EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00387 alignment
(8 sequences with 128 aa)


PIPA_DROME/549-666 WLSSMVNYAQPIKFQGFDKA-IEKNIAHNMSSFAES--AGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGG-------CGYLLKPDFMR
PLCB2_HUMAN/541-658 EMSSLVNYIQPTKFVSFEFS-AQKNRSYVISSFTEL--KAYDLLSKASVQFVDYNKRQMSRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQ-------SGYLLKHEFMR
PLCB1_BOVIN/539-656 EMSNLVNYIQPVKFESFEIS-KKRNRSFEMSSFVET--KGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGK-------SGYRLKPEFMR
PIP1_DROME/598-715 EISALVNYVQPIHFSSFENA-EKKNRCYEMSSFDEK--QATTLLKERPIEFVNYNKHQLSRVYPAGTRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNAR-------SGYLLKPEFMR
PLCD1_BOVIN/430-548 ELSDMVIYCKSVHFRGFPSSGTSGQAFYEMSSFSEN--RALRLLQESGNSFVRHNVNHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGSEMDVYQGRFLDNGA-------CGYVLKPAFLR
PIPA_DICDI/538-653 EFEELI-YLVSHGFKSGNTT--KEIPSYKIHSLVEE--KVKQLVQSEPREVVEASQNHLLRVYPRGTRFDSSNFDPMPGWSIGCQLAALNQQTSSEPMWINDGMFSDNGG-------CGYVLKPPCLL
PLC1_YEAST/586-710 DVSNIS-GIHGIKFRNFSLP--ESKTIAHCFSLNERKVEYMIKDKHLKLSLDKHNRRYLMRVYPHVLRYKSSNFNPIPFWKAGVQMVATNWQTNDIGQQLNLAMFQILDHQPDGSFKSGYVLKPKKLL
PLC1_SCHPO/637-753 ELQQLAPYARSLKFRNFSLP--ESKTYSHIFSFSER--TIKKHGKAMVPRLSKHNLRYLCRVYPGPLRVGSTNFNPQVYWRLGVQMVALNWQTYDTGLQINDALFIADPP-------TGYLLKPPCQR