EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00143 alignment
(17 sequences with 193 aa)


INO2_HORSE/1-187 MALLPSLLTALVVYE-LWPCGALGCDLPQNHILVSRKNFVLLGQMSRISSAICLKDRKDFRFPQDMADGRQFPEAQAASVLHEMLQQIFSLFHTERSS.AAWNTTLLDELCTGLLRQLEDLDTCLEQEMGEEESALGTVRPT...LAVKRYFRGIHLYLKEKKYSDCAWEIVRMEIMRSFSSS.ANLQGRLRM
INO1_HORSE/1-187 MAFSVSSLMALVVIS-SSPVSSMSCDLPASLDLRKQETLRVLHQMETISPPSCLKHRTDFRFPQEQLDGRQFPEAQATSVLQEMLQQIVSLFHTERSS.AAWNTTLLDRLLAGLHQQLEDLNTCLDEQTGEEESALGTVGPT...LAVKRYFRRIRLYLTEKKYSDCAWEIVRVDIMRSFSSS.ANLQGRLGM
INO1_HUMAN/1-187 MALLFPLLAALVMTS-YSPVGSLGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSS.AAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPA...LTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLS.TNMQERLRS
IND1_HUMAN/1-187 MAFVLSLLMALVLVS-YGPGGSLGCDLSQNHVLVGRKNLRLLDEMRRLSPHFCLQDRKDFALPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHTEHSS.AAWDTTLLEPCRTGLHQQLDNLDACLGQVMGEEDSALGRTGPT...LALKRYFQGIHVYLKEKGYSDCAWETVRLEIMRSFSSL.ISLQERLRM
INT1_BOVIN/1-187 MAFVLSLLMALVLVS-YGPGRSLGCYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSS.AAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPI...LTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSS.TTLQKRLRK
INA_FELCA/1-192 MALPSSFLVALVALG-CNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFAFPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSsAAWNTTLLEEFCTGLDRQLTRLEACVLQEVEEGEAPLTNEDIHpedSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYYSsTALQKRLRS
INA4_HUMAN/1-187 MALSFSLLMAVLVLS-YKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSS.AAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNVDSI...LAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFS.TNLQKRLRR
INA1_HUMAN/1-187 MASPFALLMVLVVLS-CKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSS.AAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSI...LAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLS.TNLQERLRR
INA1_HORSE/1-184 MALPVSLLMALVVLS-CHSICSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFGFPQEVFDGNQFRKPQAISAVHETIQQIFHLFSTDGSS.AAWDESLLDKLYTGLYQQLTELEACLSQEVGVEETPLMNEDSL...LAVRRYFQRIALYLQEKKYSPCAWEIVRAEIMRSFSSS.TNLPQS---
INA1_BOVIN/1-187 MAPAWSLLLALLLLS-CNAICSLGCHLPHSHSLAKRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSA.AVWDESLLDRLRTALDQQLTDLQACLRQEEGLPGAPLLKEDSS...LAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSS.TNLQERFRR
INA4_MOUSE/1-183 MARLCAFLMILVMMSYYWSACSLGCDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLS.ATWNATLLDSFCNDLHQQLNDLKACVMQ-----EPPLTQEDSL...LAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSS.TNLLARLSE
INA1_MOUSE/1-187 MARLCAFLMVLAVMS-YWPTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSS.AAWNATLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDAL...LAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSS.ANVLGRLRE
INB_MOUSE/1-182 MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKIN---LTYRADFKIPMEMT--EKMQKSYTAFAIQEMLQNVFLVFRNNFSS.TGWNETIVVRLLDELHQQTVFLKTVLEEKQE-ERLTWEMSSTA...LHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLII.RRLTRNFQN
INB_HUMAN/1-187 MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEY-CLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSS.TGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSS...LHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFI.NRLTGYLRN
INB_HORSE/1-186 MTYRWILPMALLLCFSTTALSVNYDLLRSQLRSSNSACLMLLRQLNGAPQR-CPEDTMNFQVPEEIEQAQQFQKEDAALVIYEMLQHTWRIFRRNFAS.TGWNETIVKNLLVEVHLQMDRLETNLEEIME-EESSTWGNTTI...LRLKKYYGRISQYLKAKKYSHCAWTVVQAEMLRNLAFL.NGLTDYLQN
INB1_BOVIN/1-186 MTYRCLLQMVLLLCFSTTALSRSYSLLRFQQRQSLKECQKLLGQLPSTSQH-CLEARMDFQMPEEMKQEQQFQKEDAILVMYEVLQHIFGILTRDFSS.TGWSETIIEDLLKELYWQMNRLQPIQKEIMQ-KQNSTTEDTIV...PHLGKYYFNLMQYLESKEYDRCAWTVVQVQILTNVSFL.MRLTGYVRD
INF1_CHICK/9-193 HPRGYGILLLTLLLKALATTASACNHLRPQDATFSHDSLQLLRDMAPTLPQLCPQHNASCSFNDTILDTSNTR--QADKTTHDILQHLFKILSSPSTP.AHWNDSQRQSLLNRIHRYTQHLEQCLDSSDTRSRTRWPRNLHL...-TIKKHFSCLHTFLQDNDYSACAWEHVRLQARAWFLHI.HNLTGNTRT