EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00039 alignment
(20 sequences with 42 aa)


URT2_DESRO/42-79 CRDEKTQMIYQQQ.ESWLRPEVRSKRVEHCRC---DRGLAQC
TPA_RAT/38-75 CRDEQTQTTYQQH.QSWLRPMLRGNRVEYCRC---NSGLAQC
TPA_MOUSE/38-75 CRDEPTQTTYQQH.QSWLRPMLRSSRVEYCRC---NSGLVQC
TPA_HUMAN/41-78 CRDEKTQMIYQQH.QSWLRPVLRSNRVEYCWC---NSGRAQC
HGFA_HUMAN/202-237 CFD-ETRYEYLEGgDRWARVRQ-GHVEQ-CECFGGRTW---C
FINC_BOVIN/530-568 CQDSETRTFYQIG.DSWEKYLQ-GVRYQ-CYCYGRGIGEWAC
FINC_HUMAN/561-599 CQDSETGTFYQIG.DSWEKYVH-GVRYQ-CYCYGRGIGEWHC
FINC_BOVIN/200-239 CNDQDTRTSYRIG.DTWSKKDNRGNLLQ-CICTGNGRGEWKC
FINC_BOVIN/2174-2209 CYD-D-GKTYHVG.EQWQKEYL-GAICS-CTCFGGQRG-WRC
FINC_BOVIN/21-56 CYD-N-GKHYQIN.QQWERTYL-GSALV-CTCYGGSRG-FNC
FINC_BOVIN/487-524 CIV-D-GITYNVN.DTFHKRHEEGHMLN-CTCFGQGRGRWKC
FINC_BOVIN/155-194 CFDQAAGTSYVVG.ETWEKPYQ-GWMMVDCTCLGEGSGRITC
FINC_BOVIN/66-104 CFDKYTGNTYRVG.DTYERPKD-SMIWD-CTCIGAGRGRISC
FINC_BOVIN/2130-2167 CHD-N-GVNYKIG.EKWDRQGENGQMMS-CTCLGNGKGEFKC
FINC_BOVIN/110-148 CHE-G-GQSYKIG.DTWRRPHETGGYMLECVCLGNGKGEWTC
FINC_BOVIN/439-477 CTT-NEGVMYRIG.DQWDKQHDMGHMMR-CTCVGNGRGEWTC
FINC_BOVIN/277-311 CVT-DSGVVYSVG.MQWLKTQG-NKQML-CTCLGNGVS---C
FINC_BOVIN/2085-2124 CFDPYTVSHYAIG.EEWERLSDSGFKLS-CQCLGFGSGHFRC
FINC_HUMAN/2206-2245 CFDPYTVSHYAVG.DEWERMSESGFKLL-CQCLGFGSGHFRC
FA12_HUMAN/135-170 CFEPQLLRFFHKN.EIWYRTEQ-AAVAR-CQCKG---PDAHC