EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00199 alignment
(21 sequences with 408 aa)


CATE_ECOLI/81-469 TTNQGVRIADDQNSLRAGSR..........GPTLLEDFILREKITHFDHERIPERIVHARGSAAHGYFQPYKSLSDITKADFLSDPNKITPVFVRFSTVQGGAGSADTVRDIRGFATKFYTEEGIFDLVGNNTPIFFIQDAHKFPDFVHAVKPEPHWAIPQGQSAHDTFWDYVSLQPE..TLHNVMWAMSD.RGIPRSYRTMEGFGIHTFRLINAEGKATFVRFHWKPLAGKASLV.WDEAQKLTGRDPDFHRRELWEAIEAGDFPEYELGFQLIPEEDEFKFDFDLLDPTKLIPEELVPVQRVGKMVLNRNPDNFFAENEQAAFHPGHIVPGLDFTNDPLLQGRLFSYTDTQISRLGGPNFHEIPINRPT.CPYHNFQ.RDGMHRMGIDTNP-..ANYEPNSINDNW
CATE_BACSU/31-419 TTNQGLRVSEDEHSLKAGVR..........GPTLMEDFHFREKMTHFDHERIPERVVHARGFGVHGFFQVYEPMTEYTRAKFLQDPSVKTPVFVRFSTVAGSKGSADTVRDARGFATKFYTEEGNYDLVGNNIPVFFIQDAIKFPDLVHAFKPEPHNEMPQAATAHDTFWDFVANNPE..SAHMVMWTMSD.RGIPRSYRMMEGFGVHTFRFVNEQGKARFVKFHWKPVLGVHSLV.WDEAQKIAGKDPDFHRRDLWETIENGGKVEYELGVQMIDEEDEFKFDFDILDPTKLWPEELVPVKIIGKMTLNRNQDNVFAETEQVAFHPGNVVPGIDFTNDPLLQGRLFPYTDTQLIRLGGPNFHEIPINRPV.CPFHNNQ.YDGYHRMTINKGP-..VAYHKNSLQNND
CATE_BACPF/28-416 TTNQGLKVSEDEFSLKAGER..........GPTLMEDFHFREKMTHFDHERIPERIVHARGFAAHGEFQVYDSMKEFTKAKFLQDPSVKTPVFVRFSTVAGSKGSAETVRDARGFATKFYTEEGNYDLVGNNIPVFFIQDAIKFPDLVHALKPEPHNEIPQAQSAHDTFWDFIANNQE..SAHMVMWAMSD.RSIPRSFRMMEGFGVHTFRFVNEEGKAHFVKFHWKPVLGIHSLV.WDEAQKIAGKDPDFHRRDLWESIENGDYPEYELGVQLISEEDEFNFDFDVLDPTKIWPEEEVPVKIIGKMTLNRNVDNVFAETEQVAFHPGHVVPGIDFTNDPLLQGRLFSYTDTQLIRLGGPNFHELPINRPV.CPFHNNQ.RDGYGRQTINKGQ-..VSYHKNSLAANT
CATA_LISSE/8-391 TTNQGVPIGDNQNSMTAGLK..........GPTLLEDYVLIEKLAHFDRERVPERVVHARGAGAHGKFVTKKSMKKYTKAQFLQEEGTETEVFARFSTVIHGQHSPETLRDPRGFSVKFYTEEGNYDFVGNNLPVFFIRDAIKFPDVIHSLKPDPRTNIQD----GNRYWDFFSLTPE..ATTMITYLFSD.EGTPASYREIRGSSVHAFKWINEEGKTVYVKLRWVPKAGIVNLS.TDQAAQIQAKEFNHASRDLYEAIENGDYPEWDLYVQVLDPKDLDNYDFNPLDATKDWFEDVFPYEHVGTMTLNRNPDNIFAETESVGFNPGVLVPGMLPSEDRVLQGRLFSYSDTQRHRVG-PNYLQLPINSPK.TPVDNNQ.RDGQMPFKQQTSS-..INYEPNSYDTEP
CATA_IPOBA/18-401 TTNSGAPVWNNTCALTVGSR..........GPILLEDYHLVEKIQNFTRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMYTRGGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHIQE----NWRILDYLSHLPE..SLNTFAWFYDD.VGIPTDYRHMEGFGVHTFTMINKEGKANYVKFHWKPTCGVKCLL.EEEAIRIGGENHSHATQDLYESIAAGNYPEWKLYIQVMDPDHEDRFDFDPLDTTKIWPEELIPLQPVGRMVLNKNIDNFFAENEMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLG-PNYMLLPVNAPK.CAHHNNS.YDGYMNFVHRDEE-..VDYFPSKFDNTR
CATA1_LYCES/18-401 TTNAGGPVYNNVSSLTVGPR..........GPVLLEDYYLIEKLATFDREKIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGAQTPVICRFSTVVHERGSPESIRDIRGFAVKFYTREGNFDLVGNNVPVFFNRDAKSFPDTIRALKPNPKSHIQE----NWRILDFFSFLPE..SLHTFAFFYDD.VCLPTDYRHMEGFGVHAYQLINKEGKAHYVKFHWKPTCGVKCMS.EEEAIRVGGTNHSHATKDLYDSIAAGNYPEWKLFIQTMDPEDVDKFDFDPLDVTKTWPEDLLPLIPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIG-PNYMQLPVNAPK.CGHHNNH.RDGAMNMTHRDEE-..VDYLPSRFDPCR
CATA1_GOSHI/18-401 TTNSGAPVWNNNSSLTVGPR..........GQYLLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQE----NWRILDFFSHHPE..SLHMFTFLFDD.LGVPQDYRHMEGSGVNTYTLINKAGKAHYVKFHWKPTCGVKCLL.EDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLFIQTIDPDHEDKFDFDPLDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLG-PNYLQLPANAPK.CAHHNNH.HEGFMNFMHRDEE-..INYFPSRYDPVR
CATA3_MAIZE/20-404 TTNAGAPVWNDNEALTVGPR..........GPILLEDYHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVTSLTCADFLRAPGVRTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSHVQE----YWRVFDFLSHLPE..SLHTFFFLFDD.VGVPSDYRHMEGFGVNTYTFVSAAGKAQYVKFHWKPTCGVRCILtDEEAALVGGRNHSHATQDLYDSIAAGSFPEWTLYVQVMDPDTEEQYDFDPLDDTKTWPEDLLPLRPVGRLVLDRNVDNFFNENEQLAFGPGLVVPGIYYSDDKMLQCRVFAYADTQRYRLG-PNYLMLPVNAPR.CAHHNNH.YDGAMNFMHRDEE-..VDYYPSRHAPLR
CATA_BACFR/7-391 TAANGRPIADNQNSQTAGPR..........GPIMLQDPWLIEKLAHFDREVIPERRMHAKGSGAYGTFTVTHDITKYTRAAIFSQVGKQTECFVRFSTVAGERGAADAERDIRGFAMKFYTEEGNWDLVGNNTPVFFLRDPLKFPDLNHAVKRDPRNNMRS----ANNNWDFWTLLPE..ALHQVTITMSP.RGIPASYRHMHGFGSHTYSFLNAENKRIWVKFHLKTMQGIKNLT.DQEAEAIIAKDRESHQRDLYESIERGDFPKWKFQIQLMTEEEADNYRINPFDLTKVWPHKDFPLQDVGILELNRNPENYFAEVEQSAFNPMNIVEGIGFSPDKMLQGRLFSYGDAQRYRLG-VNSEQIPVNKPR.CPFHAFH.RDGAMRVDGNYGSA..KGYEPNSYGEWQ
CATA_HAEIN/16-400 TMGNGAPVADNQNSLTAGPR..........GPLLAQDLWLNEKLADFVREVIPERRMHAKGSGAFGTFTVTHDITKYTRAKIFSEVGKKTEMFARFTTVAGERGAADAERDIRGFALKFYTEEGNWDLVGNNTPVFFLRDPRKFPDLNKAVKRDPRTNMRS----ATNNWDFWTLLPE..ALHQVTVVMSD.RGIPASYRHMHGFGSHTYSFWNEAGERFWVKFHFRTQQGIKNLT.DAEAAEIIANDRESHQRDLYEAIERGDFPKWTLFVQIMPEADAEKVPYHPFDLTKVWSKKDYPLIEVGEFELNRNPENFFADVEQSAFAPSNLVPGIGASPDRMLQARLFNYADAQRYRLG-VNYRQIPVNRPR.CPVHSNQ.RDGQGRVDGNYGSL..PHYEPNSFSQWQ
CATA_PROMI/7-391 TTAAGAPVVDNNNVITAGPR..........GPMLLQDVWFLEKLAHFDREVIPERRMHAKGSGAFGTFTVTHDITKYTRAKIFSEVGKKTEMFARFSTVAGERGAADAERDIRGFALKFYTEEGNWDMVGNNTPVFYLRDPLKFPDLNHIVKRDPRTNMRN----MAYKWDFFSHLPE..SLHQLTIDMSD.RGLPLSYRFVHGFGSHTYSFINKDNERFWVKFHFRCQQGIKNLM.DDEAEALVGKDRESSQRDLFEAIERGDYPRWKLQIQIMPEKEASTVPYNPFDLTKVWPHADYPLMDVGYFELNRNPDNYFSDVEQAAFSPANIVPGISFSPDKMLQGRLFSYGDAHRYRLG-VNHHQIPVNAPK.CPFHNYH.RDGAMRVDGNSGNG..ITYEPNSGGVFQ
CATA_DROME/26-411 TTGNGAPIGIKDASQTVGPR..........GPILLQDVNFLDEMSHFDRERIPERVVHAKGAGAFGYFEVTHDITQYCAAKIFDKVKKRTPLAVRFSTVGGESGSADTARDPRGFAVKFYTEDGVWDLVGNNTPVFFIRDPILFPSFIHTQKRNPQTHLKD----PDMFWDFLTLRPE..SAHQVCILFSD.RGTPDGYCHMNGYGSHTFKLINAKGEPIYAKFHFKTDQGIKNLD.VKTADQLASTDPDYSIRDLYNRIKTCKFPSWTMYIQVMTYEQAKKFKYNPFDVTKVWSQKEYPLIPVGKMVLDRNPKNYFAEVEQIAFSPAHLVPGVEPSPDKMLHGRLFSYSDTHRHRLG-PNYLQIPVNCPYkVKIENFQ.RDGAMNVTDNQDGA..PNYFPNSFNGPQ
CATA_BOVIN/27-412 TTGGGNPVGDKLNSLTVGPR..........GPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDALLFPSFIHSQKRNPQTHLKD----PDMVWDFWSLRPE..SLHQVSFLFSD.RGIPDGHRHMDGYGSHTFKLVNADGEAVYCKFHYKTDQGIKNLS.VEDAARLAHEDPDYGLRDLFNAIATGNYPSWTLYIQVMTFSEAEIFPFNPFDLTKVWPHGDYPLIPVGKLVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFAYPDTHRHRLG-PNYLQIPVNCPYrARVANYQ.RDGPMCMMDNQGGA..PNYYPNSFSAPE
BCA_STRVL/7-391 TTEAGAPVADNQNSETAGVG..........GPVLVQDQLLLEKLAHFNRERIPERVVHARGAGAYGTFTLTRDVSRWTRAAFLSEVGKRTETFLRFSTVAGSLGAADAVRDPRGWALKFYTEEGNYDLVGNNTPVFFIKDAIKFPDFIHTQKRDPYTGSQE----ADNVWDFWGLSPE..STHQVTWLFGD.RGIPASYRHMNGYGSHTYQWNNEAGEVFWVKYHFKTDQGIKNLT.QDEANRLAGEDPDSHQRDLREAIERGDFPTWTVQVQIMPAADAAGYRFNPFDLTKVWPHEDYPPVEIGTLELNRNPENIFAEVEQSIFSPAHFVPGIGPSPDKMLQGRLFAYGDAHRYRVG-INADHLPVNRPH.ATEARTHsRDGFLYDGRHKG-A..KNYEPNSFGGPV
CATA_BACSU/6-390 TTSWGAPVGDNQNSMTAGSR..........GPTLIQDVHLLEKLAHFNRERVPERVVHAKGAGAHGYFEVTNDVTKYTKAAFLSEVGKRTPLFIRFSTVAGELGSADTVRDPRGFAVKFYTEEGNYDIVGNNTPVFFIRDAIKFPDFIHTQKRDPKTHLKN----PTAVWDFWSLSPE..SLHQVTILMSD.RGIPATLRHMHGFGSHTFKWTNAEGEGVWIKYHFKTEQGVKNLD.VNTAAKIAGENPDYHTEDLFNAIENGDYPAWKLYVQIMPLEDANTYRFDPFDVTKVWSQKDYPLIEVGRMVLDRNPENYFAEVEQATFSPGTLVPGIDVSPDKMLQGRLFAYHDAHRYRVG-ANHQALPINRAR.NKVNNYQ.RDGQMRFGDNGGGS..VYYEPNSFGGPK
CATA_LACSK/6-388 TTNEGQPWADNQHSQTAGQR..........GPVLIQDYQLLEKLAHFNRERIPERVVHAKGAGAKGYFKVTKDMSAYTKAAVFSGVGKKTPLITRFSQVAGEAGYPDTYRDVRGFAVKFYTEEGNYDIVGNNTPVFFVNDPLKFPDFIHSQKRDPRTHARS----QDMQWDFWSLSPE..SVHQVTILMSD.RGIPASYRMMHGFGSHTFKWVNAQGEQFWVKYHFKTNQGIHNLS.NELADELAGKDTDYLQNDLFDAIETGDYPSWTVAVQLVPYEDGLNYPQDIFDVTKVISQKDYPLIEIGQMVLDENPTNNFEDIQELAFSPANLVPGIEASPDKLLQGRLFGYKDAERYRLG-ANYEQLPVNRPK.VPVHNYE.RDGAMAQNQATG--..VNYEPNSQDGPT
CATA_YEAST/23-410 TNSTGNPINEPFVTQRIGEH..........GPLLLQDYNLIDSLAHFNRENIPQRNPHAHGSGAFGYFEVTDDITDICGSAMFSKIGKRTKCLTRFSTVGGDKGSADTVRDPRGFATKFYTEEGNLDWVYNNTPVFFIRDPSKFPHFIHTQKRNPQTNLRD----ADMFWDFLTTPENqvAIHQVMILFSD.RGTPANYRSMHGYSGHTYKWSNKNGDWHYVQVHIKTDQGIKNLT.IEEATKIAGSNPDYCQQDLFEAIQNGNYPSWTVYIQTMTERDAKKLPFSVFDLTKVWPQGQFPLRRVGKIVLNENPLNFFAQVEQAAFAPSTTVPYQEASADPVLQARLFSYADAHRYRLG-PNFHQIPVNCPYaSKFFNPAiRDGPMNVNGNFGSE..PTYLAN-DKSYT
CATA_PICAN/8-404 TTSQGCPVSDPFTTQRIPLDstgykyappiGPLLLQDFKLIDTLSHFDRERIPERVVHAKGAGAYGVFEVTDDITDVCSAKFLDTVGKKTRIFTRFSTVGGEKGSADTARDPRGFATKFYTEDGNLDLVYNNTPIFFIRDPIKFPHFIHTQKRNPATNLKD----PNMFWDYLTANDE..SLHQVMYLFSN.RGTPASYRTMNGYSGHTYKWYNSKGEWVYVQVHFIANQGVHNLL.DEEAGRLAGEDPDHSTRDLWEAIEKGDYPSWECYIQTMTLEQSKKLPFSVFDLTKVWPHKDFPLRHFGRFTLNENPKNYYAETEQIAFSPSHTVPGMEPSNDPVLQSRLFSYPDTHRHRLG-PNYHQIPVNCPLkSGSFNPInRDGPMCVDGNLGGT..PNYANAYNCPIQ
CATA_CANTR/5-390 TNSNGQPIPEPFATQRVGQH..........GPLLLQDFNLIDSLAHFDRERIPERVVHAKGSGAYGVFEVTDDITDVCAAKFLDTVGKKTRIFTRFSTVGGELGSADTARDPRGFATKFYTEEGNLDLVYNNTPVFFIRDPSKFPHFIHTQKRNPETHLKD----ANMFWDYLTTNEE..SVHQVMVLFSD.RGTPASYREMNGYSGHTYKWSNNKGEWFYVQVHFISDQGIKTLT.NEEAGSLAGSNPDYAQEDLFKNIAAGNYPSWTCYIQTMTEAQAKEAEFSVFDLTKVWPHGKYPMRRFGKFTLNENPKNYFAEVEQAAFSPAHTVPHMEPSADPVLQSRLFSYADTHRHRLG-TNYTQIPVNCPVtGAVFNPHmRDGAMNVNGNLGNH..PNYLAS-DKPIE
CATA_MICLU/14-396 TRQNGAPAVSDRQSLTVGSE..........GPIVLHDTHLLETHQHFNRMNIPERRPHAKGSGAFGEFEVTEDVSKYTKALVFQP-GTKTETLLRFSTVAGELGSPDTWRDVRGFALRFYTEEGNYDLVGNNTPIFFLRDPMKFTHFIRSQKRLPDSGLRD----ATMQWDFWTNNPE..SAHQVTYLMGP.RGLPRTWREMNGYGSHTYLWVNAQGEKHWVKYHFISQQGVHNLS.NDEATKIAGENADFHRQDLFESIAKGDHPKWDLYIQAIPYEEGKTYRFNPFDLTKTISQKDYPRIKVGTLTLNRNPENHFAQIESAAFSPSNTVPGIGLSPDRMLLGRAFAYHDAQLYRVG-AHVNQLPVNRPK.NAVHNYA.FEGQMWYDHTGDR-..STYVPNSNGDSW
CATA_PENJA/14-400 LAIMVAAAVESESSLTDGDA..........GALLLQDISEWDEVFRFDRLEAVERAAHAAAAAAFGAFVARGDWTASAAAAFQAA-GKQIAFMAAFSTVAGAKGS-ATVRDADAFAAKFASAAALQELVGNNSPISFFIFDLLFAAILFASKAKAANQAAFAAAAELAAESLFVRLPS..-LHQVSFFALAgFAAVAAHRHMNGYGSHTFKLVAKDGSVYCSKFWYKADQGQAAEV.WKDAEEVAAEDVDYFRDLNFQAEAAGRYPLWELASQVMTFSDFEIDPFNENIPTKVVPRESVPLIVDAELLLNRNPLNMFAEVEQVFMDVAAASKGADEVEDPLIQ-RQFAYIDTHLSELT--ASYGIPVCRPY.ATVLNDQ.EDGARYDDVQDVLViaPNAFSASAVEVQ