EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00265 alignment
(13 sequences with 191 aa)


KITH_SWPVK/4-175 GFIHLILGPMFSGKSTELIRLVNRYQIATYNCRVIKYSKDNRYGND..--AVYTHDKCYISAV----STDSLFDIKDTLDD--VDIVGIDEGQFFN--DIVEFCEYIANKGKIVIVAALDGTYERKPFGNILNLIPLSEKVTKLNAICMICHRD.ASFSKRLS------DEKEIELIGGKEKYLSVCRSCY
KITH_MYXVU/6-176 GQIHLIIGPMFAGKSTELIRLVKRYQIARYKCLVVNYEKDARYGNG..---VRTHDNTCISAV----PTASLDDVESISEH--VEVIGIDEGQFFP--NIVSFCERMANAGKVLIVAALDGTFQRKPFTNICELIPLAENVTKLNAVCMYCYKD.ASFSKRLG------NETEIEIIGGSDKYKSVCRKCY
KITH_CAPVK/4-174 GYIHLIIGPMFSGKSTELIRIVKRYQIAQYKCCVVKYLKDIRYGNS..---VYTHDNNHVSAI----STTLLYDVVDKIMN--FDIIGIDEGQFFK--DIVSFSENMANMGKIIIIAALDSTFQRKEFNDILKLIPLSEKVTKLNAVCMECYKD.AAFSKRIT------KEKEIELIGGKEKYKSVCRKCY
KITH_MONPV/4-174 GHIQLIIGPMLSGKSTELIRRVRRYQIAQYKCVTIKYSNDNRYGTG..---LWTHDKNNFAAL----EVTKLCDVLEAITD--FSVIGIDEGQFFP--DIVEFCERMANEGKIVIVAALDGTFQRRPFNNILNLIPLSEMVVKLTAVCMKCFKE.ASFSKRLG------AETEIEIIGGNDMYQSVCRKCY
KITH_CHICK/19-190 GQIQVIFGPMFSGKSTELMRRVRRFQLAQYRCLLVKYAKDTRYCTT..--GVSTHDRNTMEAR----PACALQDVYQEALG--SAVIGIDEGQFFP--DIVEFCEKMANTGKTVIVAALDGTFQRKAFGSILNLVPLAESVVKLNAVCMECYRE.ASYTKRLG------AEREVEVIGGADKYHSVCRACY
KITH_FOWPV/4-180 GSIHVITGPMFSGKTSELVRRIKRFMLSNFKCIIIKHCGDNRYNEDdiNK-VYTHDLLFMEAT----ASSNLSVLVPTLLNDGVQVIGIDEAQFFL--DIVEFSESMANLGKTVIVAALNGDFKRELFGNVYKLLSLAETVSSLTAICVKCYCD.ASFSKRVT------ENKEVMDIGGKDKYIAVCRKCF
KITH_CBEPV/1-179 MSIEIITGPMYSGKTTELIRRITRYKLCKKNCVIISHSIDNRCEED..DNILINHDGFKISHD-DFIKTNILINKIKIFDK--YEIIGIDECQFFDSNDLMIFCDTLANNGKKIIVAGLNSDFNKNPFKSIIKLIPISEKITKLQSICNFCYND.ATFTMKKF------NKDIIIEIGGSDLYIPVCRICY
KITH_AMEPV/1-178 MSIELIIGPMFSGKTTELMRKINRYILSNQKCVIITHNIDNRFI--..NKNIINHDGNILNKEYLYIKTNNLINEINIVDN--YDIIGIDECQFFEENDLEQFCDKMANNKKKVIVAGLNCDFNRNIFNSISKLIPKVEKIKKLQAICQFCYKD.ASFTIKKH------NKNQIIEIGGQDLYVPVCRLCY
KITH_BACSU/8-187 GWLELICGSMFSGKSEELIRRVKRATYAKQEVRVFKPVIDNRYSEA..--AVVSHNGTSMTSY----AISSAADIWDHISES-TDVVAVDEVQFFD-QEIVEVLSSLADKGYRVIAAGLDMDFRGEPFGVVPNIMAIAESVTKLQAVCSVCGSP.ASRTQRLIDGKPASYDDPVILVGAAESYEARCRHHH
KITH_ASFB7/10-183 GTISLVLGPMFAGKTTFLIHCIYMLERLEKKVVFIKSTKNTRDKT-..---IKTHSGIQLRPK--QCKIIESTQLSDVGSLTDIHAVVVDEAHFFD---DLIKCRTWAEEEKIIILAGLNASFEQKMFPPIVRIFPYCSWVKYIGRTCMKCNQHnACFNVRKN------ADKTLILAGGSELYVTCCNNCL
KITH_HAEIN/2-186 AKLYFYYSTMNAGKSTTLLQSSYNYRERDMNTLVYTAAIDDRFGVG..--KVTSRIGISQDAFLFRSETNLFDEINEHLKKEKVHCVLVDEAQFLSKQQVYQLSDVVDKLKIPVLCYGLRTDFQAELFEGSKYLLAWADQLEELKTIC-YCGRK.ANFVLRLNDQGEVIKEGAQIQIGGNDSYLSVCRLHY
KITH_ECOLI/2-186 AQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAG..--KVSSRIGLSSPAKLFNQNSSLFDEIRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLAWSDKLVELKTIC-FCGRK.ASMVLRLDQAGRPYNEGEQVVIGGNERYVSVCRKHY
KITH_BPT4/2-185 ASLIFTYAAMNAGKSASLLIAAHNYKERGMSVLVLKPAIDTRDSVC..--EVVSRIGIKQEANIITDDMDIFEFYKWAEAQKDIHCVFVDEAQFLKTEQVHQLSRIVDTYNVPVMAYGLRTDFAGKLFEGSKELLAIADKLIELKAVC-HCGKK.AIMTARLMEDGTPVKEGNQICIG-DEIYVSLCRKHW