EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00382 alignment
(12 sequences with 74 aa)


TF3B_KLULA/193-266 IQHFAEKLELGDKKIKVIRDAVKLAQTMSRDWMYEGRRPAGIAGACLLLACRMNNLRRTHSEIVAISHVAEETL
TF3B_CANAL/190-263 IQHFVEKLDFKDKATKVAKDAVKLAHRMAADWIHEGRRPAGIAGACVLLAARMNNFRRSHAEIVAVSHVGEETL
TF2B_PYRWO/212-282 VNKFADELGLSE---KVRRRAIEILDEAYKRGLTSGKSPAGLVAAALYIASLLEGEKRTQREVAEVARVTEVTV
TF2B_HALVA/30-100 VPRFASELELSE---EVQSKANEIIDTTAEQGLLSGKSPTGYAAAAIYAASLLCNEKKTQREVADVAQVTEVTI
TF2B_KLULA/245-315 IPRFCSHLGLSV---QVANAAEYIAKHSKDVNVLAGRSPITIAAAAIYMATLLFKLNISPTRISQTLQVTEGTV
TF2B_DROME/214-284 MCRFCANLDLPN---MVQRAATHIAKKAVEMDIVPGRSPISVAAAAIYMASQASEHKRSQKEIGDIAGVADVTI
TF2B_YEAST/133-203 ITMLCDAAELPK---IVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKTKEF
TF2B_KLULA/137-207 ITMMCDAAELPK---IVKDCAKEAYKLCFEERVLKGKSQESIMASVILVGCRRAEVGRSFKEILSLTNVRKKEI
TF2B_DROME/120-190 ISSMADRINLPK---TIVDRANNLFKQVHDGKNLKGRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKEI
TF2B_PYRWO/116-186 LDRITAQLKLPR---HVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVDKKEI
TF3B_KLULA/98-168 LKAVSYALNIPE---YVTDAAFQWYRLALSNNFVQGRKSQNVIAACLYIACRKERTHHMLIDFSSRLQVSVYSI
TF3B_CANAL/95-165 IKRIAAALKIPD---YIAEAAGEWFRLALTLNFVQGRRSNNVLATCLYVACRKERTHHMLIDFSSRLQISVYSL