EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00367 alignment
(18 sequences with 35 aa)


SACX_BACSU/6-40 AKELLLLAGGKNNIISISHCTTRLRFDVKDETKID
PTSB_VIBAL/7-41 AKELLTLLGGKSNITALAHCATRLRLAVADEQKID
PTSB_BACSU/7-41 AKRLIELLGGKENIISAAHCATRLRLVMKDESKID
PTSA_PEDPE/7-40 ADRVLNAIG-KNNIQAAAHCATRLRLVIKDESKID
PTSA_STRMU/7-40 ASEVITAVG-KDNLVAAAHCATRLRLVLKDDSKVD
PTSA_LACLA/7-40 AERILNAVG-RDNIQGARHCATRLRLVLKDTGVID
PTSB_KLEPN/7-41 SRSLLPLLGGKENIASAAHCATRLRLVLVDDALAD
PTDA_ECOLI/9-43 ARSVIAALGGVDNISAVTHCMTRLRFVIKDDALID
PTBA_ERWCH/7-41 ASEIRDGVGGQENIISVIHCATRLRFKLRDNTNAN
PTBA_ECOLI/5-39 ARKIVAGVGGADNIVSLMHCATRLRFKLKDESKAQ
PTBA_BACSU/7-41 SKDILQLVGGEENVQRVIHCMTRLRFNLHDNAKAD
PTIB_ECOLI/73-107 AAGILQALGGVGNISSINNCATRLRIALHDMSQTL
PTOB_ECOLI/452-486 VPAILEALGGADNIVSLDNCITRLRLSVKDMSLVN
PTGB_ECOLI/402-436 APALVAAFGGKENITNLDACITRLRVSVADVSKVD
PTGA_BACSU/442-476 PYEILQAMGDQENIKHLDACITRLRVTVNDQKKVD
PTGA_BACST/81-115 PYEVLAALGGKENIEHLDACITRLRVSVHDIGRVD
PTGA_STRPN/476-510 AVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVG
PTAA_ECOLI/393-427 ATNYIAAVGGTDNLKAIDACITRLRLTVADSARVN