EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00323 alignment
(10 sequences with 30 aa)


DEF3_HUMAN/66-94 CYCRIP.ACIAGERRYGTCIYQGRLWAFCC
DEF1A_CAVPO/65-93 CICTTR.TCRFPYRRLGTCIFQNRVYTFCC
DEF5_MOUSE/64-92 CYCRIR.GCKRRERVFGTCRNLFLTFVFCC
DEF1_MOUSE/64-92 CYCRSR.GCKGRERMNGTCRKGHLLYTLCC
DEF5_HUMAN/65-93 CYCRTG.RCATRESLSGVCEISGRLYRLCC
DEF6_HUMAN/72-99 CHCRR-.SCYSTEYSYGTCTVMGINHRFCC
DEF5_RABIT/65-93 CTCRRF.SCGFGERASGSCTVNGVRHTLCC
DEF1_RABIT/62-90 CACRRR.FCPNSERFSGYCRVNGARYVRCC
DEF4_HUMAN/65-93 CSCRLV.FCRRTELRVGNCLIGGVSFTYCC
DEF3_RABIT/65-93 CACRRA.LCLPRERRAGFCRIRGRIHPLCC