EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00366 alignment
(14 sequences with 71 aa)


RS11_YEAST/72-141 GTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFR-VQVGDIVTVGQCRPISKTVRFNVVKV
RS11_RAT/75-145 GVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKV
RS11_DUNTE/73-142 GVVKSSKMMRTIIVRRDYLHFIPKYARYEKRHTNIPAHVSPCFR-VRDGDTVIIGQCRPLSKTIRFNVLRV
RS11A_ARATH/74-143 GTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFR-VKEGDHIIIGQCRPLSKTVRFNVLKV
RS17_METVA/35-104 GVVSGDKGHNTIVIKREVTGYISKYERYEKRTTSLVAHNPPCIN-AKTGDVVKVMECRPVSKTKSFVVIEK
RS17_HALMA/33-102 GEVASTDMEKTVVVEREYDVKVPKYDRFMKRRSRVPAHAPDCLD-LAVGDTVTIAECRPLSKTKSHVVVGV
RS17_THETH/7-75 GVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEERYKV--GDVVEIIEARPISKRKRFRVLRL
RS17_MYCCA/11-79 GKVVSDKMDKTITVLVETYKNHPIYKKRVKYSKKYKAHDENQVAQM--GDKVEIMETRPLSKTKNFRLVRV
RS17_BUCAK/10-78 GRVVSHKMEKSIVVAIERTVKHPIYGKFIKRTTKLHVHDENNECGI--GDVVEIRECRPLSKTKSWTLVRV
RS17_THEMA/8-76 GIVVSDKMDKTVVVAVEKLVQHPLYKKYVKRTKKYHAHDERNECKI--GDVVEIEETRPLSKTKRWRVVRI
RS17_CHLTR/14-81 GVVVSSKMEKTVVVRVERVYSHPQYAKVVRDSSKYYAHN-ELDVKE--GDTVRIQETRPLSKTKRWRVVGR
RR17_PEA/43-111 GKVVCASGNKTVAVEVTRLAPHPKYQKRIRLKKKYQAHDPENDFKV--GDIVQLLKTRPISKKKTFLAVPA
RR17_ARATH/55-123 GRVVCATSDKTVAVEVVRLAPHPKYKRRVRMKKKYQAHDPDNQFKV--GDVVRLEKSRPISKTKSFVALPV
RR17_CYAPA/8-76 GVVIRNPQEKTVIVAVNNRVRHNKYSKIIIRTKKYQVHDHSHICKL--GDEVKISEVKPISKTKRWIISEV