN-FDTVNMTAYCDFYIIPLAQEAKCTEYINNGLPPIQNTRNIVPVSIVSRNIVYTRAQPNQDIVVSKTSLWKEMQYNRDIVIRFKFANSIIKSGGLGYKWSEVSFKPAFYQYTYTRDGEEVTAHTTCSVNGVNDFNYNGGSLPTDFVISKYEVIKENSFVYIDYWDDSQAFRNMVYVRSLAAD-LNSVMCTGGDYSFALPVGNYPVMTGGAVSLHSAGVTLSTQFTDFVSLNSLRFRFRLSVEEPPFSILRTRVSGLY--GLPAAKPNNSQEYYEIAGRFSLISLVPLNDDYQTPIMNSVTVRQDLERQLGELRDEFNNLSQQIAMSQLIDLALLPLDMFSMFSGIKSTIDAAKSMATNVMKRFKKSSLANSVSTLTDSLSDAASSISRSASVRSVSSTASAWTEVSNIASDINVTTSSISTQTSTISRRLRLKEMATQTDG.MNFDDISAAVLKTKIDKSTQLNTNTLPEIVTEASEKFIPNRAYRVIKDDEVLEASIDGKYFAYKVETFEEIPFDVQKFADLVTDSPVISAIIDFKTLKNLNDNYGISRQQALNLLRSDPRVLREFINQDNPIIRNRIESLIMQCRL