EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00236 alignment
(10 sequences with 97 aa)


GLHA_RANCA/1-97 FPDDNFLTPGCPECRLKENLRFSNMGIGrIYQCSGCCYSRAYPTPMRSKKTMLVPKNITSEAKCCVAKTQYRVTVMDNVKIENHTACHCSTCLYHKS
GLHA_MACMU/25-120 FPDGEFTMQDCPECKPRENKFFSKPGAP.IYQCMGCCFSRAYPTPVRSKKTMLVQKNVTSESTCCVAKSLTRVMVMGSVRVENHTECHCSTCYYHKF
GLHA_HUMAN/25-116 APD----VQDCPECTLQENPFFSQPGAP.ILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
GLHA1_RAT/25-120 LPDGDLIIQGCPECKLKENKYFSKLGAP.IYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS
GLHA_HORSE/25-120 FPDGEFTTQDCPECKLRENKYFFKLGVP.IYQCKGCCFSRAYPTPARSRKTMLVPKNITSESTCCVAKAFIRVTVMGNIKLENHTQCYCSTCYHHKI
GLHA_ANGAN/25-117 YPNNEMARGGCDECRLQENKIFSKPSAP.IFQCVGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAR---EVTRLDNMKLENHTDCHCSTCYYHKF
GLHA2_ONCTS/23-114 YPNSDKTNMGCEECTLKPNTIFPN----.IMQCTGCCFSRAYPTPLRSKQTMLVPKNITSEATCCVAKEGERVTTKDGFPVTNHTECHCSTCYYHKS
GLHA1_ONCKE/14-108 YQNSDMTNVGCEECKLKENKVFSNPGAP.VYQCTGCCFSRAYPTPLQSKKAMLVPKNITSEATCCVAKEGERVVVDN-IKLTNHTECWCNTCYHHKS
GLHA1_CYPCA/24-118 YPRNDMNNFGCEECKLKENNIFSKPGAP.VYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAK-EVKRVLVNDVKLVNHTDCHCSTCYYHKS
GLHA_ACALA/24-117 YPNTDLSNMGCEACTLRKNTVFSR-DRP.IYQCMGCCFSRAYPTPLKAMKTMTIPKNITSEATCCVAKHVYETEVAG-IRVRNHTDCHCSTCYYHKI