EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00170 alignment
(22 sequences with 65 aa)


YEN5_YEAST/382-446 AKAWKRARLLERNRIAASKCRQRKKMSQLQLQREFDQISKENTMMKKKIENYEKLVQKMKKISRL
ATF4_HUMAN/276-340 EKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEE
TAF1_TOBAC/192-256 ERELKREKRKQSNRESARRSRLRKQAEAEELAIRVQSLTAENMTLKSEINKLMENSEKLKLENAA
CPRF1_PETCR/267-331 DRDLKRERRKQSNRESARRSRLRKQAEAEELAIKVDSLTAENMALKAEINRLTLTAEKLTNDNSR
GBF3_ARATH/257-321 ERELKRERRKQSNRESARRSRLRKQAETEELARKVEALTAENMALRSELNQLNEKSDKLRGANAT
GBF2_ARATH/247-311 EKEVKREKRKQSNRESARRSRLRKQAETEQLSVKVDALVAENMSLRSKLGQLNNESEKLRLENEA
EMP1_WHEAT/248-312 ERELKRERRKQSNRESARRSRLRKQQECEELAQKVSELTAANGTLRSELDQLKKDCKTMETENKK
HBPA_WHEAT/250-314 ERELKKQKRKLSNRESARRSRLRKQAECEELGQRAEALKSENSSLRIELDRIKKEYEELLSKNTS
GBF1_ARATH/220-284 ERELKRQKRKQSNRESARRSRLRKQAECEQLQQRVESLSNENQSLRDELQRLSSECDKLKSENNS
CPRF3_PETCR/194-258 ERELKRQRRKQSNRESARRSRLRKQAKSDELQERLDNLSKENRILRKNLQRISEACAEVTSENHS
GBF4_ARATH/185-249 KAAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEENEQLLKEIEESTKERYKKLMEVLI
CREB_BOVIN/265-325 EAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYC----HKSD
ATF1_HUMAN/211-271 DPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYS----NKSV
CREM_HUMAN/272-332 EATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICS----PKTD
CREBA_DROME/439-503 EKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHK
JUNB_HUMAN/266-330 QERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMT
AP1_CHICK/229-293 QERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMN
AP1_DROME/210-274 QEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGENVDLASIVKNLKDHVAQLKQQVME
GCN4_YEAST/223-280 ESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKN-------YHLENEVARLKKLVGE
CPC1_NEUCR/214-270 DPSDVVAMKRARNTLAARKSRERKAQRLEELEAKIEELIAER-------DRWKNLALAHGASTE-
BZLF1_EBV/170-231 ECDSELEIKRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLR---LLLKQMCPSLDVDSII
YAP4_YEAST/235-295 GKPLRNTKRAAQNRSAQKAFRQRREKYIKNLEEKSKLFDGLMK----ENSELKKMIESLKSKLKE