EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00273 alignment
(43 sequences with 186 aa)


VTDB_HUMAN/216-385 SNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESAS-..EDCMAKELPEHTVKLCDNLSTKN--SKFEDCCQEKTAMdVFVCTYFMPAAQLPELPDVEL-...-PTNKDVCD---PGNTKVMDKYTFELSRR-THLPEVFLSKVLEPTLKSLGECCD..VEDSTTCF
VTDB_HUMAN/25-199 KNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGAD..PDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLE.RKLCMAALK----HQPQEFPTYv..EPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCT..SASPTVCF
O42279_PETMA/145-322 AAQLCSSLQALGAQKFLGRMVLVFSQRAPNATFDQISKLSHRFHSYAQTCCGEGWS..PGCFAEQRHLIHDEMCHDMEALSRVPAMAKCCQISGSA.RAKCMETIPRGKPVLDVALAR-...-FDGHKVCQMNAEAPQELLGRMLYEFGRRHTDASVGEAKKIITEWMDGVKDCCAgnHSEEQACL
ALBU_PETMA/1041-1217 VQHICGSLHSRGEETFIQREVTLLSQKAPNASFEKVSQLARHFLSLAKKCCAPDHA..AGCFLEEPYAIHDEVCRDDEVVDQVGGLATCCRMSGTS.RAKCLAQLPRDLGRHGNRETP-...EFDELKICELRRDNPAVLMEKILYEFGRRHSDSAVSEVKNFAQKFSHSVTECCT..SEKTHECF
ALBU_PETMA/240-417 SQNLCKALKSLGKEKFEDRIIVRFTQRAPQAPFELIQKLAHRFEVLAEKCCELGHS..DRCLVEERYTVDDELCLEQSFVATCPRLSSCCSLSGSS.RAQCLETVPVLETSDKASPATP...TLPISEQCTLWAGKPVEFHKRVVWQISHRYPTTGVAQVEALAHHYLEHLTICCA..SEDKDTCI
ALBU_PETMA/1235-1413 GNLTCQRLKAQGVEHFEQLVILNFARAAKSLPMEKVVEFAHRFTRIAGQCCEHDT-..-HCLIDESFHLHAEMCGDHGYIMAHPGVANCCKSDVSE.QGTCFKIHEDVHHAEEILSKDVspaHPTAERVCLRYRQFPEKFINLALFELVHRLPLLESSVLRRKALAYTGFTDDCCR..AVDKTACF
Q9YGH6_9NEOB/219-391 HKQKCRVLKEFPERVSQALTLVQVSQRFGNAKYDDVEKVTIEIAHLNEDCCKGDA-..VECMIERME-ATEHICLAKEKLS--SKLSDCCAKGVLE.RTPCILALPNE--EPDLPIELKe..YYEDEHVCENYQKDKRKYLAHFTHDYSRSHQESSPQSCLRVSRGFEMLLEKCCA..SANSAECL
ALBU_RANCA/2-170 ----CRIIREFPDIVFKGLTLVQVSQKFGKAGFEDVKKVTEEIVHLNEDCCKGDA-..VECMMERME-ATDHICEAKDKLS--SKLADCCAKSILE.RTPCLLALPND--ESDLSKELKn..YYEDERVCENYKKDKLLFLAHFTHDYARSHQESSPQSCLRVSKGFEGLLEKCCA..SENHAECL
ALBU2_XENLA/219-393 QHHFCWILDNFPEKVLKALNLARVSHRYPKAEFKLAHNFTEEVTHFIKDCCHDDM-..FECMTERLE-LTEHTCQHKDELS--SKLEKCCNIPLLE.RTYCIVTLENDDVPAELSQPITe..FTEDPHVCEKYAENNEVFLGRYLHAVSRKHQELSEQFLLQSAKEYESLLNKCCK..TDNPPECY
FETA_MOUSE/216-390 NEHVCSVIRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNS-..LECLQDGEK-VMTYICSQQNILS--SKIAECCKLPMIQ.LGFCIIHAENGVKPEGLSLNPSq..FLGDRNFAQFSSEEKIMFMASFLHEYSRTHPNLPVSVILRIAKTYQEILEKCSQ..SGNLPGCQ
FETA_HORSE/220-394 NQHVCAVIRNFGPRTLQAITVTTLSQRYSKANFTEIQKLVLDVAHAHEECCRGNV-..EECVQDGEK-LISYVCSQEDILS--SSIVECCKLPTVE.LAQCIIHAENDDKPEGLSPNLNr..LLGERDFNQFSSKEKDLFMARFTYEYSRRHTKLAVPVILRVAKGYQEFLEKCSQ..SENPLECQ
FETA_GORGO/220-394 NQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDV-..LDCLQDGEK-IMSYICSQQDTLS--NKITECCKLTTLE.RGQCIIHAENDEKPEGLSPNLNr..FLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQ..TENPLECQ
ALBU_MOUSE/220-394 QRMKCSSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDL-..LECADDRAE-LAKYMCENQATIS--SKLQTCCDKPLLK.KAHCLSEVEHDTMPADLPAIAAd..FVEDQEVCKNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLAKKYEATLEKCCA..EANPPACY
ALBU_MACMU/212-386 QRLKCASLQKFGDRAFKAWAVARLSQKFPKAEFAEVSKLVTDLTKVHTECCHGDL-..LECADDRAD-LAKYMCENQDSIS--SKLKECCDKPLLE.KSHCLAEVENDEMPADLPSLAAd..YVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVMLLLRLAKAYEATLEKCCA..AADPHECY
ALBU_BOVIN/219-393 QRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDL-..LECADDRAD-LAKYICDNQDTIS--SKLKECCDKPLLE.KSHCIAEVEKDAIPENLPPLTAd..FAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCA..KDDPHACY
ALBU_HORSE/219-393 ERLKCSSFQNFGERAVKAWSVARLSQKFPKADFAEVSKIVTDLTKVHKECCHGDL-..LECADDRAD-LAKYICEHQDSIS--GKLKACCDKPLLQ.KSHCIAEVKEDDLPSDLPALAAd..FAEDKEICKHYKDAKDVFLGTFLYEYSRRHPDYSVSLLLRIAKTYEATLEKCCA..EADPPACY
ALBU_RABIT/220-394 ERLRCASIQKFGDRAYKAWALVRLSQRFPKADFTDISKIVTDLTKVHKECCHGDL-..LECADDRAD-LAKYMCEHQETIS--SHLKECCDKPILE.KAHCIYGLHNDETPAGLPAVAEe..FVEDKDVCKNYEEAKDLFLGKFLYEYSRRHPDYSVVLLLRLGKAYEATLKKCCA..TDDPHACY
ALBU_CHICK/224-398 QQYFCGILKQFGDRVFQARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDM-..VECMDDMAR-MMSNLCSQQDVFS--GKIKDCCEKPIVE.RSQCIMEAEFDEKPADLPSLVEk..YIEDKEVCKSFEAGHDAFMAEFVYEYSRRHPEFSIQLIMRIAKGYESLLEKCCK..TDNPAECY
AFAM_MOUSE/220-394 QRNVCGALIKFGPKVLNSINVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCCEGDV-..VHCIRSQSQ-VENHICSKQDSIS--SKIKVCCEKKTLE.REACIINANKDDRPEGLSLREAk..FTESENVCQERDSDPDKFFAEFIYEYSRRHPDLSTPRLLRITKVYMDFLEDCCS..RENPAGCY
AFAM_HUMAN/220-394 QKHVCGALLKFGTKVVHFIYIAILSQKFPKIEFKELISLVEDVSSNYDGCCEGDV-..VQCIRDTSK-VMNHICSKQDSIS--SKIKECCEKKIPE.RGQCIINSNKDDRPKDLSLREGk..FTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCN..TENPPGCY
ALBU1_SALSA/214-390 LRSLCIVHKKYGDRVVKAKKLVQYSQKMPQASFQEMGGMVDKIVATVAPCCSGDM-..VTCMKERKT-LVDEVCADESVLSRAAGLSACCKEDAVH.RGSCVEAMKPDPKPDGLSEHYDi..HADIAAVCQTFTKTPDVAMGKLVYEISVRHPESSQQVILRFAKEAEQALLQCCD..MEDHAECV
Q9YGH6_9NEOB/29-201 PRIINDIVKAVGKPAVEKLVLVMVAQDFEKCSLDEHLKVQAKIIEAVDNCEKHPEE..AECKKPAIELYHDIVCKEEDIDQLYPWTTECCGKAEAE.RTKCFYEHREVR---VEEYKI-...-PNIEESCKEHKEHPQRAFSYYLSNIAKRHSKLYPPAVLGFAIQYNEITTECCA..AEDKAKCF
Q91134_NAJNA/31-206 QHSTIRLASQISATDFGAITLTLVTQTVPNATLEDLKKLSAEIIELHKKCVASEFS.dPPCTKPLGIVFLDVLCHNEEFSNKYG-INDCCAKADPD.RNECVLSHKTSSTGTISPFVH-...-PNAEEACQAFQNDRDSVLAQYIFELSRRYPTALSVVILESTKTYKKILETCCA..EADKDACI
ALBU_RABIT/28-202 KSEIAHRFNDVGEEHFIGLVLITFSQYLQKCPYEEHAKLVKEVTDLAKACVADESA..ANCDKSLHDIFGDKICALPSLRDTYGDVADCCEKKEPE.RNECFLHHKDDKPD-LPPFAR-...-PEADVLCKAFHDDEKAFFGHYLYEVARRHPYFYAPELLYYAQKYKAILTECCE..AADKGACL
ALBU_MOUSE/28-202 KSEIAHRYNDLGEQHFKGLVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTCVADESA..ANCDKSLHTLFGDKLCAIPNLRENYGELADCCTKQEPE.RNECFLQHKDDNPS-LPPFER-...-PEAEAMCTSFKENPTTFMGHYLHEVARRHPYFYAPELLYYAEQYNEILTQCCA..EADKESCL
ALBU_MERUN/29-203 KSEIAHRYKDLGEKYFKGLVLYTFSQYLQKCSYEEHVKLVREVTDFASNCAKDESA..ENCDKSLHTLFGDKLCSLPNFGEKYAEMADCCAKQEPE.RNECFLQHKDDNPQ-LPPFKR-...-AEPDAMCTAFQENAEAFMGHYLHEVARRHPYFYGPELLYLADKYTAVLTECCA..ADDKGACL
ALBU_HUMAN/28-202 KSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESA..ENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPE.RNECFLQHKDDNPN-LPRLVR-...-PEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQ..AADKAACL
ALBU_HORSE/28-201 KSEIAHRFNDLGEKHFKGLVLVAFSQYLQQCPFEDHVKLVNEVTEFAKKCAADESA..ENCDKSLHTLFGDKLCTVATLRATYGELADCCEKQEPE.RNECFLTHKDDHPN-LPKLK--...-PEPDAQCAAFQEDPDKFLGKYLYEVARRHPYFYGPELLFHAEEYKADFTECCP..ADDKLACL
ALBU_FELCA/28-202 QSEIAHRFNDLGEEHFRGLVLVAFSQYLQQCPFEDHVKLVNEVTEFAKGCVADQSA..ANCEKSLHELLGDKLCTVASLRDKYGEMADCCEKKEPE.RNECFLQHKDDNPG-FGQLVT-...-PEADAMCTAFHENEQRFLGKYLYEIARRHPYFYAPELLYYAEEYKGVFTECCE..AADKAACL
ALBU_BOVIN/28-201 KSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESH..AGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPE.RNECFLSHKDDSPD-LPKLK--...-PDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQ..AEDKGACL
ALBU_PIG/28-201 KSEIAHRFKDLGEQYFKGLVLIAFSQHLQQCPYEEHVKLVREVTEFAKTCVADESA..ENCDKSIHTLFGDKLCAIPSLREHYGDLADCCEKEEPE.RNECFLQHKNDNPD-IPKLK--...-PDPVALCADFQEDEQKFWGKYLYEIARRHPYFYAPELLYYAIIYKDVFSECCQ..AADKAACL
ALBU_CHICK/31-206 KSEIAHRYNDLKEETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDA..PECSKPLPSIILDEICQVEKLRDSYGAMADCCSKADPE.RNECFLSFKVSQPDFVQPYQR-...-PASDVICQEYQDNRVSFLGHFIYSVARRHPFLYAPAILSFAVDFEHALQSCCK..ESDVGACL
ALBU1_XENLA/31-202 HKHIADMYNLLTERTFKGLTLAIVSQNLQKCSLEELSKLVNEINDFAKSCTGNDKT..PECEKPIGTLFYDKLCADPKVGVNYEWSKECCSKQDPE.RAQCFRAHRVFEHN---PVR--...-PKPEETCALFKEHPDDLLSAFIHEEARNHPDLYPPAVLLLTQQYGKLVEHCCE..EEDKDKCF
FETA_RAT/34-204 IESTLDSSQCPTEKNMFNVATIVVAQFVQDATKAEVNKMSSDALAAMKENTGD---..-GCLENQLSVFLDEICHETELSNKYG-FSGCCNQSGVE.RHQCLLARKKTAPDSVPPFHF-...-PETAESCPAYEENRAMSINTFIYDVSKRNPFLYAPTILYLAAQYDKAVPACCK..ADNMEECF
FETA_MOUSE/28-198 IASTLDSSQCVTEKNVLSIATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGD---..-GCLESQLSVFLDEICHETELSNKYG-LSGCCSQSGVE.RHQCLLARKKTAPASVPPFQF-...-PEPAESCKAHEENRAVFMNRFIYEVSRRNPFMYAPAILSLAAQYDKVVLACCK..ADNKEECF
FETA_HORSE/28-202 IASALDSFQCSPEMNLVDLATIFFAQFVQEATYKEVSKMVKDVLTVTEKSTGSEQP..TGCSENRLSAFLEEICHEEEIPEKYG-LSGCCSQNEEE.RHNCLLARKKDSPASIPPFQV-...-PEPVTSCKAYEENREMFLNRYLYEIARRHPFLYSSTALYLASHYDKIISACCK..SENAVECF
FETA_GORGO/28-202 IASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQS..AGCLENQLPAFLEELCHEKEILEKYG-LSDCCSQSEEG.RHNCFLAHKKPTPASIPLFQV-...-PEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCK..AENAVECF
AFAM_MOUSE/28-202 DVDHFNATQKFIDENTAYLAIIAFSQYVQEASFDEVETLVKVMLDYRDRCWADNTL..PECSKTANDAIQDMLCDMEGLPQKHN-FSHCCGKAGFP.RRLCFFYNKKANVGFLPPFPT-...-LDPEEKCQAYKNKSESFLHLYMYEVARRNPFVFAPVLLAVAAWFEEAATTCCE..QQQKATCF
AFAM_HUMAN/28-202 DIENFNSTQKFIEDNIEYITIIAFAQYVQEATFEEMEKLVKDMVEYKDRCMADKTL..PECSKLPNNVLQEKICAMEGLPQKHN-FSHCCSKVDAQ.RRLCFFYNKKSDVGFLPPFPT-...-LDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCE..EQNKVNCL
ALBU1_SALSA/22-196 QNQICTIFTEAKEDGFKSLILVGLAQNLPDSTLGDLVPLIAEALAMGVKCCSDTPP..EDCERDVADLFQSAVCSSETLVEKND-LKMCCEKTAAE.RTHCFVDHKAKIPRDLSLKAE-...-LPAADQCEDFKKDHKAFVGRFIFKFSKSNPMLPPHVVLAIAKGYGEVLTTCCG..EAEAQTCF
FETA_MOUSE/408-588 SKQSCALYQTLGDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCCQLSEEkwSGCGEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSN.RRLCITSFLRDETYAPPPFSEDk..FIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQLAAVTADFSGLLEKCCK..AQDQEVCF
AFAM_MOUSE/412-590 VQQECNQFQELGKDTLQRHFLVKFTKAAPQLPMEELVSLSKEMVAALTTCCTLSDE..FACVDNLADLVLGELCGVNTNRTINPAVDHCCKTDFAF.RRHCFEHLKADTTYALPSVSALv..SALHTDWCQPRKEDLQNKKHRFLVNLVKWMPGITDEEWLCLFTKFTAAREECSE..VQEPESCF
AFAM_HUMAN/412-590 VQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEE..FACVDNLADLVFGELCGVNENRTINPAVDHCCKTNFAF.RRPCFESLKADKTYVPPPFSQDl..FTFHADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCK..AESPEVCF