EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00268 alignment
(13 sequences with 299 aa)


RIR4_SALTY/1-281 MKLSRISAINW--NKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQT-LSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLC--QTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEP-LKKK-IASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEALYAETGW------...VNDVKAFLCYNANKALMNLGYEALFPPEM--ADVNPA
RIR2_YEAST/76-358 EPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYI-KDPKESEFLFNAIHTIPEIGEKAEWALRWIQDADALFGERLVAFASIEGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLK---NKPDPAIV----EKIVTEAVEIEQRYFL---DALPVALLGMN...ADLMNQYVEFVADRLLVAFGNKKYYKVEN--PFDFME
RIR2_SCHPO/66-348 EVVLRPNPHRFVLFPIKYHEIWQFYKKAEASFWTAEEIDLSKDLVDWDNKLNADERYFISTVLAYFAASDGIVNENLLERFSSEVQIPEARCVYGFQIMIENIHSETYSLLLDTYI-REPKEKQRHFDAILTMGSIKAKAKWALRWINDEDSTYAIRLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLMFSHLK---HRPGRKVV----EAIIVEAVDIEKEYFT---DALPVSLLGMN...KDLMCQYIEFVADRLLVALGNDKYYNVTN--PFDFME
RIR2_HUMAN/70-351 EPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES-LKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYI-KDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV---HKPSEERV----REIIINAVRIEQEFLT---EALPVKLIGMN...CTLMKQYIEFVADRLMLELGFSKVFRVEN--PFDFME
RIR2_CAEEL/62-343 EPMLQDLDNRFVIFPLKHHDIWNFYKKAVASFWTVEEVDLGKDMNDWEK-MNGDEQYFISRILAFFAASDGIVNENLCERFSNEVQVSEARFFYGFQIAIENIHSEMYSKLIETYI-RDETERNTLFNAVDEFEFIKKKADWALRWISDKKASFAERLIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTHSNELISRDEGLHRDFACLLYSKLQ---KKLTQQRI----YDIIKDAVAIEQEFLT---EALPVDMIGMN...CRLMSQYIEFVADHLLVELGCDKLYKSKN--PFDFME
RIR2_DICDI/12-293 EPILKENKDRFVLFPIKYPDIWRMYKKALASHWVAEEIDLGNDNVDWEYKLTDNERHFISHVLAFFAASDGIVNENLATRFMSEVQIPEARCFYGFQIAIENIHSETYSLLIETYI-KDKQTKDKLFNAIETIPCIKKKAEWALRWINDSDS-FAERLVAFAAVEGIFFSGSFCSIFWLKKRGLMQGLTFSNELISRDEGLHCDFACLLYTKLQ---RKLDPKVI----EKMIRDAVECEKEFIC---ESLPVDLIGMN...SRSMSQYIEFCADRLVVSLGYKKIFNSSN--PFEWME
RIR2_ASFB7/9-294 EELLIENSQRFTIFPIQHPECWNWYKKLESLTWTAQEVDMCKDIDDWEA-MPKPQREFYKQILAFFVVADEIVIENLLTNFMREIKVKEVLYFYTMQAAQECVHSEAYSIQVKTLI-PDEKEQQRIFSGIEKHPIIKKMAQWVRQWMDPDRNTLGERLVGFAAVEGILFQNHFVAIQFLKEQNIMPGLVSYNEFISRDEGVHCSFACFLISNYVY--NIPEEKII----HKILKEAVELVDEFINYAFDKARGRVPGFS...KEMLFQYIRYFTDNLCFMMQCKSIYKVGN--PFPQMT
RIR2_VZVD/1-280 MDQ-KDCSHFF--YRPECPDINNLRALSISNRWLESDFIIEDDYQYLDC-LTEDELIFYRFIFTFLSAADDLVNVNL-GSLTQLFSQKDIHHYYIEQECIEVVHARVYSQIQLMLFRGDESLRVQYVNVTINNPSIQQKVQWLEEKVRDNPS-VAEKYILMILIEGIFFVSSFAAIAYLRNNGLFVVTCQFNDLISRDEAIHTSASCCIYNNYVP--EKPAITRI----HQLFSEAVEIECAFLK---SHAPK-TRLVN...VDAITQYVKFSADRLLSAINVPKLFNTPPPDSDFPLA
RIR2_EHV1B/12-295 TAELSLAGAFF--YTPECPDIEHLRSLSVANRWLDTDLPISDDLKDVAK-LTPAEREFYRFLFAFLSAADDLVNLNL-GDLSALFTQKDILHYYIEQESIEVTHSRVYSAIQLMLFGNDAAARARYVASIIGDAAIGRKVAWLQAKVRECGS-VAEKYILMILIEGLFFASSFASIAYLRTHNLFVVTCQSNDLISRDEAIHTRASCCIYNNYLGGFEKPEPKRI----YELFSEAVNIECEFLL---SHAPQYSHLLD...IGAIISYVRYSADRLLGEIGLSPLFNAPKPSPSFPLA
RIR2_BHV1C/7-288 AATLTRKYKYF--YETECPDLDHLRSLSVANRWLETEFPLADDAKDVAR-LSGAELEFYRFLFAFLSAADDLVNVNL-GDLSELFTQKDILHYYIEQESIEVVHSRVYSAIQLLLFRNDAVARAGYVEGALGDPAVRRKVDWLERRVAAAES-VAEKYVLMILIEGIFFSSSFAAIAYLRTHNLFVVTCQTNDLISRDEAVHTAASCCIFDNYLGG-ERPPPARI----YELFREAWKLSASLF----GCAPRGSHILD...VEAISAYVEYSADRLLAAIQLPPLFGTPPPGTDFPLA
RIR2_HHV11/28-314 IPKCPDPERYF--YTSQCPDINHLRSLSILNRWLETELVFVGDEEDVSK-LSEGELSFYRFLFAFLSAADDLVTENL-GGLSGLFEQKDILHYYVEQECIEVVHSRVYNIIQLVLFHNNDQARREYVAGTINHPAIRAKVDWLEARVRECAS-VPEKFILMILIEGIFFAASFAAIAYLRTNNLLRVTCQSNDLISRDEAVHTTASCYIYNNYLGGHAKPPPDRV----YGLFRQAVEIEIGFIR---SQAPTDSHILSpaaLAAIENYVRFSADRLLGLIHMKPLFSAPPPDASFPLS
RIR2_SHV21/1-279 MDSVK---KYL--YTCDHVGFLELTKETWKNRWFPSQVPLQGDVCCVDM-LNERDLEFYKFLFTFLGMAEKLVNINI-EDLLSQFDSHDISHYYAEQMAMENIHGKVYANILNMLFKNNITEVYSYACDIMNDSALQEKLRWLNGRVTEASD-KAEKILLFLLVEGIFFISSFFSIGLFRVRGIMNGICLANDYIARDEMLHTSAAALLYNTMTKSSERPSEDWI----YKLFREAVEVEFKFIA---AKGYG-VSLVN...VHEIRQFLQATADRILESINLNPIYGSLPPE-NCPLA
RIR2_EBV/1-276 MS------KLL--YVRDHEGFACLTVETHRNRWFAAHIVLTKDCGCLKL-LNERDLEFYKFLFTFLAMAEKLVNFNI-DELVTSFESHDIDHYYTEQKAMENVHGETYANILNMLFDGDRAAMNAYAEAIMADEALQAKISWLRDKVAAAVT-LPEKILVFLLIEGIFFISSFYSIALLRVRGLMPGICLANNYISRDELLHTRAASLLYNSMTAKADRPRATWI----QELFRTAVEVETAFIE---ARGEG-VTLVD...VRAIKQFLEATADRILGDIGQAPLYGTPPPK-DCPLT