ID CM000669; SV 1; linear; genomic DNA; CON; HUM; 159138663 BP. XX AC CM000669; XX PR Project:PRJNA31257; XX DT 03-MAR-2009 (Rel. 100, Created) DT 30-JUN-2009 (Rel. 101, Last updated, Version 2) XX DE Homo sapiens chromosome 7, GRCh37 primary reference assembly. XX KW . XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RC Erratum:[Nature 2001 Aug 2;412(6846):565] RP 1-159138663 RX DOI; 10.1038/35057062. RX PUBMED; 11237011. RG International Human Genome Sequencing Consortium RA Lander E.S., Linton L.M., Birren B., Nusbaum C., Zody M.C., Baldwin J., RA Devon K., Dewar K., Doyle M., FitzHugh W., Funke R., Gage D., Harris K., RA Heaford A., Howland J., Kann L., Lehoczky J., LeVine R., McEwan P., RA McKernan K., Meldrim J., Mesirov J.P., Miranda C., Morris W., Naylor J., RA Raymond C., Rosetti M., Santos R., Sheridan A., Sougnez C., RA Stange-Thomann N., Stojanovic N., Subramanian A., Wyman D., Rogers J., RA Sulston J., Ainscough R., Beck S., Bentley D., Burton J., Clee C., RA Carter N., Coulson A., Deadman R., Deloukas P., Dunham A., Dunham I., RA Durbin R., French L., Grafham D., Gregory S., Hubbard T., Humphray S., RA Hunt A., Jones M., Lloyd C., McMurray A., Matthews L., Mercer S., Milne S., RA Mullikin J.C., Mungall A., Plumb R., Ross M., Shownkeen R., Sims S., RA Waterston R.H., Wilson R.K., Hillier L.W., McPherson J.D., Marra M.A., RA Mardis E.R., Fulton L.A., Chinwalla A.T., Pepin K.H., Gish W.R., RA Chissoe S.L., Wendl M.C., Delehaunty K.D., Miner T.L., Delehaunty A., RA Kramer J.B., Cook L.L., Fulton R.S., Johnson D.L., Minx P.J., Clifton S.W., RA Hawkins T., Branscomb E., Predki P., Richardson P., Wenning S., Slezak T., RA Doggett N., Cheng J.F., Olsen A., Lucas S., Elkin C., Uberbacher E., RA Frazier M., Gibbs R.A., Muzny D.M., Scherer S.E., Bouck J.B., RA Sodergren E.J., Worley K.C., Rives C.M., Gorrell J.H., Metzker M.L., RA Naylor S.L., Kucherlapati R.S., Nelson D.L., Weinstock G.M., Sakaki Y., RA Fujiyama A., Hattori M., Yada T., Toyoda A., Itoh T., Kawagoe C., RA Watanabe H., Totoki Y., Taylor T., Weissenbach J., Heilig R., Saurin W., RA Artiguenave F., Brottier P., Bruls T., Pelletier E., Robert C., Wincker P., RA Smith D.R., Doucette-Stamm L., Rubenfield M., Weinstock K., Lee H.M., RA Dubois J., Rosenthal A., Platzer M., Nyakatura G., Taudien S., Rump A., RA Yang H., Yu J., Wang J., Huang G., Gu J., Hood L., Rowen L., Madan A., RA Qin S., Davis R.W., Federspiel N.A., Abola A.P., Proctor M.J., Myers R.M., RA Schmutz J., Dickson M., Grimwood J., Cox D.R., Olson M.V., Kaul R., RA Raymond C., Shimizu N., Kawasaki K., Minoshima S., Evans G.A., RA Athanasiou M., Schultz R., Roe B.A., Chen F., Pan H., Ramser J., RA Lehrach H., Reinhardt R., McCombie W.R., de la Bastide M., Dedhia N., RA Blocker H., Hornischer K., Nordsiek G., Agarwala R., Aravind L., RA Bailey J.A., Bateman A., Batzoglou S., Birney E., Bork P., Brown D.G., RA Burge C.B., Cerutti L., Chen H.C., Church D., Clamp M., Copley R.R., RA Doerks T., Eddy S.R., Eichler E.E., Furey T.S., Galagan J., Gilbert J.G., RA Harmon C., Hayashizaki Y., Haussler D., Hermjakob H., Hokamp K., Jang W., RA Johnson L.S., Jones T.A., Kasif S., Kaspryzk A., Kennedy S., Kent W.J., RA Kitts P., Koonin E.V., Korf I., Kulp D., Lancet D., Lowe T.M., RA McLysaght A., Mikkelsen T., Moran J.V., Mulder N., Pollara V.J., RA Ponting C.P., Schuler G., Schultz J., Slater G., Smit A.F., Stupka E., RA Szustakowski J., Thierry-Mieg D., Thierry-Mieg J., Wagner L., Wallis J., RA Wheeler R., Williams A., Wolf Y.I., Wolfe K.H., Yang S.P., Yeh R.F., RA Collins F., Guyer M.S., Peterson J., Felsenfeld A., Wetterstrand K.A., RA Patrinos A., Morgan M.J., de Jong P., Catanese J.J., Osoegawa K., RA Shizuya H., Choi S., Chen Y.J.; RT "Initial sequencing and analysis of the human genome"; RL Nature 409(6822):860-921(2001). XX RN [2] RP 1-159138663 RX DOI; 10.1038/nature01782. RX PUBMED; 12853948. RA Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., RA Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., RA Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., RA Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H., Sun H., RA Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., RA Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., RA Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., RA Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., RA Rohlfing T., Rock S.M., Tin-Wollam A.M., Abbott A., Minx P., Maupin R., RA Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., RA Woessner J.P., Wendl M.C., Yang S.P., Schultz B.R., Wallis J.W., Spieth J., RA Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., RA Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., RA Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., RA Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., RA Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., RA Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., RA Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., RA Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.; RT "The DNA sequence of human chromosome 7"; RL Nature 424(6945):157-164(2003). XX RN [3] RP 1-159138663 RX DOI; 10.1038/nature03001. RX PUBMED; 15496913. RG International Human Genome Sequencing Consortium RA ; RT "Finishing the euchromatic sequence of the human genome"; RL Nature 431(7011):931-945(2004). XX RN [4] RP 1-159138663 RG Genome Reference Consortium RA ; RT ; RL Submitted (24-FEB-2009) to the INSDC. RL NCBI, NIH, Bethesda, MD 20892, USA XX CC The DNA sequence is composed of genomic sequence, primarily CC finished clones that were sequenced as part of the Human Genome CC Project. PCR products and WGS shotgun sequence have been added CC where necessary to fill gaps or correct errors. All such additions CC are manually curated by GRC staff. For more information see: CC http://genomereference.org. XX CO join(gap(10000),GL000055.1:1..50360631,gap(40000),GL000056.1:1..7643700, CO gap(3000000),GL000057.1:1..256182,gap(50000),GL000058.1:1..556644, CO gap(50000),GL000059.1:1..77412220,gap(25000),GL000060.1:1..14866257, CO gap(100000),GL000061.1:1..4758029,gap(10000)) XX FH Key Location/Qualifiers FH FT source 1..159138663 FT /organism="Homo sapiens" FT /chromosome="7" FT /mol_type="genomic DNA" FT /db_xref="taxon:9606" FT gap 1..10000 FT /estimated_length=10000 FT unsure 10001..10241 FT /note="Unresolved tandem repeat." FT unsure 16335..16384 FT /note="Sequence derived from one plasmid subclone." FT unsure 16385..16992 FT /note="Unresolved tandem repeat." FT repeat_region 44728..44800 FT /rpt_family="MIR" FT repeat_region 45268..45294 FT /rpt_family="(CTCA)n" FT repeat_region 45295..45407 FT /rpt_family="L2" FT repeat_region 49850..50014 FT /rpt_family="L1" FT repeat_region 50015..50399 FT /rpt_family="ERV1" FT repeat_region 50400..50691 FT /rpt_family="Alu" FT repeat_region 50692..50794 FT /rpt_family="ERV1" FT repeat_region 50795..51439 FT /rpt_family="L1" FT repeat_region 51533..52066 FT /rpt_family="ERVL" FT repeat_region 52133..52351 FT /rpt_family="MER1_type" FT repeat_region 52409..53626 FT /rpt_family="L1" FT repeat_region 53636..53707 FT /rpt_family="Alu" FT repeat_region 53860..53919 FT /rpt_family="MIR" FT repeat_region 54642..54776 FT /rpt_family="MIR" FT repeat_region 56172..56385 FT /rpt_family="L2" FT repeat_region 56974..57137 FT /rpt_family="MIR" FT repeat_region 58541..58760 FT /rpt_family="MER1_type" FT repeat_region 58982..59518 FT /rpt_family="ERVL" FT repeat_region 65844..65915 FT /rpt_family="MIR" FT repeat_region 67218..68010 FT /rpt_family="ERVL" FT repeat_region 68020..68481 FT /rpt_family="L2" FT repeat_region 69965..70400 FT /rpt_family="ERVL" FT repeat_region 70745..70855 FT /rpt_family="MIR" FT repeat_region 71626..71685 FT /rpt_family="MIR" FT repeat_region 71850..71962 FT /rpt_family="MIR" FT repeat_region 74279..75117 FT /rpt_family="L1" FT repeat_region 75118..75380 FT /rpt_family="Alu" FT repeat_region 75381..75442 FT /rpt_family="L1" FT repeat_region 75518..76103 FT /rpt_family="L1" FT repeat_region 76143..76526 FT /rpt_family="L1" FT repeat_region 76708..77127 FT /rpt_family="CT-rich" FT repeat_region 78936..79010 FT /rpt_family="(TCCTG)n" FT repeat_region 79188..79615 FT /rpt_family="MaLR" FT repeat_region 82006..82174 FT /rpt_family="(CA)n" FT misc_feature 82325..82592 FT /note="CpG_island (%GC=67.9, o/e=0.69, #CpGs=20)" FT repeat_region 84977..85073 FT /rpt_family="MER2_type" FT repeat_region 85139..85296 FT /rpt_family="(TG)n" FT repeat_region 85336..85448 FT /rpt_family="(TG)n" FT repeat_region 88228..88377 FT /rpt_family="MaLR" FT repeat_region 88457..88540 FT /rpt_family="MaLR" FT repeat_region 89212..89376 FT /rpt_family="(TG)n" FT repeat_region 89916..90294 FT /rpt_family="L1" FT repeat_region 90599..90914 FT /rpt_family="(TG)n" FT repeat_region 90921..91018 FT /rpt_family="(TATATG)n" FT repeat_region 91026..91203 FT /rpt_family="(TG)n" FT repeat_region 92759..92817 FT /rpt_family="A-rich" FT repeat_region 93409..93710 FT /rpt_family="MER1_type" FT repeat_region 94204..94648 FT /rpt_family="L1" FT repeat_region 94739..95293 FT /rpt_family="L1" FT repeat_region 96215..96512 FT /rpt_family="Alu" FT repeat_region 97942..98242 FT /rpt_family="Alu" FT repeat_region 98302..99160 FT /rpt_family="L1" FT repeat_region 99161..99455 FT /rpt_family="Alu" FT repeat_region 99456..99690 FT /rpt_family="L1" FT repeat_region 99680..101113 FT /rpt_family="L1" FT repeat_region 102485..102628 FT /rpt_family="MIR" FT repeat_region 102801..102879 FT /rpt_family="L1" FT misc_feature 103275..104053 FT /note="CpG_island (%GC=65.6, o/e=0.50, #CpGs=54)" FT repeat_region 103435..104038 FT /rpt_family="(CACCG)n" FT repeat_region 104128..104613 FT /rpt_family="L1" FT repeat_region 104627..104834 FT /rpt_family="L1" FT repeat_region 104835..105179 FT /rpt_family="MER2_type" FT repeat_region 105180..105201 FT /rpt_family="(AGGTG)n" FT repeat_region 105202..105522 FT /rpt_family="MER2_type" FT repeat_region 105523..105934 FT /rpt_family="L1" FT repeat_region 105935..106237 FT /rpt_family="Alu" FT repeat_region 106238..106770 FT /rpt_family="L1" FT repeat_region 106776..107086 FT /rpt_family="L1" FT repeat_region 107088..107703 FT /rpt_family="L1" FT repeat_region 107801..107897 FT /rpt_family="(CA)n" FT repeat_region 107985..108091 FT /rpt_family="(CA)n" FT repeat_region 108132..108306 FT /rpt_family="(CA)n" FT repeat_region 108320..108495 FT /rpt_family="(CA)n" FT repeat_region 109123..109256 FT /rpt_family="MIR" FT repeat_region 110592..110831 FT /rpt_family="MIR" FT repeat_region 111183..112599 FT /rpt_family="L1" FT repeat_region 112707..113054 FT /rpt_family="L1" FT repeat_region 113089..113184 FT /rpt_family="L1" FT repeat_region 113198..113465 FT /rpt_family="L1" FT repeat_region 113528..115263 FT /rpt_family="L1" FT repeat_region 115267..115338 FT /rpt_family="L1" FT repeat_region 115347..115674 FT /rpt_family="L1" FT repeat_region 115911..116052 FT /rpt_family="GA-rich" FT repeat_region 116970..117260 FT /rpt_family="Alu" FT repeat_region 117261..117283 FT /rpt_family="(TA)n" FT misc_feature 117562..117866 FT /note="CpG_island (%GC=78.4, o/e=1.00, #CpGs=32)" FT repeat_region 118269..118940 FT /rpt_family="ERVL" FT misc_feature 120520..120758 FT /note="CpG_island (%GC=63.2, o/e=0.81, #CpGs=17)" FT repeat_region 121480..121770 FT /rpt_family="GA-rich" FT repeat_region 122127..123168 FT /rpt_family="L1" FT repeat_region 123622..123992 FT /rpt_family="L1" FT repeat_region 124107..124249 FT /rpt_family="MIR" FT repeat_region 125434..125538 FT /rpt_family="MIR" FT repeat_region 125541..125742 FT /rpt_family="L1" FT repeat_region 125988..126295 FT /rpt_family="Alu" FT repeat_region 126312..126744 FT /rpt_family="L1" FT repeat_region 126745..126887 FT /rpt_family="L1" FT repeat_region 130072..130204 FT /rpt_family="MIR" FT repeat_region 130267..130321 FT /rpt_family="L1" FT repeat_region 130459..130518 FT /rpt_family="L1" FT repeat_region 130521..130581 FT /rpt_family="MER2_type" FT repeat_region 130582..130894 FT /rpt_family="L1" FT repeat_region 130895..131015 FT /rpt_family="MER2_type" FT repeat_region 131560..131595 FT /rpt_family="G-rich" FT repeat_region 132112..132484 FT /rpt_family="MaLR" FT repeat_region 132541..132706 FT /rpt_family="L2" FT repeat_region 132841..133258 FT /rpt_family="(TCTA)n" FT repeat_region 133277..133401 FT /rpt_family="L2" FT repeat_region 133794..133910 FT /rpt_family="(TGGGGG)n" FT repeat_region 135559..135702 FT /rpt_family="ERVL" FT repeat_region 136119..136735 FT /rpt_family="ERV1" FT repeat_region 137254..137433 FT /rpt_family="L1" FT repeat_region 137434..137836 FT /rpt_family="ERV1" FT repeat_region 137837..137862 FT /rpt_family="L1" FT repeat_region 138037..138067 FT /rpt_family="AT_rich" FT repeat_region 138133..138258 FT /rpt_family="ERV1" FT repeat_region 138259..138554 FT /rpt_family="Alu" FT repeat_region 138555..138748 FT /rpt_family="ERV1" FT repeat_region 138775..139028 FT /rpt_family="ERV1" FT repeat_region 140677..140948 FT /rpt_family="ERV1" FT repeat_region 141037..141344 FT /rpt_family="ERV1" FT repeat_region 142865..143207 FT /rpt_family="L1" FT repeat_region 144369..144517 FT /rpt_family="L2" FT repeat_region 145912..146318 FT /rpt_family="ERV1" FT repeat_region 146319..146531 FT /rpt_family="ERV1" FT repeat_region 146532..146655 FT /rpt_family="ERV1" FT misc_feature 149025..150038 FT /note="CpG_island (%GC=65.7, o/e=0.80, #CpGs=96)" FT repeat_region 149159..149292 FT /rpt_family="SUBTEL_sa" FT repeat_region 149433..149477 FT /rpt_family="SUBTEL_sa" FT repeat_region 150600..151006 FT /rpt_family="ERV1" FT repeat_region 151335..151610 FT /rpt_family="Alu" FT repeat_region 152071..152329 FT /rpt_family="Alu" FT repeat_region 152986..153145 FT /rpt_family="L1" FT repeat_region 153428..153640 FT /rpt_family="MaLR" FT repeat_region 153889..154075 FT /rpt_family="ERVL" FT repeat_region 154160..154303 FT /rpt_family="ERVL" FT repeat_region 154355..154925 FT /rpt_family="MER1_type" FT repeat_region 158628..158851 FT /rpt_family="MaLR" FT misc_feature 159774..160039 FT /note="CpG_island (%GC=70.3, o/e=1.61, #CpGs=29)" FT repeat_region 160188..160480 FT /rpt_family="Alu" FT repeat_region 160565..160719 FT /rpt_family="MER1_type" FT repeat_region 162284..162325 FT /rpt_family="(TG)n" FT repeat_region 165706..165971 FT /rpt_family="ERV1" FT repeat_region 166092..166307 FT /rpt_family="(TCCC)n" FT repeat_region 168164..168337 FT /rpt_family="ERV1" FT repeat_region 168921..169142 FT /rpt_family="Alu" FT repeat_region 170727..170956 FT /rpt_family="L1" FT misc_feature 171459..171748 FT /note="CpG_island (%GC=73.1, o/e=0.86, #CpGs=24)" FT repeat_region 171477..171553 FT /rpt_family="C-rich" FT repeat_region 173855..173884 FT /rpt_family="(TTAGGG)n" FT repeat_region 174160..174277 FT /rpt_family="(CA)n" FT repeat_region 174599..174707 FT /rpt_family="MIR" FT repeat_region 176030..176070 FT /rpt_family="(TG)n" FT repeat_region 176095..176265 FT /rpt_family="(CATATA)n" FT repeat_region 176142..176365 FT /rpt_family="(TG)n" FT misc_feature 178518..179127 FT /note="CpG_island (%GC=63.0, o/e=0.75, #CpGs=45)" FT repeat_region 179694..179811 FT /rpt_family="L2" FT repeat_region 180761..180927 FT /rpt_family="Alu" FT repeat_region 180955..181252 FT /rpt_family="MER1_type" FT repeat_region 184459..184622 FT /rpt_family="MIR" FT repeat_region 185266..185568 FT /rpt_family="Alu" FT repeat_region 185716..186012 FT /rpt_family="Alu" FT misc_feature 186353..186673 FT /note="CpG_island (%GC=68.2, o/e=0.67, #CpGs=26)" FT repeat_region 187988..188409 FT /rpt_family="ERV1" FT repeat_region 189125..189357 FT /rpt_family="L2" FT repeat_region 189518..189594 FT /rpt_family="(TG)n" FT repeat_region 189610..189686 FT /rpt_family="ERV1" FT repeat_region 189688..189828 FT /rpt_family="(TG)n" FT repeat_region 189890..189970 FT /rpt_family="(TG)n" FT repeat_region 190045..190206 FT /rpt_family="(TG)n" FT repeat_region 191341..191489 FT /rpt_family="MIR" FT repeat_region 191747..191872 FT /rpt_family="(CA)n" FT misc_feature 191812..193799 FT /note="CpG_island (%GC=78.6, o/e=0.87, #CpGs=274)" FT repeat_region 191957..191992 FT /rpt_family="GC_rich" FT repeat_region 192233..192254 FT /rpt_family="GC_rich" FT repeat_region 192607..192696 FT /rpt_family="C-rich" FT repeat_region 192743..192764 FT /rpt_family="GC_rich" FT repeat_region 192797..192838 FT /rpt_family="GC_rich" FT repeat_region 192901..192930 FT /rpt_family="GC_rich" FT repeat_region 193029..193066 FT /rpt_family="GC_rich" FT repeat_region 193177..193199 FT /rpt_family="GC_rich" FT repeat_region 193389..193442 FT /rpt_family="GC_rich" FT misc_feature 195475..195988 FT /note="CpG_island (%GC=63.6, o/e=0.69, #CpGs=35)" FT repeat_region 197117..197260 FT /rpt_family="L2" FT repeat_region 198238..198385 FT /rpt_family="MIR" FT repeat_region 198457..198681 FT /rpt_family="MER2_type" FT gap 232485..282484 FT /estimated_length=50000 FT unsure 395571..396139 FT /note="Unresolved tandem repeat." FT unsure 401292..401904 FT /note="Unresolved tandem repeat." FT unsure 482558..483811 FT /note="Unresolved tandem repeat." FT unsure 494823..497401 FT /note="Unresolved tandem repeat." FT misc_feature 506677..506797 FT /note="Sequence derived from PCR product of project DNA" FT unsure 506886..508145 FT /note="Unresolved tandem repeat." FT unsure 509773..509814 FT /note="Sequence derived from one plasmid subclone." FT unsure 509801..510900 FT /note="Unresolved tandem repeat." FT repeat_region 513012..513300 FT /rpt_family="ERVL" FT repeat_region 513504..513804 FT /rpt_family="Alu" FT repeat_region 513807..513934 FT /rpt_family="L1" FT repeat_region 514276..514570 FT /rpt_family="MaLR" FT repeat_region 515826..515915 FT /rpt_family="ERVL" FT repeat_region 516193..516545 FT /rpt_family="MaLR" FT repeat_region 516979..517008 FT /rpt_family="(TTTTTG)n" FT repeat_region 517013..517324 FT /rpt_family="Alu" FT repeat_region 517946..518922 FT /rpt_family="GA-rich" FT unsure 517996..518935 FT /note="Unresolved simple sequence repeat." FT repeat_region 518937..519087 FT /rpt_family="L1" FT repeat_region 519100..519220 FT /rpt_family="L2" FT repeat_region 521217..521313 FT /rpt_family="C-rich" FT repeat_region 521519..521699 FT /rpt_family="MIR" FT repeat_region 521731..521907 FT /rpt_family="L2" FT repeat_region 521908..522268 FT /rpt_family="(TGGA)n" FT repeat_region 522332..522784 FT /rpt_family="(TGGA)n" FT repeat_region 522785..522927 FT /rpt_family="CR1" FT repeat_region 523053..523143 FT /rpt_family="(TGGA)n" FT misc_feature 523744..523836 FT /note="match to EST AI830062 (NID:g5450733) wj58g12.x1" FT /note="similar to Sus scrofa EST BI344340 (NID:g15037629)" FT repeat_region 525889..526386 FT /rpt_family="(TG)n" FT repeat_region 526414..527234 FT /rpt_family="L1" FT repeat_region 527235..527525 FT /rpt_family="Alu" FT repeat_region 527526..527997 FT /rpt_family="L1" FT repeat_region 527998..528091 FT /rpt_family="Alu" FT repeat_region 528092..529109 FT /rpt_family="L1" FT repeat_region 529104..529477 FT /rpt_family="L1" FT repeat_region 529534..529599 FT /rpt_family="MIR" FT repeat_region 529726..529999 FT /rpt_family="Alu" FT misc_feature 531372..531696 FT /note="match to EST AI807744 (NID:g5394310) wf50a10.x1" FT repeat_region 532947..533250 FT /rpt_family="Alu" FT misc_feature 533291..533294 FT /note="match to EST BF992590 (NID:g12398913)" FT repeat_region 533877..533900 FT /rpt_family="GC_rich" FT misc_feature 534481..534593 FT /note="match to EST AI830062 (NID:g5450733) wj58g12.x1" FT misc_feature 535263..535710 FT /note="match to EST AA431156 (NID:g2114864) zw71f11.r1" FT misc_feature 535542..535755 FT /note="match to EST AI830062 (NID:g5450733) wj58g12.x1" FT misc_feature 535750..536142 FT /note="match to EST AA432176 (NID:g2114564) zw71f11.s1" FT repeat_region 535943..535977 FT /rpt_family="(GGGA)n" FT misc_feature 536119..536714 FT /note="match to EST BQ184805 (NID:g20360356)" FT misc_feature 536259..536766 FT /note="match to EST BQ187717 (NID:g20363268)" FT misc_feature 536895..537541 FT /note="match to EST BQ001096 (NID:g19725996)" FT misc_feature 536899..537306 FT /note="match to EST BE503326 (NID:g9705734)" FT misc_feature 536904..537487 FT /note="match to EST BM702563 (NID:g19015821)" FT misc_feature 537009..537014 FT /note="similar to Homo sapiens EST BF094250 FT (NID:g10899960)" FT misc_feature 537016..537147 FT /note="similar to Homo sapiens EST BF094250 FT (NID:g10899960)" FT misc_feature 537026..537350 FT /note="match to EST AV729452 (NID:g10838873)" FT misc_feature 537119..537514 FT /note="match to EST AI291742 (NID:g3934516) qm85e09.x1" FT misc_feature 537127..537520 FT /note="match to EST BE837666 (NID:g10270044)" FT misc_feature 537368..537578 FT /note="match to EST BM787770 (NID:g19136002)" FT misc_feature 537379..537574 FT /note="match to EST BF511395 (NID:g11594693)" FT misc_feature 537405..537498 FT /note="match to EST AV729452 (NID:g10838873)" FT repeat_region 537452..537664 FT /rpt_family="L1" FT misc_feature 537501..537530 FT /note="similar to Homo sapiens EST BI761739 FT (NID:g15753317)" FT misc_feature 537597..537933 FT /note="match to EST BF511395 (NID:g11594693)" FT misc_feature 537597..537865 FT /note="match to EST BM787770 (NID:g19136002)" FT misc_feature 537612..538022 FT /note="similar to Homo sapiens EST BI761739 FT (NID:g15753317)" FT misc_feature 537791..537972 FT /note="match to EST BE765968 (NID:g10195892)" FT misc_feature 537796..538211 FT /note="match to EST BQ306732 (NID:g20840455)" FT misc_feature 537831..538243 FT /note="similar to Sus scrofa EST BE231870 (NID:g9016588)" FT misc_feature 537871..538032 FT /note="match to EST AA076799 (NID:g1836273)" FT misc_feature 537896..538211 FT /note="similar to EST BY716895 (NID:g27130012)" FT misc_feature 537926..538211 FT /note="similar to EST BQ783161 (NID:g21991633)" FT /note="similar to Rattus norvegicus EST BG666087 FT (NID:g13888009)" FT repeat_region 537948..537972 FT /rpt_family="(TC)n" FT misc_feature 537958..538211 FT /note="similar to Mus musculus EST AA815901 (NID:g2885497) FT vp74e03.r1" FT /note="similar to Mus musculus EST AI893253 (NID:g5599155) FT me29e08.y1" FT /note="similar to Rattus norvegicus EST BF281159 FT (NID:g11212313)" FT /note="similar to Rattus norvegicus EST BF282869 FT (NID:g11213939)" FT misc_feature 537958..538058 FT /note="similar to Rattus sp. EST AI169449 (NID:g3705757)" FT misc_feature 537966..538193 FT /note="similar to Mus musculus EST AW044901 (NID:g5905430) FT um15b10.y1" FT misc_feature 537966..538058 FT /note="similar to Mus musculus EST AV007303 (NID:g4784290)" FT misc_feature 537972..538211 FT /note="match to EST AI583995 (NID:g4569892) ts08c03.x1" FT misc_feature 537976..538211 FT /note="match to EST BF448004 (NID:g11513233)" FT misc_feature 537985..538211 FT /note="similar to Mus musculus EST AI120252 (NID:g3520576) FT ub68b03.r1" FT misc_feature 537993..538193 FT /note="similar to Mus musculus EST AW107374 (NID:g6078174) FT um15b10.x1" FT misc_feature 538008..538211 FT /note="match to EST BF809261 (NID:g12138250)" FT misc_feature 538070..538214 FT /note="similar to Mus musculus EST AV007303 (NID:g4784290)" FT /note="similar to Rattus sp. EST AI169449 (NID:g3705757)" FT misc_feature 538081..538211 FT /note="match to EST BE315078 (NID:g9145364)" FT misc_feature 538095..538211 FT /note="match to EST AA397466 (NID:g2050507) nc65h01.r1" FT misc_feature 538096..538211 FT /note="similar to Mus musculus EST BI715983 (NID:g15691678) FT ic64b05.y2" FT misc_feature 538119..538211 FT /note="similar to EST BU340052 (NID:g25848053)" FT misc_feature 538129..538211 FT /note="similar to Mus musculus EST BF160749 FT (NID:g11040856)" FT misc_feature 538201..538204 FT /note="match to EST AU118732 (NID:g10933871)" FT repeat_region 538412..538498 FT /rpt_family="MIR" FT repeat_region 538505..538630 FT /rpt_family="MaLR" FT repeat_region 539252..539602 FT /rpt_family="MaLR" FT repeat_region 539681..539728 FT /rpt_family="MIR" FT misc_feature 539889..540067 FT /note="match to EST BI013215 (NID:g14417286)" FT misc_feature 540068..540136 FT /note="match to EST AA397466 (NID:g2050507) nc65h01.r1" FT /note="similar to Rattus norvegicus EST BF282869 FT (NID:g11213939)" FT misc_feature 540749..540879 FT /note="match to EST AU118732 (NID:g10933871)" FT /note="match to EST BF992590 (NID:g12398913)" FT misc_feature 540750..540879 FT /note="similar to EST BU370863 (NID:g25878864)" FT misc_feature 540753..540881 FT /note="similar to Mus musculus EST AA815901 (NID:g2885497) FT vp74e03.r1" FT /note="similar to Rattus norvegicus EST BF281159 FT (NID:g11212313)" FT misc_feature 540753..540879 FT /note="match to EST AA397466 (NID:g2050507) nc65h01.r1" FT /note="match to EST AI583995 (NID:g4569892) ts08c03.x1" FT /note="match to EST BE315078 (NID:g9145364)" FT /note="match to EST BF448004 (NID:g11513233)" FT /note="match to EST BQ306732 (NID:g20840455)" FT /note="similar to EST BQ783161 (NID:g21991633)" FT /note="similar to EST BU340052 (NID:g25848053)" FT /note="similar to EST BY716895 (NID:g27130012)" FT /note="similar to Mus musculus EST AI120252 (NID:g3520576) FT ub68b03.r1" FT /note="similar to Mus musculus EST AI893253 (NID:g5599155) FT me29e08.y1" FT /note="similar to Mus musculus EST BF160749 FT (NID:g11040856)" FT /note="similar to Mus musculus EST BI715983 (NID:g15691678) FT ic64b05.y2" FT /note="similar to Rattus norvegicus EST BF282869 FT (NID:g11213939)" FT /note="similar to Rattus norvegicus EST BG666087 FT (NID:g13888009)" FT /note="similar to Sus scrofa EST BI344340 (NID:g15037629)" FT misc_feature 540753..540775 FT /note="match to EST BF809261 (NID:g12138250)" FT misc_feature 540755..540879 FT /note="similar to Mus musculus EST AA240232 (NID:g1864663) FT my24b02.r1" FT misc_feature 540759..540879 FT /note="match to EST BI060733 (NID:g14468260)" FT misc_feature 540861..540879 FT /note="match to EST BF772764 (NID:g12120664)" FT repeat_region 541083..541357 FT /rpt_family="Alu" FT repeat_region 541580..541877 FT /rpt_family="Alu" FT misc_feature 541763..541765 FT /note="match to EST BQ001096 (NID:g19725996)" FT repeat_region 542406..542447 FT /rpt_family="(CA)n" FT repeat_region 542709..542807 FT /rpt_family="MIR" FT misc_feature 543257..543453 FT /note="match to EST BF874254 (NID:g12264384)" FT repeat_region 545256..545362 FT /rpt_family="MIR" FT repeat_region 545529..545828 FT /rpt_family="Alu" FT repeat_region 545864..545932 FT /rpt_family="Alu" FT repeat_region 547984..548225 FT /rpt_family="Alu" FT repeat_region 548601..548636 FT /rpt_family="MIR" FT repeat_region 548845..548925 FT /rpt_family="MaLR" FT repeat_region 548926..549227 FT /rpt_family="Alu" FT misc_feature 549165..549168 FT /note="match to EST BF771485 (NID:g12119385)" FT repeat_region 549228..549484 FT /rpt_family="MaLR" FT misc_feature 550073 FT /note="similar to Homo sapiens EST BF850576 FT (NID:g12237738)" FT misc_feature 550157..550171 FT /note="match to EST BQ306732 (NID:g20840455)" FT misc_feature 550205 FT /note="match to EST BQ306732 (NID:g20840455)" FT repeat_region 550222..550264 FT /rpt_family="(GGGGA)n" FT repeat_region 550339..550440 FT /rpt_family="(GGGGA)n" FT unsure 550385..550396 FT /note="Sequence derived from one plasmid subclone." FT misc_feature 550424..550633 FT /note="similar to Homo sapiens EST BF850576 FT (NID:g12237738)" FT misc_feature 550439..550633 FT /note="similar to EST BU359425 (NID:g25867426)" FT misc_feature 550443..550633 FT /note="similar to EST BU348200 (NID:g25856201)" FT misc_feature 550446..550637 FT /note="match to EST BF448004 (NID:g11513233)" FT misc_feature 550446..550634 FT /note="similar to EST BY716895 (NID:g27130012)" FT misc_feature 550446..550633 FT /note="match to EST AI583995 (NID:g4569892) ts08c03.x1" FT /note="match to EST AU118732 (NID:g10933871)" FT /note="match to EST BE315078 (NID:g9145364)" FT /note="match to EST BF772764 (NID:g12120664)" FT /note="similar to EST BQ783161 (NID:g21991633)" FT /note="similar to EST BU340052 (NID:g25848053)" FT /note="similar to EST BU370863 (NID:g25878864)" FT /note="similar to Mus musculus EST AA240232 (NID:g1864663) FT my24b02.r1" FT /note="similar to Mus musculus EST AI120252 (NID:g3520576) FT ub68b03.r1" FT /note="similar to Mus musculus EST BF160749 FT (NID:g11040856)" FT /note="similar to Mus musculus EST BI715983 (NID:g15691678) FT ic64b05.y2" FT /note="similar to Rattus norvegicus EST BG666087 FT (NID:g13888009)" FT /note="similar to Sus scrofa EST BI344340 (NID:g15037629)" FT misc_feature 550446..550631 FT /note="similar to Mus musculus EST AI893253 (NID:g5599155) FT me29e08.y1" FT misc_feature 550446..550616 FT /note="similar to Rattus norvegicus EST BF282869 FT (NID:g11213939)" FT misc_feature 550446..550570 FT /note="match to EST AA397466 (NID:g2050507) nc65h01.r1" FT misc_feature 550446..550543 FT /note="match to EST BI060733 (NID:g14468260)" FT misc_feature 550446..550528 FT /note="match to EST BF992590 (NID:g12398913)" FT misc_feature 550446..550447 FT /note="match to EST BQ315460 (NID:g20874621)" FT misc_feature 550473..550633 FT /note="similar to EST CB812250 (NID:g29935893)" FT misc_feature 550544..550633 FT /note="similar to Mus musculus EST BF582134 FT (NID:g11655846)" FT misc_feature 550565..550633 FT /note="match to EST BF771483 (NID:g12119383)" FT misc_feature 550577..550633 FT /note="match to EST BQ315460 (NID:g20874621)" FT repeat_region 551900..551975 FT /rpt_family="(CCCGG)n" FT misc_feature 551946..552092 FT /note="similar to Mus musculus EST BE305832 (NID:g9158128)" FT misc_feature 551988..552151 FT /note="similar to EST CB812250 (NID:g29935893)" FT misc_feature 551988..552105 FT /note="similar to Homo sapiens EST BF850576 FT (NID:g12237738)" FT misc_feature 551988..552100 FT /note="match to EST AI583995 (NID:g4569892) ts08c03.x1" FT misc_feature 551988..552092 FT /note="match to EST AU118732 (NID:g10933871)" FT /note="match to EST BE315078 (NID:g9145364)" FT /note="match to EST BF771483 (NID:g12119383)" FT /note="match to EST BQ315460 (NID:g20874621)" FT /note="similar to EST BU340052 (NID:g25848053)" FT /note="similar to EST BU348200 (NID:g25856201)" FT /note="similar to EST BU359425 (NID:g25867426)" FT /note="similar to EST BU370863 (NID:g25878864)" FT /note="similar to Mus musculus EST AI120252 (NID:g3520576) FT ub68b03.r1" FT /note="similar to Mus musculus EST AI893253 (NID:g5599155) FT me29e08.y1" FT /note="similar to Mus musculus EST BF160749 FT (NID:g11040856)" FT /note="similar to Mus musculus EST BF582134 FT (NID:g11655846)" FT misc_feature 551988..552088 FT /note="similar to Mus musculus EST AA240232 (NID:g1864663) FT my24b02.r1" FT misc_feature 551988..552087 FT /note="similar to Sus scrofa EST BI344340 (NID:g15037629)" FT misc_feature 551988..552072 FT /note="match to EST BF772764 (NID:g12120664)" FT misc_feature 551988..552066 FT /note="similar to Mus musculus EST BI715983 (NID:g15691678) FT ic64b05.y2" FT misc_feature 551988..552040 FT /note="similar to EST BQ783161 (NID:g21991633)" FT /note="similar to Rattus norvegicus EST BG666087 FT (NID:g13888009)" FT misc_feature 552024..552092 FT /note="match to EST BI010649 (NID:g14414720)" FT repeat_region 553806..553861 FT /rpt_family="MIR" FT misc_feature 556529..562845 FT /note="CpG_island (%GC=70.8, o/e=0.80, #CpGs=654)" FT repeat_region 556566..556610 FT /rpt_family="GC_rich" FT repeat_region 556943..557010 FT /rpt_family="GC_rich" FT misc_feature 557030..557127 FT /note="similar to EST BY088144 (NID:g26197680)" FT misc_feature 557031..557158 FT /note="similar to Mus musculus EST AI893253 (NID:g5599155) FT me29e08.y1" FT misc_feature 557031..557132 FT /note="similar to EST BU340052 (NID:g25848053)" FT /note="similar to EST BU348200 (NID:g25856201)" FT /note="similar to EST BU370863 (NID:g25878864)" FT misc_feature 557031..557127 FT /note="match to EST AU118732 (NID:g10933871)" FT /note="match to EST BE315078 (NID:g9145364)" FT /note="match to EST BF771483 (NID:g12119383)" FT /note="similar to EST BU359425 (NID:g25867426)" FT /note="similar to Mus musculus EST BE305832 (NID:g9158128)" FT /note="similar to Mus musculus EST BF160749 FT (NID:g11040856)" FT /note="similar to Mus musculus EST BF582134 FT (NID:g11655846)" FT misc_feature 557031..557120 FT /note="match to EST BQ315460 (NID:g20874621)" FT misc_feature 557031..557109 FT /note="similar to Mus musculus EST AI120252 (NID:g3520576) FT ub68b03.r1" FT misc_feature 557035..557127 FT /note="match to EST BI010649 (NID:g14414720)" FT misc_feature 557039..557061 FT /note="similar to Homo sapiens EST BF850576 FT (NID:g12237738)" FT misc_feature 557044..557127 FT /note="similar to EST BU671553 (NID:g23400304)" FT repeat_region 557152..557283 FT /rpt_family="GC_rich" FT repeat_region 557627..557686 FT /rpt_family="(CA)n" FT repeat_region 557961..557995 FT /rpt_family="G-rich" FT misc_feature 558056..558145 FT /note="similar to Mus musculus EST BF160749 FT (NID:g11040856)" FT misc_feature 558576..559131 FT /note="similar to EST BU671553 (NID:g23400304)" FT misc_feature 558576..558809 FT /note="match to EST AU118732 (NID:g10933871)" FT misc_feature 558576..558800 FT /note="similar to Mus musculus EST BE305832 (NID:g9158128)" FT misc_feature 558576..558767 FT /note="similar to EST BU359425 (NID:g25867426)" FT misc_feature 558576..558733 FT /note="match to EST BF771483 (NID:g12119383)" FT misc_feature 558576..558705 FT /note="similar to Mus musculus EST BF582134 FT (NID:g11655846)" FT misc_feature 558576..558622 FT /note="match to EST BI010649 (NID:g14414720)" FT misc_feature 558588..558732 FT /note="match to EST BF771485 (NID:g12119385)" FT misc_feature 558598..558705 FT /note="similar to EST BY105382 (NID:g26215999)" FT misc_feature 558634..558705 FT /note="similar to Mus musculus EST AW044901 (NID:g5905430) FT um15b10.y1" FT /note="similar to Mus musculus EST AW107374 (NID:g6078174) FT um15b10.x1" FT misc_feature 558877 FT /note="match to EST BF771485 (NID:g12119385)" FT misc_feature 558878..558880 FT /note="match to EST BE315078 (NID:g9145364)" FT repeat_region 559068..559088 FT /rpt_family="(CCG)n" FT repeat_region 559234..559358 FT /rpt_family="(CCGCG)n" FT repeat_region 559518..559562 FT /rpt_family="(CCCCCG)n" FT unsure 559544..559554 FT /note="Sequence derived from one plasmid subclone." FT misc_feature 559597..559933 FT /note="similar to Mus musculus EST BF582134 FT (NID:g11655846)" FT misc_feature 559597..559889 FT /note="similar to Mus musculus EST AW044901 (NID:g5905430) FT um15b10.y1" FT misc_feature 559597..559853 FT /note="similar to EST BY105382 (NID:g26215999)" FT misc_feature 559597..559845 FT /note="similar to EST BY088144 (NID:g26197680)" FT misc_feature 559597..559719 FT /note="similar to Mus musculus EST AW107374 (NID:g6078174) FT um15b10.x1" FT repeat_region 559631..559654 FT /rpt_family="GC_rich" FT repeat_region 559698..559734 FT /rpt_family="GC_rich" FT misc_feature 559741..559943 FT /note="similar to Mus musculus EST BE227038 (NID:g8932274) FT us76a08.y1" FT repeat_region 559906..559934 FT /rpt_family="GC_rich" FT misc_feature 560062..560066 FT /note="match to EST BF772764 (NID:g12120664)" FT misc_feature 561654..562099 FT /note="match to EST BF058414 (NID:g10812310)" FT repeat_region 562264..562285 FT /rpt_family="GC_rich" FT misc_feature 562396..562401 FT /note="match to EST BQ184805 (NID:g20360356)" FT misc_feature 562865..563166 FT /note="match to EST AA984488 (NID:g3163013) am87d07.s1" FT misc_feature 563007..563345 FT /note="similar to Homo sapiens EST H73146 (NID:g1046482) FT yu26d11.r1" FT misc_feature 563162..563529 FT /note="match to EST H73147 (NID:g1046483) yu26d11.s1" FT misc_feature 563350..563351 FT /note="similar to Homo sapiens EST H73146 (NID:g1046482) FT yu26d11.r1" FT misc_feature 563418..563797 FT /note="match to EST BF848387 (NID:g12235537)" FT misc_feature 563721..563861 FT /note="match to EST BE174798 (NID:g8637524)" FT repeat_region 563841..564060 FT /rpt_family="MER1_type" FT repeat_region 564127..564182 FT /rpt_family="MIR" FT repeat_region 564156..564523 FT /rpt_family="L2" FT repeat_region 564557..564862 FT /rpt_family="Alu" FT repeat_region 565072..565277 FT /rpt_family="MaLR" FT repeat_region 565376..565459 FT /rpt_family="L2" FT repeat_region 565520..565579 FT /rpt_family="AcHobo" FT repeat_region 565785..565829 FT /rpt_family="MIR" FT repeat_region 566011..566062 FT /rpt_family="CT-rich" FT repeat_region 566852..567141 FT /rpt_family="Alu" FT misc_feature 567216..567590 FT /note="match to EST AV661538 (NID:g9882552)" FT repeat_region 567340..567373 FT /rpt_family="AT_rich" FT repeat_region 567399..567870 FT /rpt_family="L1" FT repeat_region 567904..568404 FT /rpt_family="(TGGA)n" FT misc_feature 568313..568885 FT /note="similar to Homo sapiens EST AV720174 FT (NID:g10817326)" FT repeat_region 568418..568596 FT /rpt_family="(TGGA)n" FT repeat_region 568597..568758 FT /rpt_family="L1" FT repeat_region 568924..569222 FT /rpt_family="Alu" FT repeat_region 569788..569807 FT /rpt_family="(CAAAT)n" FT repeat_region 570098..570404 FT /rpt_family="Alu" FT repeat_region 570573..570670 FT /rpt_family="MIR" FT misc_feature 570762..570771 FT /note="similar to Homo sapiens EST BF850576 FT (NID:g12237738)" FT repeat_region 570812..570848 FT /rpt_family="(CGGGGG)n" FT repeat_region 571097..571246 FT /rpt_family="GA-rich" FT repeat_region 571263..571398 FT /rpt_family="(GGGGA)n" FT repeat_region 571472..571558 FT /rpt_family="GA-rich" FT repeat_region 572071..572236 FT /rpt_family="MaLR" FT misc_feature 573019..573550 FT /note="match to EST BM910217 (NID:g19360596)" FT repeat_region 573090..573247 FT /rpt_family="MIR" FT repeat_region 573315..573346 FT /rpt_family="L2" FT repeat_region 573700..573790 FT /rpt_family="CT-rich" FT repeat_region 573839..573962 FT /rpt_family="Alu" FT misc_feature 573961..574443 FT /note="match to EST AA534414 (NID:g2278667) nf76c09.s1" FT repeat_region 573964..574100 FT /rpt_family="L2" FT repeat_region 574633..574926 FT /rpt_family="Alu" FT repeat_region 574996..575376 FT /rpt_family="L2" FT repeat_region 575379..575679 FT /rpt_family="Alu" FT misc_feature 575438..575442 FT /note="similar to Homo sapiens EST W05046 (NID:g1277795) FT za78g09.r1" FT misc_feature 575661..575673 FT /note="similar to Homo sapiens EST AV720174 FT (NID:g10817326)" FT misc_feature 576039..576844 FT /note="match to EST BG473793 (NID:g13406070)" FT misc_feature 576073..576824 FT /note="match to EST BE733063 (NID:g10147055)" FT repeat_region 576297..576367 FT /rpt_family="MaLR" FT repeat_region 576368..576661 FT /rpt_family="Alu" FT repeat_region 576662..576729 FT /rpt_family="MaLR" FT repeat_region 576764..576966 FT /rpt_family="MaLR" FT misc_feature 576874 FT /note="match to EST BG473793 (NID:g13406070)" FT repeat_region 577466..577592 FT /rpt_family="MIR" FT repeat_region 577709..577939 FT /rpt_family="L2" FT repeat_region 579325..579372 FT /rpt_family="(GGGTG)n" FT repeat_region 580560..580773 FT /rpt_family="MaLR" FT repeat_region 580787..580892 FT /rpt_family="MaLR" FT repeat_region 581075..581232 FT /rpt_family="MaLR" FT misc_feature 581341..581642 FT /note="similar to Homo sapiens EST AA080925 (NID:g1623414) FT zn04f03.r1" FT repeat_region 581971..582116 FT /rpt_family="MIR" FT misc_feature 582152..582564 FT /note="match to EST AA084206 (NID:g1626417) zn04f03.s1" FT repeat_region 583201..583322 FT /rpt_family="MIR" FT repeat_region 583516..583623 FT /rpt_family="(TGAA)n" FT repeat_region 584259..584331 FT /rpt_family="MIR" FT repeat_region 584431..584526 FT /rpt_family="L2" FT repeat_region 584535..584553 FT /rpt_family="L1" FT repeat_region 584554..584854 FT /rpt_family="Alu" FT repeat_region 584855..585424 FT /rpt_family="L1" FT repeat_region 585426..585569 FT /rpt_family="Alu" FT repeat_region 585570..585859 FT /rpt_family="Alu" FT repeat_region 585869..585984 FT /rpt_family="L1" FT repeat_region 585997..586285 FT /rpt_family="Alu" FT repeat_region 586286..586421 FT /rpt_family="Alu" FT repeat_region 586470..586908 FT /rpt_family="L1" FT repeat_region 586909..587222 FT /rpt_family="Alu" FT repeat_region 587223..587416 FT /rpt_family="L1" FT repeat_region 587417..587716 FT /rpt_family="Alu" FT misc_feature 587417..587448 FT /note="match to EST BM129735 (NID:g17124287) if22d12.y1" FT misc_feature 587417..587432 FT /note="match to EST AW450524 (NID:g6991300)" FT /note="match to EST BM704378 (NID:g19017636)" FT /note="match to EST BM992673 (NID:g19712062)" FT misc_feature 587417..587429 FT /note="match to EST AI695647 (NID:g4983547) we51h09.x1" FT /note="match to EST BM665135 (NID:g18971797)" FT repeat_region 587717..587909 FT /rpt_family="L1" FT repeat_region 587925..588018 FT /rpt_family="L1" FT repeat_region 588572..588778 FT /rpt_family="L1" FT misc_feature 588834..589499 FT /note="match to EST BM992673 (NID:g19712062)" FT misc_feature 588834..589033 FT /note="match to EST AW450524 (NID:g6991300)" FT misc_feature 588834..589025 FT /note="match to EST BM704378 (NID:g19017636)" FT misc_feature 588835..589279 FT /note="similar to EST BU732383 (NID:g23658223)" FT misc_feature 588836..589351 FT /note="match to EST BM709366 (NID:g19022624)" FT misc_feature 588838..589027 FT /note="match to EST BM129735 (NID:g17124287) if22d12.y1" FT misc_feature 588966..589265 FT /note="similar to Homo sapiens EST BQ339456 FT (NID:g20999121)" FT misc_feature 589018..589735 FT /note="match to EST BF568417 (NID:g11641797)" FT misc_feature 589045..589330 FT /note="match to EST BM796953 (NID:g19145185)" FT misc_feature 589109..589153 FT /note="match to EST AW450524 (NID:g6991300)" FT misc_feature 589320..589745 FT /note="match to EST BM761573 (NID:g19091188)" FT misc_feature 589332..589976 FT /note="match to EST BI550912 (NID:g15438224)" FT misc_feature 589350..589502 FT /note="similar to Homo sapiens EST AW374572 (NID:g6879226)" FT misc_feature 589357..590237 FT /note="match to EST BQ068759 (NID:g19897805)" FT misc_feature 589378..589584 FT /note="match to EST BQ188598 (NID:g20364149)" FT misc_feature 589387..590239 FT /note="match to EST BI489113 (NID:g15328341)" FT misc_feature 589387..590003 FT /note="match to EST BI522886 (NID:g15347678)" FT misc_feature 589419..589795 FT /note="match to EST T15419 (NID:g517581)" FT misc_feature 589424..589949 FT /note="match to EST AA421872 (NID:g2100747) zv30b09.s1" FT misc_feature 589424..589559 FT /note="match to EST AI742132 (NID:g5110420) wg49c12.x1" FT misc_feature 589528..589756 FT /note="match to EST AA338161 (NID:g1990617)" FT misc_feature 589539..589601 FT /note="similar to Bos taurus EST AW657958 (NID:g7423784)" FT misc_feature 589567..590110 FT /note="match to EST AA452401 (NID:g2166070) zx29d08.r1" FT misc_feature 589635..590239 FT /note="match to EST BI458433 (NID:g15249089)" FT misc_feature 589660..589839 FT /note="similar to Bos taurus EST AW657958 (NID:g7423784)" FT misc_feature 589690..590239 FT /note="similar to EST CA455161 (NID:g24905601)" FT misc_feature 589738..590239 FT /note="match to EST BG707365 (NID:g13983640)" FT misc_feature 589788..590239 FT /note="similar to EST CB153661 (NID:g28138657)" FT misc_feature 589811..590240 FT /note="similar to EST BU558802 (NID:g22909098)" FT misc_feature 589811..590239 FT /note="similar to Mus musculus EST AU080183 (NID:g6084937)" FT misc_feature 589811..590109 FT /note="match to EST M78057 (NID:g273794)" FT misc_feature 589815..590190 FT /note="match to EST AA984789 (NID:g3163314) am93a12.s1" FT misc_feature 589824..590111 FT /note="similar to EST CB718121 (NID:g29775269)" FT misc_feature 589863..590239 FT /note="similar to Mus musculus EST AI893992 (NID:g5599894) FT mf91h10.y1" FT misc_feature 589876..590239 FT /note="match to EST BM665135 (NID:g18971797)" FT misc_feature 589881..590239 FT /note="match to EST AI799386 (NID:g5364858) tw33g11.x1" FT misc_feature 589882..590239 FT /note="similar to EST BU857537 (NID:g24042529)" FT misc_feature 589899..590239 FT /note="match to EST BM715352 (NID:g19028610)" FT misc_feature 589907..590239 FT /note="similar to EST BQ949475 (NID:g22364953)" FT misc_feature 589946..590239 FT /note="similar to Homo sapiens EST W05046 (NID:g1277795) FT za78g09.r1" FT misc_feature 590003..590239 FT /note="match to EST BM771926 (NID:g19101541)" FT misc_feature 590023..590226 FT /note="similar to Bos taurus EST AW657958 (NID:g7423784)" FT misc_feature 590041..590234 FT /note="similar to EST CA513274 (NID:g25004228)" FT misc_feature 590066..590234 FT /note="similar to EST BU910048 (NID:g24091962)" FT misc_feature 590067..590234 FT /note="similar to EST BQ736721 (NID:g21875618)" FT misc_feature 590069..590239 FT /note="similar to Gallus gallus EST BI391229 FT (NID:g15084511)" FT misc_feature 590079..590239 FT /note="match to EST BM264355 (NID:g17927395) ig34b12.y1" FT misc_feature 590099..590239 FT /note="match to EST BE700975 (NID:g10088717)" FT misc_feature 590104..590223 FT /note="match to EST BM545254 (NID:g18777189)" FT misc_feature 590161..590239 FT /note="similar to EST BU443888 (NID:g25933199)" FT misc_feature 590174..590239 FT /note="match to EST BF963562 (NID:g12380746)" FT misc_feature 590177..590239 FT /note="match to EST BM920178 (NID:g19370557)" FT misc_feature 590217..590239 FT /note="match to EST BM744179 (NID:g19065508)" FT misc_feature 590221..590239 FT /note="match to EST BM723607 (NID:g19044938)" FT repeat_region 590340..590491 FT /rpt_family="MER53" FT misc_feature 591019..591107 FT /note="match to EST BE889136 (NID:g10346145)" FT misc_feature 591022..591107 FT /note="similar to EST BQ736721 (NID:g21875618)" FT /note="similar to EST BU910048 (NID:g24091962)" FT /note="similar to EST CA513274 (NID:g25004228)" FT /note="similar to EST CB793925 (NID:g29882402)" FT misc_feature 591026..591124 FT /note="similar to Mus musculus EST AI893992 (NID:g5599894) FT mf91h10.y1" FT misc_feature 591026..591111 FT /note="match to EST BG707365 (NID:g13983640)" FT misc_feature 591026..591107 FT /note="match to EST BE700975 (NID:g10088717)" FT /note="match to EST BF963562 (NID:g12380746)" FT /note="match to EST BI458433 (NID:g15249089)" FT /note="match to EST BM264355 (NID:g17927395) ig34b12.y1" FT /note="match to EST BM665135 (NID:g18971797)" FT /note="match to EST BM715352 (NID:g19028610)" FT /note="match to EST BM723607 (NID:g19044938)" FT /note="match to EST BM744179 (NID:g19065508)" FT /note="match to EST BM771926 (NID:g19101541)" FT /note="match to EST BM920178 (NID:g19370557)" FT /note="similar to EST BQ949475 (NID:g22364953)" FT /note="similar to EST BU443888 (NID:g25933199)" FT /note="similar to EST BU857537 (NID:g24042529)" FT /note="similar to EST CA455161 (NID:g24905601)" FT /note="similar to EST CB153661 (NID:g28138657)" FT /note="similar to Gallus gallus EST BI391229 FT (NID:g15084511)" FT /note="similar to Mus musculus EST AU080183 (NID:g6084937)" FT misc_feature 591026..591060 FT /note="similar to Homo sapiens EST W05046 (NID:g1277795) FT za78g09.r1" FT misc_feature 591026..591058 FT /note="match to EST AI799386 (NID:g5364858) tw33g11.x1" FT misc_feature 591046..591107 FT /note="match to EST BM752012 (NID:g19081630)" FT misc_feature 591061..591107 FT /note="match to EST BG007915 (NID:g12452577)" FT misc_feature 591069..591107 FT /note="similar to Homo sapiens EST BQ366256 FT (NID:g21041768)" FT misc_feature 591094..591107 FT /note="match to EST AW498823 (NID:g7137092)" FT repeat_region 591358..591521 FT /rpt_family="C-rich" FT repeat_region 591543..591710 FT /rpt_family="C-rich" FT repeat_region 591727..591893 FT /rpt_family="C-rich" FT repeat_region 591972..592139 FT /rpt_family="C-rich" FT misc_feature 592014..592303 FT /note="match to EST AA077256 (NID:g1836730)" FT repeat_region 593077..593132 FT /rpt_family="MIR" FT repeat_region 594546..594816 FT /rpt_family="MaLR" FT repeat_region 595305..595387 FT /rpt_family="MIR" FT repeat_region 595839..595910 FT /rpt_family="L2" FT repeat_region 597672..597988 FT /rpt_family="Alu" FT repeat_region 597989..598019 FT /rpt_family="(GGA)n" FT repeat_region 598111..598418 FT /rpt_family="Alu" FT repeat_region 598734..599059 FT /rpt_family="L2" FT misc_feature 599231..599696 FT /note="match to EST BF811377 (NID:g12140455)" FT repeat_region 599398..599430 FT /rpt_family="MER1_type" FT repeat_region 599431..599679 FT /rpt_family="Alu" FT repeat_region 599680..599996 FT /rpt_family="MaLR" FT repeat_region 599997..600028 FT /rpt_family="(TAA)n" FT repeat_region 600029..600127 FT /rpt_family="MER1_type" FT repeat_region 600243..600390 FT /rpt_family="MIR" FT repeat_region 600643..600929 FT /rpt_family="(CA)n" FT misc_feature 601486..601487 FT /note="match to EST AA055385 (NID:g1547742) zf20h08.r1" FT misc_feature 601595..601647 FT /note="similar to EST BX118161 (NID:g27881236)" FT misc_feature 601604..601647 FT /note="match to EST AA055385 (NID:g1547742) zf20h08.r1" FT repeat_region 603171..603278 FT /rpt_family="(TG)n" FT repeat_region 603293..603580 FT /rpt_family="(TG)n" FT repeat_region 603918..604021 FT /rpt_family="(CCCCAG)n" FT misc_feature 604738..605256 FT /note="similar to EST BX118161 (NID:g27881236)" FT misc_feature 604738..604886 FT /note="match to EST AA055385 (NID:g1547742) zf20h08.r1" FT misc_feature 605065..605256 FT /note="match to EST AA055936 (NID:g1548275) zf20h08.s1" FT repeat_region 605432..605570 FT /rpt_family="MIR" FT repeat_region 605636..605767 FT /rpt_family="MIR" FT misc_feature 605746..606189 FT /note="Sequence derived from PCR product of project DNA." FT repeat_region 605782..605822 FT /rpt_family="(CAT)n" FT repeat_region 605856..606038 FT /rpt_family="(CAT)n" FT repeat_region 606011..606236 FT /rpt_family="(CACCAT)n" FT repeat_region 606240..606418 FT /rpt_family="(CAT)n" FT repeat_region 606489..606891 FT /rpt_family="L1" FT repeat_region 606981..607225 FT /rpt_family="(CAT)n" FT repeat_region 607279..607701 FT /rpt_family="L1" FT misc_feature 609125..609694 FT /note="similar to EST CB105045 (NID:g27930852)" FT misc_feature 612541..613739 FT /note="CpG_island (%GC=63.7, o/e=0.70, #CpGs=84)" FT repeat_region 613979..614084 FT /rpt_family="MER1_type" FT repeat_region 614085..614380 FT /rpt_family="Alu" FT repeat_region 614381..614511 FT /rpt_family="MER1_type" FT repeat_region 614690..615168 FT /rpt_family="MaLR" FT repeat_region 615171..615509 FT /rpt_family="Alu" FT repeat_region 616141..616171 FT /rpt_family="(TTCA)n" FT misc_feature 616681..617101 FT /note="match to EST AA663585 (NID:g2617576) ae67h09.s1" FT repeat_region 617378..617836 FT /rpt_family="ERV1" FT misc_feature 617453..617455 FT /note="match to EST AI628350 (NID:g4665150) ts36h11.x1" FT misc_feature 617826..618112 FT /note="match to EST AI339140 (NID:g4076067) qt14e10.x1" FT repeat_region 618074..618306 FT /rpt_family="L1" FT misc_feature 618296..618490 FT /note="match to EST AI367887 (NID:g4137632) qq45h12.x1" FT repeat_region 618307..618618 FT /rpt_family="Alu" FT misc_feature 618322..618490 FT /note="match to EST BQ212654 (NID:g20393084)" FT misc_feature 618342..618490 FT /note="match to EST AI628350 (NID:g4665150) ts36h11.x1" FT repeat_region 618619..618664 FT /rpt_family="L1" FT misc_feature 618878..619012 FT /note="similar to Bos taurus EST BF076261 (NID:g10869946)" FT misc_feature 618892..619014 FT /note="match to EST AA323632 (NID:g1975980)" FT /note="match to EST BI835452 (NID:g15947002)" FT misc_feature 618893..619110 FT /note="match to EST AI367887 (NID:g4137632) qq45h12.x1" FT misc_feature 618893..619016 FT /note="match to EST BM665135 (NID:g18971797)" FT /note="similar to Mus musculus EST AU080183 (NID:g6084937)" FT misc_feature 618893..619014 FT /note="match to EST AI628350 (NID:g4665150) ts36h11.x1" FT /note="match to EST AW498823 (NID:g7137092)" FT /note="match to EST BE889136 (NID:g10346145)" FT /note="match to EST BF963562 (NID:g12380746)" FT /note="match to EST BG007915 (NID:g12452577)" FT /note="match to EST BI458433 (NID:g15249089)" FT /note="match to EST BM264355 (NID:g17927395) ig34b12.y1" FT /note="match to EST BM715352 (NID:g19028610)" FT /note="match to EST BM723607 (NID:g19044938)" FT /note="match to EST BM744179 (NID:g19065508)" FT /note="match to EST BM752012 (NID:g19081630)" FT /note="match to EST BM771926 (NID:g19101541)" FT /note="match to EST BM920178 (NID:g19370557)" FT /note="match to EST BQ212654 (NID:g20393084)" FT /note="similar to EST BQ736721 (NID:g21875618)" FT /note="similar to EST BQ949475 (NID:g22364953)" FT /note="similar to EST BU443888 (NID:g25933199)" FT /note="similar to EST BU857537 (NID:g24042529)" FT /note="similar to EST BU910048 (NID:g24091962)" FT /note="similar to EST CA455161 (NID:g24905601)" FT /note="similar to EST CA513274 (NID:g25004228)" FT /note="similar to EST CB793925 (NID:g29882402)" FT /note="similar to Gallus gallus EST BI391229 FT (NID:g15084511)" FT /note="similar to Homo sapiens EST BQ366256 FT (NID:g21041768)" FT misc_feature 618893..618972 FT /note="match to EST BE700975 (NID:g10088717)" FT misc_feature 618893..618948 FT /note="similar to EST CB153661 (NID:g28138657)" FT misc_feature 618895..619014 FT /note="match to EST AA877409 (NID:g2985116) nx22e08.s1" FT misc_feature 618921..619014 FT /note="match to EST AA323077 (NID:g1975402)" FT repeat_region 619451..619587 FT /rpt_family="Alu" FT repeat_region 619588..619897 FT /rpt_family="Alu" FT repeat_region 619898..620043 FT /rpt_family="Alu" FT repeat_region 620659..620962 FT /rpt_family="Alu" FT repeat_region 621358..621655 FT /rpt_family="Alu" FT repeat_region 622595..622868 FT /rpt_family="L1" FT repeat_region 622974..623313 FT /rpt_family="(CA)n" FT repeat_region 623365..623496 FT /rpt_family="(CA)n" FT misc_feature 624119..624120 FT /note="match to EST AA323997 (NID:g1976399)" FT misc_feature 624137..624205 FT /note="match to EST AA351660 (NID:g2004000)" FT misc_feature 624141..624205 FT /note="match to EST AA323997 (NID:g1976399)" FT /note="similar to Bos taurus EST BF076261 (NID:g10869946)" FT misc_feature 624145..624206 FT /note="match to EST AA323077 (NID:g1975402)" FT misc_feature 624145..624205 FT /note="match to EST AA323632 (NID:g1975980)" FT /note="match to EST AI628350 (NID:g4665150) ts36h11.x1" FT /note="match to EST AW498823 (NID:g7137092)" FT /note="match to EST BE889136 (NID:g10346145)" FT /note="match to EST BG007915 (NID:g12452577)" FT /note="match to EST BI458433 (NID:g15249089)" FT /note="match to EST BI835452 (NID:g15947002)" FT /note="match to EST BM264355 (NID:g17927395) ig34b12.y1" FT /note="match to EST BM723607 (NID:g19044938)" FT /note="match to EST BM744179 (NID:g19065508)" FT /note="match to EST BM771926 (NID:g19101541)" FT /note="match to EST BM920178 (NID:g19370557)" FT /note="match to EST BQ212654 (NID:g20393084)" FT /note="similar to EST BQ736721 (NID:g21875618)" FT /note="similar to EST BQ949475 (NID:g22364953)" FT /note="similar to EST BU443888 (NID:g25933199)" FT /note="similar to EST BU857537 (NID:g24042529)" FT /note="similar to EST BU910048 (NID:g24091962)" FT /note="similar to EST CA455161 (NID:g24905601)" FT /note="similar to EST CA513274 (NID:g25004228)" FT /note="similar to EST CB718121 (NID:g29775269)" FT /note="similar to EST CB793925 (NID:g29882402)" FT /note="similar to Gallus gallus EST BI391229 FT (NID:g15084511)" FT /note="similar to Homo sapiens EST BQ366256 FT (NID:g21041768)" FT misc_feature 624145..624197 FT /note="match to EST AA877409 (NID:g2985116) nx22e08.s1" FT /note="match to EST BM752012 (NID:g19081630)" FT misc_feature 624145..624187 FT /note="match to EST BM715352 (NID:g19028610)" FT misc_feature 624145..624182 FT /note="match to EST BF963562 (NID:g12380746)" FT misc_feature 624147..624205 FT /note="similar to Bos taurus EST AW656118 (NID:g7421944)" FT misc_feature 624153..624205 FT /note="similar to EST CB155753 (NID:g28140866)" FT repeat_region 624573..624667 FT /rpt_family="MaLR" FT repeat_region 624917..625015 FT /rpt_family="Tip100" FT repeat_region 625263..625418 FT /rpt_family="MIR" FT repeat_region 625665..625870 FT /rpt_family="MaLR" FT repeat_region 625890..626096 FT /rpt_family="MaLR" FT repeat_region 626228..626346 FT /rpt_family="MaLR" FT repeat_region 626521..626736 FT /rpt_family="Alu" FT repeat_region 628079..628249 FT /rpt_family="(ATGGTG)n" FT repeat_region 628247..628426 FT /rpt_family="(TGG)n" FT repeat_region 628456..628709 FT /rpt_family="(ATGGTG)n" FT repeat_region 628728..628848 FT /rpt_family="MIR" FT repeat_region 629114..629303 FT /rpt_family="MIR" FT misc_feature 629907..629913 FT /note="match to EST AW408587 (NID:g6927644)" FT repeat_region 631206..631337 FT /rpt_family="Alu" FT repeat_region 632381..632702 FT /rpt_family="Alu" FT repeat_region 633409..633504 FT /rpt_family="L2" FT repeat_region 635417..635569 FT /rpt_family="MaLR" FT misc_feature 635779..635941 FT /note="match to EST BG987804 (NID:g14391874)" FT misc_feature 635782..635941 FT /note="similar to EST CB608033 (NID:g29547718)" FT /note="similar to Mus musculus EST BE650062 (NID:g9975886)" FT misc_feature 635783..635941 FT /note="match to EST AA323632 (NID:g1975980)" FT /note="match to EST AA323997 (NID:g1976399)" FT /note="match to EST BE889136 (NID:g10346145)" FT /note="match to EST BG007915 (NID:g12452577)" FT /note="match to EST BI835452 (NID:g15947002)" FT /note="match to EST BM264355 (NID:g17927395) ig34b12.y1" FT /note="match to EST BM723607 (NID:g19044938)" FT /note="match to EST BM744179 (NID:g19065508)" FT /note="match to EST BM771926 (NID:g19101541)" FT /note="match to EST BM920178 (NID:g19370557)" FT /note="match to EST BQ212654 (NID:g20393084)" FT /note="similar to Bos taurus EST AW656118 (NID:g7421944)" FT /note="similar to Bos taurus EST BF076261 (NID:g10869946)" FT /note="similar to EST BQ736721 (NID:g21875618)" FT /note="similar to EST BQ949475 (NID:g22364953)" FT /note="similar to EST BU443888 (NID:g25933199)" FT /note="similar to EST BU857537 (NID:g24042529)" FT /note="similar to EST BU910048 (NID:g24091962)" FT /note="similar to EST CB155753 (NID:g28140866)" FT /note="similar to EST CB718121 (NID:g29775269)" FT /note="similar to Gallus gallus EST BI391229 FT (NID:g15084511)" FT misc_feature 635783..635930 FT /note="match to EST AI628350 (NID:g4665150) ts36h11.x1" FT misc_feature 635783..635926 FT /note="similar to EST CA513274 (NID:g25004228)" FT misc_feature 635783..635895 FT /note="similar to EST CB793925 (NID:g29882402)" FT misc_feature 635783..635891 FT /note="match to EST AW498823 (NID:g7137092)" FT misc_feature 635783..635889 FT /note="similar to Homo sapiens EST BQ366256 FT (NID:g21041768)" FT misc_feature 635783..635878 FT /note="match to EST AA351660 (NID:g2004000)" FT misc_feature 635783..635840 FT /note="similar to EST CA455161 (NID:g24905601)" FT misc_feature 636242..636246 FT /note="match to EST BI458433 (NID:g15249089)" FT repeat_region 636307..636388 FT /rpt_family="MIR" FT repeat_region 638923..639224 FT /rpt_family="Alu" FT repeat_region 639663..639855 FT /rpt_family="L1" FT repeat_region 639860..640143 FT /rpt_family="Alu" FT misc_feature 641090..641221 FT /note="match to EST BQ212654 (NID:g20393084)" FT repeat_region 641245..641273 FT /rpt_family="GC_rich" FT repeat_region 641529..641598 FT /rpt_family="G-rich" FT repeat_region 642012..642036 FT /rpt_family="(GGA)n" FT misc_feature 642190..642320 FT /note="similar to EST BQ949475 (NID:g22364953)" FT misc_feature 642482..642934 FT /note="similar to EST BX114951 (NID:g27839154)" FT misc_feature 642739..643143 FT /note="match to EST BF816539 (NID:g12152319)" FT repeat_region 643162..643195 FT /rpt_family="L2" FT repeat_region 643332..643475 FT /rpt_family="G-rich" FT repeat_region 644477..644528 FT /rpt_family="(CAGG)n" FT repeat_region 644730..644868 FT /rpt_family="L2" FT misc_feature 645132..645385 FT /note="match to EST AI695647 (NID:g4983547) we51h09.x1" FT misc_feature 645259..645807 FT /note="similar to EST CB139608 (NID:g28112667)" FT misc_feature 645820..646214 FT /note="match to EST AW408587 (NID:g6927644)" FT misc_feature 645830..645878 FT /note="similar to EST BQ736721 (NID:g21875618)" FT misc_feature 645830..645876 FT /note="match to EST BG987804 (NID:g14391874)" FT /note="match to EST BI835452 (NID:g15947002)" FT /note="match to EST BM723607 (NID:g19044938)" FT /note="match to EST BM920178 (NID:g19370557)" FT /note="similar to Bos taurus EST AW656118 (NID:g7421944)" FT /note="similar to Bos taurus EST BF076261 (NID:g10869946)" FT /note="similar to EST BU443888 (NID:g25933199)" FT /note="similar to EST BU857537 (NID:g24042529)" FT /note="similar to EST CB155753 (NID:g28140866)" FT /note="similar to EST CB608033 (NID:g29547718)" FT /note="similar to Mus musculus EST BE650062 (NID:g9975886)" FT misc_feature 645830..645870 FT /note="match to EST BE889136 (NID:g10346145)" FT misc_feature 645830..645868 FT /note="match to EST AA323632 (NID:g1975980)" FT misc_feature 645830..645855 FT /note="match to EST BM744179 (NID:g19065508)" FT /note="match to EST BM771926 (NID:g19101541)" FT misc_feature 645830..645854 FT /note="match to EST BG007915 (NID:g12452577)" FT misc_feature 645836..645868 FT /note="match to EST AA323997 (NID:g1976399)" FT repeat_region 646103..646384 FT /rpt_family="Alu" FT misc_feature 646315..647212 FT /note="similar to EST BQ706853 (NID:g21845752)" FT repeat_region 646402..646432 FT /rpt_family="(TG)n" FT repeat_region 646438..646654 FT /rpt_family="L1" FT repeat_region 646456..646605 FT /rpt_family="L1" FT repeat_region 646656..646950 FT /rpt_family="Alu" FT misc_feature 647028..647092 FT /note="match to EST BG987804 (NID:g14391874)" FT /note="similar to Mus musculus EST BE650062 (NID:g9975886)" FT misc_feature 647028..647091 FT /note="match to EST BI835452 (NID:g15947002)" FT /note="match to EST BM723607 (NID:g19044938)" FT /note="match to EST BM920178 (NID:g19370557)" FT /note="similar to Bos taurus EST BF076261 (NID:g10869946)" FT /note="similar to EST BU443888 (NID:g25933199)" FT /note="similar to EST BU857537 (NID:g24042529)" FT /note="similar to EST CB155753 (NID:g28140866)" FT /note="similar to EST CB608033 (NID:g29547718)" FT misc_feature 647028..647071 FT /note="similar to Bos taurus EST AW656118 (NID:g7421944)" FT misc_feature 647133 FT /note="match to EST AA262058 (NID:g1898182) zs18e09.r1" FT repeat_region 647184..647457 FT /rpt_family="L1" FT misc_feature 647257..647618 FT /note="match to EST AA262058 (NID:g1898182) zs18e09.r1" FT misc_feature 647502..647787 FT /note="similar to EST BX114951 (NID:g27839154)" FT misc_feature 647549..647935 FT /note="match to EST BM688575 (NID:g19001833)" FT misc_feature 647641..648122 FT /note="match to EST BE674909 (NID:g10035450)" FT misc_feature 647846..648121 FT /note="match to EST AI673399 (NID:g4853130) wf18f06.x1" FT repeat_region 649378..649679 FT /rpt_family="Alu" FT repeat_region 650679..650802 FT /rpt_family="MIR" FT repeat_region 650882..650926 FT /rpt_family="CT-rich" FT repeat_region 651336..651516 FT /rpt_family="(TGGA)n" FT repeat_region 651554..651730 FT /rpt_family="(TGGA)n" FT repeat_region 651762..651933 FT /rpt_family="(TGGA)n" FT repeat_region 651979..652302 FT /rpt_family="(TGGA)n" FT misc_feature 652528..652892 FT /note="match to EST AA971594 (NID:g3146884) op84e09.s1" FT repeat_region 652604..652933 FT /rpt_family="L1" FT misc_feature 652623..653210 FT /note="similar to EST BX090083 (NID:g27824171)" FT misc_feature 652872..653420 FT /note="match to EST AW979062 (NID:g8170346)" FT misc_feature 652883..653089 FT /note="match to EST AA847968 (NID:g2934486) od72c08.s1" FT repeat_region 654047..654105 FT /rpt_family="MIR" FT repeat_region 654120..654265 FT /rpt_family="Alu" FT repeat_region 654266..654563 FT /rpt_family="Alu" FT repeat_region 654564..654741 FT /rpt_family="Alu" FT repeat_region 654745..654780 FT /rpt_family="(GAAA)n" FT repeat_region 654781..655572 FT /rpt_family="Alu" FT repeat_region 655578..655667 FT /rpt_family="GA-rich" FT misc_feature 655658..655930 FT /note="match to EST BI051283 (NID:g14458813)" FT mobile_element 655706..655707 FT /mobile_element_type="transposon:Bacterial transposon FT insertion in clone excised here." FT repeat_region 656629..656923 FT /rpt_family="Alu" FT repeat_region 656937..657108 FT /rpt_family="Alu" FT misc_feature 657187..657498 FT /note="match to EST BF997134 (NID:g12403457)" FT repeat_region 658269..658632 FT /rpt_family="L1" FT repeat_region 658697..659018 FT /rpt_family="MaLR" FT repeat_region 659019..659234 FT /rpt_family="MIR" FT repeat_region 659476..659790 FT /rpt_family="Alu" FT repeat_region 659839..659962 FT /rpt_family="L1" FT repeat_region 660277..660769 FT /rpt_family="L1" FT repeat_region 660776..660989 FT /rpt_family="L1" FT repeat_region 660991..661181 FT /rpt_family="MER1_type" FT repeat_region 661414..661504 FT /rpt_family="MIR" FT repeat_region 662979..663451 FT /rpt_family="ERV1" FT repeat_region 663788..664085 FT /rpt_family="Alu" FT repeat_region 664086..664342 FT /rpt_family="L1" FT repeat_region 664348..665361 FT /rpt_family="L1" FT repeat_region 665362..665675 FT /rpt_family="Alu" FT repeat_region 665676..665846 FT /rpt_family="L1" FT repeat_region 665847..666163 FT /rpt_family="Alu" FT repeat_region 666164..666338 FT /rpt_family="L1" FT repeat_region 666357..666512 FT /rpt_family="Alu" FT repeat_region 666513..666791 FT /rpt_family="Alu" FT repeat_region 666792..666926 FT /rpt_family="Alu" FT repeat_region 667036..667153 FT /rpt_family="MIR" FT repeat_region 667482..667563 FT /rpt_family="L2" FT repeat_region 670588..670882 FT /rpt_family="Alu" FT repeat_region 671310..671603 FT /rpt_family="Alu" FT misc_feature 671780..671785 FT /note="match to EST AA877409 (NID:g2985116) nx22e08.s1" FT repeat_region 672787..672982 FT /rpt_family="L1" FT repeat_region 673119..673180 FT /rpt_family="Alu" FT misc_feature 693461..694281 FT /note="Sequence derived from PCR product of project DNA." FT unsure 699974..702371 FT /note="Unresolved tandem repeat." FT misc_feature 700302..700308 FT /note="Unresolved homopolymeric repeat." FT unsure 766554..766802 FT /note="Sequence derived from one plasmid subclone." FT misc_feature 767292..767295 FT /note="Sequence derived from PCR product of project DNA." FT repeat_region 827356..827497 FT /rpt_family="MER1_type" FT repeat_region 827386..827514 FT /rpt_family="MER1_type" FT repeat_region 827893..828018 FT /rpt_family="Alu" FT repeat_region 828029..828314 FT /rpt_family="Alu" FT repeat_region 828315..828897 FT /rpt_family="L1" FT misc_feature 828519..828523 FT /note="match to EST R09420 (NID:g761343) yf22g12.r1" FT repeat_region 828898..829242 FT /rpt_family="MaLR" FT repeat_region 829243..829515 FT /rpt_family="L1" FT repeat_region 829549..829838 FT /rpt_family="Alu" FT repeat_region 829851..830152 FT /rpt_family="Alu" FT repeat_region 830374..830668 FT /rpt_family="Alu" FT repeat_region 831060..831221 FT /rpt_family="Alu" FT repeat_region 831233..831499 FT /rpt_family="L1" FT repeat_region 831502..831797 FT /rpt_family="Alu" FT misc_feature 831569..831940 FT /note="match to EST AA663541 (NID:g2617532) ab82f06.s1" FT repeat_region 832107..832370 FT /rpt_family="L1" FT repeat_region 832371..832666 FT /rpt_family="Alu" FT repeat_region 832667..832975 FT /rpt_family="L1" FT repeat_region 833028..833346 FT /rpt_family="Alu" FT repeat_region 833438..833733 FT /rpt_family="Alu" FT repeat_region 834171..834253 FT /rpt_family="Alu" FT repeat_region 835095..835370 FT /rpt_family="MER1_type?" FT repeat_region 835406..835712 FT /rpt_family="Alu" FT repeat_region 835714..835904 FT /rpt_family="ERV1" FT repeat_region 835923..836716 FT /rpt_family="L1" FT repeat_region 836717..836851 FT /rpt_family="ERV1" FT repeat_region 836906..837012 FT /rpt_family="ERV1" FT repeat_region 837013..837498 FT /rpt_family="ERV1" FT repeat_region 837810..838122 FT /rpt_family="Alu" FT misc_feature 837840..837845 FT /note="similar to Homo sapiens EST AW821338 (NID:g7914332)" FT repeat_region 838137..838262 FT /rpt_family="Alu" FT repeat_region 838263..838574 FT /rpt_family="Alu" FT misc_feature 838702..838707 FT /note="match to EST AI469067 (NID:g4331157) ti70d08.x1" FT repeat_region 838777..839140 FT /rpt_family="MER1_type" FT repeat_region 839142..839177 FT /rpt_family="Alu" FT repeat_region 839178..839300 FT /rpt_family="Alu" FT repeat_region 839335..839641 FT /rpt_family="Alu" FT repeat_region 839664..839786 FT /rpt_family="L1" FT repeat_region 839787..839866 FT /rpt_family="Alu" FT repeat_region 839867..840182 FT /rpt_family="Alu" FT repeat_region 840183..840380 FT /rpt_family="Alu" FT repeat_region 840381..840453 FT /rpt_family="L1" FT repeat_region 840664..840948 FT /rpt_family="Alu" FT repeat_region 840955..841164 FT /rpt_family="L1" FT repeat_region 841173..841466 FT /rpt_family="Alu" FT repeat_region 842193..842214 FT /rpt_family="L1" FT repeat_region 842215..842559 FT /rpt_family="Alu" FT repeat_region 842560..842905 FT /rpt_family="L1" FT repeat_region 843103..843287 FT /rpt_family="Alu" FT repeat_region 843288..843667 FT /rpt_family="L1" FT repeat_region 843668..843793 FT /rpt_family="Alu" FT misc_feature 843711..844017 FT /note="similar to Rattus norvegicus EST BF563422 FT (NID:g11673152)" FT misc_feature 843761..844173 FT /note="similar to Rattus norvegicus EST AW528091 FT (NID:g7170500)" FT repeat_region 843795..843881 FT /rpt_family="MIR" FT repeat_region 843995..844179 FT /rpt_family="Alu" FT repeat_region 844296..844608 FT /rpt_family="Alu" FT repeat_region 844648..844956 FT /rpt_family="Alu" FT repeat_region 845081..845198 FT /rpt_family="L1" FT repeat_region 845360..845520 FT /rpt_family="Alu" FT repeat_region 845521..845821 FT /rpt_family="Alu" FT repeat_region 845822..846125 FT /rpt_family="Alu" FT repeat_region 846127..846441 FT /rpt_family="Alu" FT repeat_region 846537..846830 FT /rpt_family="Alu" FT repeat_region 846838..847069 FT /rpt_family="Alu" FT repeat_region 847070..847233 FT /rpt_family="MaLR" FT repeat_region 847234..847536 FT /rpt_family="Alu" FT repeat_region 847537..847745 FT /rpt_family="MaLR" FT repeat_region 847746..847770 FT /rpt_family="Alu" FT repeat_region 848427..848465 FT /rpt_family="MaLR" FT repeat_region 848466..848767 FT /rpt_family="Alu" FT repeat_region 848768..848809 FT /rpt_family="MaLR" FT repeat_region 848810..848964 FT /rpt_family="MaLR" FT repeat_region 848965..849264 FT /rpt_family="Alu" FT repeat_region 849265..849281 FT /rpt_family="MaLR" FT repeat_region 849282..849592 FT /rpt_family="Alu" FT repeat_region 849593..849756 FT /rpt_family="MaLR" FT repeat_region 849757..850068 FT /rpt_family="Alu" FT repeat_region 850069..850136 FT /rpt_family="MaLR" FT repeat_region 850137..850462 FT /rpt_family="MaLR" FT repeat_region 850482..850583 FT /rpt_family="MER1_type" FT repeat_region 850584..850884 FT /rpt_family="Alu" FT repeat_region 850885..850920 FT /rpt_family="MER1_type" FT repeat_region 850932..851109 FT /rpt_family="Alu" FT repeat_region 851110..851406 FT /rpt_family="Alu" FT repeat_region 851407..851571 FT /rpt_family="MaLR" FT repeat_region 851926..852074 FT /rpt_family="Alu" FT repeat_region 852076..852362 FT /rpt_family="Alu" FT repeat_region 852810..852914 FT /rpt_family="Alu" FT repeat_region 853791..853844 FT /rpt_family="Alu" FT repeat_region 853845..854152 FT /rpt_family="Alu" FT repeat_region 854153..854388 FT /rpt_family="Alu" FT repeat_region 854399..854629 FT /rpt_family="Alu" FT repeat_region 854639..854776 FT /rpt_family="Alu" FT repeat_region 854777..855077 FT /rpt_family="Alu" FT repeat_region 855078..855239 FT /rpt_family="Alu" FT misc_feature 855214..855240 FT /note="match to EST BF037314 (NID:g10745539)" FT misc_feature 855309..857020 FT /note="CpG_island (%GC=73.3, o/e=0.80, #CpGs=171)" FT misc_feature 855565..855566 FT /note="match to EST BI458073 (NID:g15248729)" FT repeat_region 856065..856102 FT /rpt_family="C-rich" FT repeat_region 856207..856235 FT /rpt_family="GC_rich" FT misc_feature 856264..856310 FT /note="match to EST BI600209 (NID:g15493148)" FT misc_feature 856266..856310 FT /note="match to EST BF966523 (NID:g12333738)" FT repeat_region 856272..856417 FT /rpt_family="G-rich" FT misc_feature 856275..856310 FT /note="match to EST BG772864 (NID:g14083517)" FT /note="match to EST BG721200 (NID:g14000387)" FT misc_feature 856280..856310 FT /note="match to EST BE247425 (NID:g9099181)" FT misc_feature 856282..856301 FT /note="match to EST BI458073 (NID:g15248729)" FT misc_feature 856284..856310 FT /note="match to EST AI469067 (NID:g4331157) ti70d08.x1" FT misc_feature 856298..856310 FT /note="match to EST BE559625 (NID:g9803344)" FT misc_feature 856388..856508 FT /note="match to EST BI462143 (NID:g15252799)" FT misc_feature 856498..856547 FT /note="match to EST BI560992 (NID:g15448306)" FT repeat_region 856583..856660 FT /rpt_family="(CGGGG)n" FT repeat_region 856771..857013 FT /rpt_family="Alu" FT misc_feature 856917..857136 FT /note="match to EST BI560992 (NID:g15448306)" FT repeat_region 857414..857702 FT /rpt_family="L1" FT repeat_region 857750..858507 FT /rpt_family="L1" FT repeat_region 858508..858799 FT /rpt_family="Alu" FT repeat_region 858800..859346 FT /rpt_family="L1" FT repeat_region 859347..859603 FT /rpt_family="Alu" FT repeat_region 859604..860448 FT /rpt_family="L1" FT repeat_region 860449..860742 FT /rpt_family="L1" FT repeat_region 860796..861091 FT /rpt_family="Alu" FT misc_feature 861607..861924 FT /note="match to EST BF759913 (NID:g12107813)" FT misc_feature 862097 FT /note="match to EST BF759913 (NID:g12107813)" FT misc_feature 862675..863027 FT /note="match to EST BE080839 (NID:g8471116)" FT repeat_region 862835..863046 FT /rpt_family="L2" FT repeat_region 863811..863916 FT /rpt_family="L1" FT misc_feature 864387..864715 FT /note="match to EST BF819418 (NID:g12157301)" FT repeat_region 864700..864998 FT /rpt_family="Alu" FT repeat_region 865006..865026 FT /rpt_family="AT_rich" FT repeat_region 865598..865896 FT /rpt_family="Alu" FT repeat_region 866656..866962 FT /rpt_family="Alu" FT repeat_region 867104..867402 FT /rpt_family="Alu" FT repeat_region 867538..867840 FT /rpt_family="Alu" FT repeat_region 867878..868208 FT /rpt_family="Alu" FT misc_feature 868170..868614 FT /note="match to EST BG008428 (NID:g12453613)" FT repeat_region 869186..869490 FT /rpt_family="Alu" FT repeat_region 870911..871206 FT /rpt_family="Alu" FT misc_feature 871657..871738 FT /note="match to EST BI560992 (NID:g15448306)" FT /note="match to EST BI462143 (NID:g15252799)" FT misc_feature 872022..872392 FT /note="match to EST AW297101 (NID:g6703737)" FT misc_feature 872131..872238 FT /note="match to EST BG896784 (NID:g14307025)" FT /note="match to EST AL528314 (NID:g12791807)" FT misc_feature 872132..872238 FT /note="match to EST BI458073 (NID:g15248729)" FT misc_feature 872138..872238 FT /note="similar to Mus musculus EST BI665607 FT (NID:g15579840)" FT /note="similar to Mus musculus EST BB618808 FT (NID:g16458282)" FT misc_feature 872142..872238 FT /note="match to EST BF037314 (NID:g10745539)" FT /note="match to EST AI469067 (NID:g4331157) ti70d08.x1" FT /note="match to EST BE247425 (NID:g9099181)" FT /note="match to EST BI600209 (NID:g15493148)" FT /note="match to EST BG772864 (NID:g14083517)" FT /note="match to EST BG721200 (NID:g14000387)" FT /note="match to EST BI560992 (NID:g15448306)" FT /note="match to EST BI462143 (NID:g15252799)" FT misc_feature 872144..872238 FT /note="match to EST BE615699 (NID:g9897298)" FT misc_feature 872222..872238 FT /note="match to EST N56631 (NID:g1199902) yw73g06.r1" FT repeat_region 872944..873247 FT /rpt_family="Alu" FT misc_feature 874284..874290 FT /note="match to EST T09412 (NID:g390440)" FT repeat_region 874317..874404 FT /rpt_family="L2" FT repeat_region 874431..874732 FT /rpt_family="Alu" FT repeat_region 875000..875210 FT /rpt_family="L1" FT repeat_region 875536..875620 FT /rpt_family="L2" FT repeat_region 875740..875958 FT /rpt_family="L2" FT repeat_region 875987..876445 FT /rpt_family="ERVL" FT repeat_region 877710..877867 FT /rpt_family="Alu" FT misc_feature 878431..878623 FT /note="match to EST BI544654 (NID:g15431966)" FT misc_feature 878433..878623 FT /note="match to EST BI546304 (NID:g15433616)" FT misc_feature 878435..878623 FT /note="match to EST BI560992 (NID:g15448306)" FT /note="match to EST BG772864 (NID:g14083517)" FT /note="similar to Mus musculus EST BB618808 FT (NID:g16458282)" FT /note="match to EST BI462143 (NID:g15252799)" FT /note="match to EST AL528314 (NID:g12791807)" FT /note="match to EST BE559625 (NID:g9803344)" FT /note="match to EST BF966523 (NID:g12333738)" FT /note="match to EST N56631 (NID:g1199902) yw73g06.r1" FT /note="match to EST BF037314 (NID:g10745539)" FT /note="match to EST BG896784 (NID:g14307025)" FT /note="similar to Mus musculus EST BI665607 FT (NID:g15579840)" FT /note="match to EST BI600209 (NID:g15493148)" FT /note="match to EST BI458073 (NID:g15248729)" FT /note="match to EST BG721200 (NID:g14000387)" FT misc_feature 878435..878814 FT /note="match to EST AI469067 (NID:g4331157) ti70d08.x1" FT misc_feature 878435..878818 FT /note="match to EST BE615699 (NID:g9897298)" FT misc_feature 878435..878571 FT /note="match to EST BE247425 (NID:g9099181)" FT misc_feature 878438..878623 FT /note="match to EST AL042137 (NID:g5421482)" FT misc_feature 878472..878818 FT /note="match to EST BF508221 (NID:g11591519)" FT misc_feature 878572..878623 FT /note="match to EST BE832883 (NID:g10265274)" FT misc_feature 878611..878747 FT /note="match to EST BE616255 (NID:g9897854)" FT repeat_region 879028..879189 FT /rpt_family="Alu" FT misc_feature 879067 FT /note="match to EST BE616255 (NID:g9897854)" FT repeat_region 879190..879490 FT /rpt_family="Alu" FT repeat_region 880274..880577 FT /rpt_family="Alu" FT repeat_region 880584..880869 FT /rpt_family="Alu" FT repeat_region 880882..881178 FT /rpt_family="Alu" FT misc_feature 881184..881186 FT /note="match to EST H28794 (NID:g899639) ym33a04.s1" FT misc_feature 881581..881767 FT /note="match to EST BE270762 (NID:g9144405)" FT misc_feature 881581..881753 FT /note="match to EST AA199752 (NID:g1795670) zq52e02.r1" FT misc_feature 881583..881768 FT /note="match to EST N56631 (NID:g1199902) yw73g06.r1" FT misc_feature 881583..881771 FT /note="match to EST BI458073 (NID:g15248729)" FT misc_feature 881583..881767 FT /note="match to EST BE832883 (NID:g10265274)" FT /note="match to EST AL042137 (NID:g5421482)" FT /note="match to EST BE559625 (NID:g9803344)" FT /note="match to EST BI544654 (NID:g15431966)" FT /note="match to EST BI546304 (NID:g15433616)" FT /note="match to EST BF966523 (NID:g12333738)" FT /note="match to EST BF037314 (NID:g10745539)" FT /note="match to EST BG896784 (NID:g14307025)" FT /note="similar to Mus musculus EST BI665607 FT (NID:g15579840)" FT /note="match to EST BG772864 (NID:g14083517)" FT /note="match to EST BI600209 (NID:g15493148)" FT /note="match to EST BG721200 (NID:g14000387)" FT /note="match to EST AL528314 (NID:g12791807)" FT /note="similar to Mus musculus EST BB618808 FT (NID:g16458282)" FT misc_feature 881583..881651 FT /note="match to EST BI560992 (NID:g15448306)" FT misc_feature 881583..881723 FT /note="match to EST BI462143 (NID:g15252799)" FT misc_feature 881629..881767 FT /note="similar to Mus musculus EST BI697948 FT (NID:g15660577)" FT misc_feature 881632..881767 FT /note="match to EST BE262777 (NID:g9136002)" FT misc_feature 881658..881767 FT /note="match to EST BE313275 (NID:g9132982)" FT misc_feature 881702..881767 FT /note="match to EST AL040103 (NID:g5409070)" FT misc_feature 881729..882075 FT /note="match to EST BF904717 (NID:g12296176)" FT misc_feature 882450..882722 FT /note="match to EST BE088748 (NID:g8479156)" FT misc_feature 882615..882869 FT /note="match to EST BE765225 (NID:g10195149)" FT misc_feature 882843..882869 FT /note="match to EST BE832883 (NID:g10265274)" FT /note="match to EST AL040103 (NID:g5409070)" FT /note="match to EST BE313275 (NID:g9132982)" FT /note="match to EST BE262777 (NID:g9136002)" FT /note="similar to Mus musculus EST BI697948 FT (NID:g15660577)" FT /note="match to EST BE270762 (NID:g9144405)" FT /note="match to EST AL042137 (NID:g5421482)" FT /note="match to EST BE559625 (NID:g9803344)" FT /note="match to EST BI544654 (NID:g15431966)" FT /note="match to EST BI546304 (NID:g15433616)" FT /note="match to EST BF966523 (NID:g12333738)" FT /note="match to EST BF037314 (NID:g10745539)" FT /note="match to EST BG896784 (NID:g14307025)" FT /note="similar to Mus musculus EST BI665607 FT (NID:g15579840)" FT /note="match to EST BG772864 (NID:g14083517)" FT /note="match to EST BI600209 (NID:g15493148)" FT /note="match to EST AL528314 (NID:g12791807)" FT /note="similar to Mus musculus EST BB618808 FT (NID:g16458282)" FT misc_feature 882870..882875 FT /note="match to EST BF904717 (NID:g12296176)" FT misc_feature 882977..883449 FT /note="match to EST AW054783 (NID:g5920486) ws59e12.x1" FT misc_feature 882978..883088 FT /note="match to EST BE832883 (NID:g10265274)" FT misc_feature 882978..883034 FT /note="match to EST BE765225 (NID:g10195149)" FT misc_feature 882978..883084 FT /note="match to EST BE270762 (NID:g9144405)" FT misc_feature 882978..883167 FT /note="match to EST AL042137 (NID:g5421482)" FT misc_feature 882978..883121 FT /note="match to EST BF037314 (NID:g10745539)" FT misc_feature 882978..883003 FT /note="match to EST BG896784 (NID:g14307025)" FT misc_feature 882978..883156 FT /note="similar to Mus musculus EST BI665607 FT (NID:g15579840)" FT misc_feature 882978..883151 FT /note="match to EST BG772864 (NID:g14083517)" FT misc_feature 882978..883157 FT /note="match to EST BE313275 (NID:g9132982)" FT /note="match to EST BE262777 (NID:g9136002)" FT /note="similar to Mus musculus EST BI697948 FT (NID:g15660577)" FT /note="match to EST BE559625 (NID:g9803344)" FT /note="match to EST BI544654 (NID:g15431966)" FT /note="match to EST BI546304 (NID:g15433616)" FT /note="match to EST BF966523 (NID:g12333738)" FT /note="match to EST BI600209 (NID:g15493148)" FT /note="match to EST AL528314 (NID:g12791807)" FT /note="similar to Mus musculus EST BB618808 FT (NID:g16458282)" FT misc_feature 883101..883157 FT /note="match to EST BF930841 (NID:g12348165)" FT misc_feature 883188..883443 FT /note="match to EST AI564855 (NID:g4523312) tm86b01.x1" FT misc_feature 883541..883907 FT /note="match to EST BF934723 (NID:g12352047)" FT repeat_region 883996..884092 FT /rpt_family="L2" FT misc_feature 884067..884362 FT /note="match to EST H28812 (NID:g899722) ym33a04.r1" FT repeat_region 884398..884520 FT /rpt_family="MIR" FT misc_feature 884619..884952 FT /note="match to EST BE719009 (NID:g10107274)" FT misc_feature 884686..885137 FT /note="match to EST AW071918 (NID:g6026916) ws56d12.x1" FT misc_feature 884746..885183 FT /note="match to EST H28794 (NID:g899639) ym33a04.s1" FT repeat_region 885091..885269 FT /rpt_family="L1" FT misc_feature 885275..885279 FT /note="match to EST AI564855 (NID:g4523312) tm86b01.x1" FT repeat_region 885739..886043 FT /rpt_family="Alu" FT repeat_region 886073..886227 FT /rpt_family="Alu" FT repeat_region 886230..886363 FT /rpt_family="Alu" FT repeat_region 886367..886669 FT /rpt_family="Alu" FT misc_feature 886951..886955 FT /note="similar to Homo sapiens EST BF239379 FT (NID:g11153301)" FT misc_feature 888055..888252 FT /note="match to EST BF930841 (NID:g12348165)" FT /note="match to EST BE313275 (NID:g9132982)" FT /note="match to EST BE262777 (NID:g9136002)" FT /note="similar to Mus musculus EST BI697948 FT (NID:g15660577)" FT misc_feature 888055..888158 FT /note="match to EST BE559625 (NID:g9803344)" FT misc_feature 888055..888248 FT /note="similar to Mus musculus EST BB618808 FT (NID:g16458282)" FT misc_feature 888092..888252 FT /note="similar to Mus musculus EST BG519189 FT (NID:g13514701)" FT misc_feature 888134..888252 FT /note="similar to Homo sapiens EST BF757532 FT (NID:g12105432)" FT repeat_region 888593..888890 FT /rpt_family="Alu" FT misc_feature 888843..889236 FT /note="match to EST BG979599 (NID:g14382334)" FT misc_feature 889128..889670 FT /note="match to EST AL549176 (NID:g12884903)" FT misc_feature 889151..889240 FT /note="match to EST BG028138 (NID:g12417232)" FT misc_feature 889157..889221 FT /note="similar to Mus musculus EST BG519189 FT (NID:g13514701)" FT misc_feature 889157..889178 FT /note="match to EST BF930841 (NID:g12348165)" FT misc_feature 889157..889241 FT /note="match to EST BE313275 (NID:g9132982)" FT misc_feature 889157..889240 FT /note="similar to Homo sapiens EST BF757532 FT (NID:g12105432)" FT /note="match to EST BE262777 (NID:g9136002)" FT /note="match to EST BI546304 (NID:g15433616)" FT misc_feature 889431..889618 FT /note="match to EST AI003347 (NID:g3203761) am78b04.s1" FT misc_feature 889560..889670 FT /note="match to EST BG028138 (NID:g12417232)" FT /note="similar to Homo sapiens EST BF757532 FT (NID:g12105432)" FT /note="similar to Mus musculus EST BG519189 FT (NID:g13514701)" FT /note="match to EST BE262777 (NID:g9136002)" FT misc_feature 889564..889670 FT /note="match to EST AW130565 (NID:g6132172) xf54b01.x1" FT misc_feature 889631..889955 FT /note="match to EST BE149788 (NID:g8612509)" FT misc_feature 889647..889670 FT /note="match to EST BE270920 (NID:g9144566)" FT repeat_region 889847..890104 FT /rpt_family="Alu" FT misc_feature 889915..890404 FT /note="match to EST AU148192 (NID:g11009713)" FT misc_feature 890170..890405 FT /note="match to EST AW085890 (NID:g6041042) xc60e07.x1" FT repeat_region 890317..890426 FT /rpt_family="Alu" FT misc_feature 890407..890419 FT /note="match to EST BF508221 (NID:g11591519)" FT misc_feature 890407..890428 FT /note="match to EST AI678184 (NID:g4888366) wc24c05.x1" FT misc_feature 890721..891151 FT /note="match to EST AL047408 (NID:g4727323)" FT misc_feature 890852..891119 FT /note="similar to Homo sapiens EST BE819207 FT (NID:g10251441)" FT misc_feature 890933..891119 FT /note="similar to Mus musculus EST BI697948 FT (NID:g15660577)" FT misc_feature 891021..891124 FT /note="match to EST AL549176 (NID:g12884903)" FT misc_feature 891021..891059 FT /note="similar to Homo sapiens EST BF757532 FT (NID:g12105432)" FT misc_feature 891021..891094 FT /note="match to EST BE262777 (NID:g9136002)" FT misc_feature 891021..891093 FT /note="match to EST BF966523 (NID:g12333738)" FT misc_feature 891021..891062 FT /note="match to EST BI600209 (NID:g15493148)" FT misc_feature 891021..891119 FT /note="match to EST BE270920 (NID:g9144566)" FT /note="match to EST AW130565 (NID:g6132172) xf54b01.x1" FT /note="match to EST BG028138 (NID:g12417232)" FT /note="similar to Mus musculus EST BG519189 FT (NID:g13514701)" FT /note="match to EST AL528314 (NID:g12791807)" FT misc_feature 891581..891680 FT /note="match to EST BI918417 (NID:g16182109)" FT misc_feature 891587..891653 FT /note="similar to Homo sapiens EST BE819207 FT (NID:g10251441)" FT misc_feature 891587..891623 FT /note="match to EST BI546304 (NID:g15433616)" FT misc_feature 891587..891680 FT /note="match to EST BE270920 (NID:g9144566)" FT /note="match to EST AW130565 (NID:g6132172) xf54b01.x1" FT /note="similar to Mus musculus EST BI652578 FT (NID:g15566814)" FT /note="match to EST BG028138 (NID:g12417232)" FT /note="similar to Mus musculus EST BG519189 FT (NID:g13514701)" FT /note="similar to Mus musculus EST BI697948 FT (NID:g15660577)" FT /note="match to EST BI544654 (NID:g15431966)" FT /note="match to EST BG721200 (NID:g14000387)" FT /note="match to EST AL528314 (NID:g12791807)" FT misc_feature 891632..891680 FT /note="match to EST BI335796 (NID:g15030530)" FT misc_feature 891655..891680 FT /note="match to EST AA100701 (NID:g1647010) zl90f01.r1" FT misc_feature 892233..892304 FT /note="match to EST AU130887 (NID:g10991241)" FT /note="similar to EST BM788609 (NID:g19136841)" FT misc_feature 892242..892277 FT /note="match to EST BI546304 (NID:g15433616)" FT misc_feature 892246..892566 FT /note="match to EST BG028138 (NID:g12417232)" FT misc_feature 892246..892308 FT /note="similar to Mus musculus EST BI652578 FT (NID:g15566814)" FT /note="similar to Mus musculus EST BG519189 FT (NID:g13514701)" FT misc_feature 892246..892267 FT /note="match to EST BI544654 (NID:g15431966)" FT misc_feature 892246..892304 FT /note="match to EST BE270920 (NID:g9144566)" FT /note="match to EST AW130565 (NID:g6132172) xf54b01.x1" FT /note="match to EST AA100701 (NID:g1647010) zl90f01.r1" FT /note="match to EST BI335796 (NID:g15030530)" FT /note="match to EST BI918417 (NID:g16182109)" FT /note="match to EST AL040103 (NID:g5409070)" FT /note="similar to Mus musculus EST BI697948 FT (NID:g15660577)" FT /note="match to EST BG721200 (NID:g14000387)" FT /note="match to EST AL528314 (NID:g12791807)" FT misc_feature 892447..892565 FT /note="match to EST BI335796 (NID:g15030530)" FT misc_feature 892447..892589 FT /note="match to EST BE270920 (NID:g9144566)" FT /note="similar to EST BM788609 (NID:g19136841)" FT /note="match to EST AA100701 (NID:g1647010) zl90f01.r1" FT /note="similar to Mus musculus EST BI652578 FT (NID:g15566814)" FT misc_feature 892447..892591 FT /note="similar to Mus musculus EST BG519189 FT (NID:g13514701)" FT misc_feature 892447..892580 FT /note="match to EST AL040103 (NID:g5409070)" FT misc_feature 892450..892589 FT /note="match to EST AW130565 (NID:g6132172) xf54b01.x1" FT /note="match to EST AU130887 (NID:g10991241)" FT /note="match to EST BI918417 (NID:g16182109)" FT misc_feature 892450..892540 FT /note="match to EST BG721200 (NID:g14000387)" FT misc_feature 892496..892529 FT /note="match to EST AV649723 (NID:g9870737)" FT misc_feature 892710..893044 FT /note="match to EST BE095154 (NID:g8485607)" FT misc_feature 893046..893195 FT /note="match to EST AW130565 (NID:g6132172) xf54b01.x1" FT misc_feature 893046..893186 FT /note="similar to EST BM788609 (NID:g19136841)" FT misc_feature 893046..893285 FT /note="similar to Mus musculus EST BI652578 FT (NID:g15566814)" FT misc_feature 893046..893255 FT /note="match to EST BE270920 (NID:g9144566)" FT /note="match to EST AU130887 (NID:g10991241)" FT /note="match to EST AA100701 (NID:g1647010) zl90f01.r1" FT /note="match to EST BI918417 (NID:g16182109)" FT misc_feature 893097..893255 FT /note="match to EST AA312396 (NID:g1964864)" FT misc_feature 893121..893255 FT /note="match to EST BF930036 (NID:g12328073)" FT misc_feature 893154..893255 FT /note="match to EST AA188877 (NID:g1775904) zp77f05.r1" FT misc_feature 893195..893255 FT /note="match to EST BE780963 (NID:g10202161)" FT misc_feature 893211 FT /note="match to EST AL042137 (NID:g5421482)" FT repeat_region 893986..894158 FT /rpt_family="MER1_type" FT repeat_region 894246..894318 FT /rpt_family="Alu" FT misc_feature 894335..894643 FT /note="match to EST AV646433 (NID:g9867447)" FT repeat_region 894343..894368 FT /rpt_family="AT_rich" FT misc_feature 894557..894626 FT /note="match to EST BE270920 (NID:g9144566)" FT misc_feature 894557..894643 FT /note="match to EST BE780963 (NID:g10202161)" FT /note="match to EST BF930036 (NID:g12328073)" FT /note="match to EST AA312396 (NID:g1964864)" FT /note="match to EST AU130887 (NID:g10991241)" FT misc_feature 894557..894597 FT /note="match to EST AA188877 (NID:g1775904) zp77f05.r1" FT /note="match to EST AA100701 (NID:g1647010) zl90f01.r1" FT misc_feature 894557..894647 FT /note="similar to Mus musculus EST BI652578 FT (NID:g15566814)" FT misc_feature 894611..894643 FT /note="match to EST BF923482 (NID:g12319370)" FT misc_feature 894618..894643 FT /note="match to EST AU126476 (NID:g10951192)" FT misc_feature 894742 FT /note="match to EST AA188877 (NID:g1775904) zp77f05.r1" FT misc_feature 895820..895823 FT /note="match to EST BI196121 (NID:g14651141)" FT /note="match to EST BF206660 (NID:g11100246)" FT misc_feature 895995..896033 FT /note="match to EST AV646433 (NID:g9867447)" FT misc_feature 895995..896038 FT /note="match to EST BF923482 (NID:g12319370)" FT /note="match to EST AU126476 (NID:g10951192)" FT /note="match to EST BE780963 (NID:g10202161)" FT /note="match to EST BF930036 (NID:g12328073)" FT /note="match to EST AA312396 (NID:g1964864)" FT /note="match to EST AU130887 (NID:g10991241)" FT /note="match to EST BI918417 (NID:g16182109)" FT misc_feature 896583..896815 FT /note="match to EST AA370919 (NID:g2023311)" FT repeat_region 897066..897133 FT /rpt_family="Alu" FT misc_feature 897465..897596 FT /note="match to EST BF930036 (NID:g12328073)" FT misc_feature 897465..897594 FT /note="match to EST BF923482 (NID:g12319370)" FT /note="match to EST AU126476 (NID:g10951192)" FT /note="match to EST BE780963 (NID:g10202161)" FT /note="match to EST AA312396 (NID:g1964864)" FT /note="match to EST AU130887 (NID:g10991241)" FT /note="match to EST BI918417 (NID:g16182109)" FT misc_feature 897520..897594 FT /note="match to EST BF155632 (NID:g11050815)" FT misc_feature 897538..897594 FT /note="match to EST BF849176 (NID:g12236326)" FT misc_feature 897557..897594 FT /note="match to EST AL118570 (NID:g5924469)" FT repeat_region 897682..897981 FT /rpt_family="Alu" FT repeat_region 898510..898817 FT /rpt_family="Alu" FT misc_feature 899765..899977 FT /note="match to EST BF923482 (NID:g12319370)" FT misc_feature 899765..899953 FT /note="match to EST BF155632 (NID:g11050815)" FT misc_feature 899765..900019 FT /note="match to EST BF849176 (NID:g12236326)" FT /note="match to EST AL118570 (NID:g5924469)" FT /note="match to EST AU126476 (NID:g10951192)" FT /note="match to EST BE780963 (NID:g10202161)" FT misc_feature 899765..899863 FT /note="match to EST AA312396 (NID:g1964864)" FT misc_feature 899765..899852 FT /note="match to EST AU130887 (NID:g10991241)" FT misc_feature 899765..899782 FT /note="match to EST BI918417 (NID:g16182109)" FT misc_feature 899790..900019 FT /note="match to EST AA326555 (NID:g1978799)" FT misc_feature 899806..899980 FT /note="match to EST T48558 (NID:g642758)" FT misc_feature 899816..899827 FT /note="match to EST AV646433 (NID:g9867447)" FT misc_feature 899823..900019 FT /note="match to EST AV696443 (NID:g10298306)" FT misc_feature 899895..899899 FT /note="match to EST BG992151 (NID:g14396221)" FT misc_feature 899951..900019 FT /note="match to EST BI196121 (NID:g14651141)" FT /note="match to EST BF206660 (NID:g11100246)" FT misc_feature 899962..899963 FT /note="match to EST BF155632 (NID:g11050815)" FT misc_feature 899984..900019 FT /note="match to EST BE720186 (NID:g10108451)" FT misc_feature 900256 FT /note="match to EST AA312396 (NID:g1964864)" FT repeat_region 900346..900663 FT /rpt_family="MaLR" FT misc_feature 901016..901101 FT /note="similar to Mus musculus EST BG071740 FT (NID:g12554309)" FT /note="match to EST BE937678 (NID:g10464137)" FT /note="similar to EST BM782607 (NID:g19130839)" FT misc_feature 901017..901067 FT /note="match to EST BF849176 (NID:g12236326)" FT misc_feature 901017..901101 FT /note="match to EST BE720186 (NID:g10108451)" FT /note="match to EST BI196121 (NID:g14651141)" FT /note="match to EST BF206660 (NID:g11100246)" FT /note="match to EST AV696443 (NID:g10298306)" FT /note="match to EST AA326555 (NID:g1978799)" FT /note="match to EST AL118570 (NID:g5924469)" FT /note="match to EST AU126476 (NID:g10951192)" FT /note="match to EST BE780963 (NID:g10202161)" FT misc_feature 901028..901101 FT /note="similar to Mus musculus EST BE652417 (NID:g9978260)" FT misc_feature 901064..901101 FT /note="similar to Homo sapiens EST AV660383 (NID:g9881397)" FT misc_feature 901079..901101 FT /note="match to EST BI859239 (NID:g15999986)" FT misc_feature 902146..902147 FT /note="match to EST AA278271 (NID:g1920350) zs79h10.r1" FT repeat_region 902507..902798 FT /rpt_family="Alu" FT misc_feature 902808..903233 FT /note="match to EST AA278271 (NID:g1920350) zs79h10.r1" FT repeat_region 903142..903300 FT /rpt_family="L1" FT misc_feature 903511..904024 FT /note="match to EST AI887510 (NID:g5592674) wm06d08.x1" FT repeat_region 903733..903902 FT /rpt_family="L1" FT repeat_region 903903..904210 FT /rpt_family="Alu" FT misc_feature 904192..904210 FT /note="match to EST BE615699 (NID:g9897298)" FT repeat_region 904211..904272 FT /rpt_family="L1" FT repeat_region 904273..904565 FT /rpt_family="Alu" FT repeat_region 904566..904784 FT /rpt_family="L1" FT repeat_region 904785..905047 FT /rpt_family="Alu" FT repeat_region 905048..905492 FT /rpt_family="L1" FT misc_feature 905307..906023 FT /note="match to EST AW993597 (NID:g8253767)" FT misc_feature 905589..905704 FT /note="similar to Mus musculus EST BG071740 FT (NID:g12554309)" FT /note="match to EST BI859239 (NID:g15999986)" FT /note="similar to Homo sapiens EST AV660383 (NID:g9881397)" FT /note="similar to Mus musculus EST BE652417 (NID:g9978260)" FT /note="similar to EST BM782607 (NID:g19130839)" FT /note="match to EST BI196121 (NID:g14651141)" FT /note="match to EST BF206660 (NID:g11100246)" FT /note="match to EST AV696443 (NID:g10298306)" FT /note="match to EST AA326555 (NID:g1978799)" FT /note="match to EST AL118570 (NID:g5924469)" FT /note="match to EST AU126476 (NID:g10951192)" FT /note="match to EST BE720186 (NID:g10108451)" FT misc_feature 905589..905685 FT /note="match to EST BE937678 (NID:g10464137)" FT misc_feature 905589..905708 FT /note="match to EST BE780963 (NID:g10202161)" FT misc_feature 905597..905704 FT /note="match to EST BE087003 (NID:g8477398)" FT misc_feature 905609..905704 FT /note="match to EST AA336899 (NID:g1989375)" FT misc_feature 905661..905704 FT /note="match to EST AV703744 (NID:g10721071)" FT misc_feature 905687..905704 FT /note="match to EST AU139315 (NID:g11000836)" FT repeat_region 905759..905885 FT /rpt_family="L1" FT repeat_region 906124..906433 FT /rpt_family="C-rich" FT misc_feature 906555..907164 FT /note="similar to EST BM677609 (NID:g18987505)" FT misc_feature 906587..906907 FT /note="match to EST AA188965 (NID:g1775991) zq48f07.s1" FT repeat_region 907335..907412 FT /rpt_family="ERVL" FT repeat_region 907594..907735 FT /rpt_family="ERVL" FT misc_feature 907997..907998 FT /note="match to EST BF791388 (NID:g12096442)" FT misc_feature 908324..908746 FT /note="similar to Homo sapiens EST BF345687 FT (NID:g11293282)" FT misc_feature 908938..909153 FT /note="match to EST D78877 (NID:g1180750)" FT misc_feature 908981..909153 FT /note="similar to Homo sapiens EST BE701083 FT (NID:g10088929)" FT misc_feature 908986..909106 FT /note="match to EST BE720186 (NID:g10108451)" FT misc_feature 908986..909157 FT /note="similar to Homo sapiens EST AV660383 (NID:g9881397)" FT misc_feature 908986..909160 FT /note="match to EST AV696443 (NID:g10298306)" FT misc_feature 908986..908999 FT /note="match to EST AA326555 (NID:g1978799)" FT misc_feature 908986..909153 FT /note="similar to Mus musculus EST BG071740 FT (NID:g12554309)" FT /note="match to EST AU139315 (NID:g11000836)" FT /note="similar to Homo sapiens EST BF239379 FT (NID:g11153301)" FT /note="match to EST AV703744 (NID:g10721071)" FT /note="match to EST AA336899 (NID:g1989375)" FT /note="match to EST BE087003 (NID:g8477398)" FT /note="match to EST BI859239 (NID:g15999986)" FT /note="similar to Mus musculus EST BE652417 (NID:g9978260)" FT /note="similar to EST BM782607 (NID:g19130839)" FT /note="match to EST BI196121 (NID:g14651141)" FT /note="match to EST BF206660 (NID:g11100246)" FT /note="match to EST AL118570 (NID:g5924469)" FT misc_feature 908986..909034 FT /note="match to EST AU126476 (NID:g10951192)" FT misc_feature 908992..909153 FT /note="match to EST AI239435 (NID:g3834832) qh31c02.x1" FT misc_feature 908994..909496 FT /note="match to EST BF914380 (NID:g12305838)" FT misc_feature 909071..909153 FT /note="match to EST BF791388 (NID:g12096442)" FT misc_feature 909126..909153 FT /note="match to EST T09412 (NID:g390440)" FT repeat_region 909569..909860 FT /rpt_family="Alu" FT misc_feature 909847..909860 FT /note="match to EST AW297101 (NID:g6703737)" FT repeat_region 909945..910250 FT /rpt_family="Alu" FT repeat_region 910516..910763 FT /rpt_family="Alu" FT repeat_region 911032..911320 FT /rpt_family="Alu" FT repeat_region 911491..911643 FT /rpt_family="L1" FT misc_feature 911995..911996 FT /note="match to EST BG115027 (NID:g12608533)" FT misc_feature 912107..912165 FT /note="similar to Homo sapiens EST BE701083 FT (NID:g10088929)" FT misc_feature 912107..912194 FT /note="match to EST AA336899 (NID:g1989375)" FT misc_feature 912107..912209 FT /note="similar to Mus musculus EST BE652417 (NID:g9978260)" FT misc_feature 912107..912186 FT /note="match to EST BI196121 (NID:g14651141)" FT misc_feature 912107..912199 FT /note="match to EST AI239435 (NID:g3834832) qh31c02.x1" FT /note="similar to Mus musculus EST BG071740 FT (NID:g12554309)" FT /note="match to EST BG115027 (NID:g12608533)" FT /note="match to EST T09412 (NID:g390440)" FT /note="match to EST BF791388 (NID:g12096442)" FT /note="match to EST AU139315 (NID:g11000836)" FT /note="similar to Homo sapiens EST BF239379 FT (NID:g11153301)" FT /note="match to EST D78877 (NID:g1180750)" FT /note="match to EST AV703744 (NID:g10721071)" FT /note="match to EST BE087003 (NID:g8477398)" FT /note="match to EST BI859239 (NID:g15999986)" FT /note="similar to EST BM782607 (NID:g19130839)" FT /note="match to EST BF206660 (NID:g11100246)" FT misc_feature 912107..912148 FT /note="match to EST AL118570 (NID:g5924469)" FT misc_feature 912111..912199 FT /note="similar to Homo sapiens EST BE383572 (NID:g9328937)" FT misc_feature 912112..912199 FT /note="match to EST BG675258 (NID:g13906654)" FT misc_feature 912142..912199 FT /note="similar to Homo sapiens EST BI199388 FT (NID:g14654409)" FT misc_feature 912162..912199 FT /note="match to EST AW139207 (NID:g6143525)" FT misc_feature 912167..912194 FT /note="similar to Homo sapiens EST AV660383 (NID:g9881397)" FT misc_feature 912180..912199 FT /note="match to EST BG698063 (NID:g13964970)" FT misc_feature 912226 FT /note="match to EST BI196121 (NID:g14651141)" FT repeat_region 912444..912739 FT /rpt_family="Alu" FT misc_feature 912628..912631 FT /note="similar to Homo sapiens EST AL545670 FT (NID:g12878152)" FT misc_feature 912735..913053 FT /note="similar to EST BM710094 (NID:g19023352)" FT misc_feature 912852..913103 FT /note="match to EST AI239435 (NID:g3834832) qh31c02.x1" FT misc_feature 912852..913101 FT /note="match to EST AW139207 (NID:g6143525)" FT misc_feature 912852..913729 FT /note="match to EST BG698063 (NID:g13964970)" FT misc_feature 912852..913105 FT /note="similar to Mus musculus EST BG071740 FT (NID:g12554309)" FT misc_feature 912852..913598 FT /note="similar to Homo sapiens EST BI199388 FT (NID:g14654409)" FT misc_feature 912852..913707 FT /note="match to EST BG675258 (NID:g13906654)" FT misc_feature 912852..913389 FT /note="similar to Homo sapiens EST BE383572 (NID:g9328937)" FT misc_feature 912852..913519 FT /note="match to EST BG115027 (NID:g12608533)" FT misc_feature 912852..913093 FT /note="match to EST T09412 (NID:g390440)" FT misc_feature 912852..913449 FT /note="match to EST BF791388 (NID:g12096442)" FT misc_feature 912852..913282 FT /note="match to EST AU139315 (NID:g11000836)" FT misc_feature 912852..913214 FT /note="similar to Homo sapiens EST BF239379 FT (NID:g11153301)" FT misc_feature 912852..912931 FT /note="match to EST D78877 (NID:g1180750)" FT misc_feature 912852..912904 FT /note="match to EST BE087003 (NID:g8477398)" FT misc_feature 912852..913260 FT /note="match to EST BI859239 (NID:g15999986)" FT misc_feature 912852..913041 FT /note="similar to EST BM782607 (NID:g19130839)" FT misc_feature 912852..913006 FT /note="match to EST BF206660 (NID:g11100246)" FT misc_feature 912891..913403 FT /note="match to EST BG925366 (NID:g14319889)" FT misc_feature 912906..912967 FT /note="match to EST AV703744 (NID:g10721071)" FT misc_feature 912969..913222 FT /note="match to EST BF088332 (NID:g10894042)" FT misc_feature 913013..913152 FT /note="match to EST AA113444 (NID:g1665293) zn69h07.r1" FT misc_feature 913091..913399 FT /note="match to EST AV649723 (NID:g9870737)" FT misc_feature 913121..913446 FT /note="match to EST BG011279 (NID:g12459319)" FT misc_feature 913128..913586 FT /note="match to EST BI008144 (NID:g14412215)" FT misc_feature 913150..913706 FT /note="match to EST BF131974 (NID:g10971014)" FT misc_feature 913151..913781 FT /note="similar to Homo sapiens EST BG498939 FT (NID:g13460456)" FT misc_feature 913164..914085 FT /note="similar to Homo sapiens EST AL545670 FT (NID:g12878152)" FT misc_feature 913173 FT /note="similar to Homo sapiens EST BI915469 FT (NID:g16179477)" FT misc_feature 913213..914156 FT /note="match to EST BI256847 (NID:g14811653)" FT misc_feature 913273..913371 FT /note="match to EST BG120429 (NID:g12613938)" FT misc_feature 913274..913679 FT /note="match to EST H06000 (NID:g869552) yl76c01.r1" FT misc_feature 913275..913908 FT /note="match to EST BE738855 (NID:g10152847)" FT misc_feature 913275..914254 FT /note="similar to EST BM927963 (NID:g19378342)" FT misc_feature 913275..914044 FT /note="similar to Homo sapiens EST BI915469 FT (NID:g16179477)" FT misc_feature 913322 FT /note="match to EST BF088332 (NID:g10894042)" FT misc_feature 913343..913476 FT /note="match to EST BE707763 (NID:g10096028)" FT misc_feature 913449..914109 FT /note="similar to EST BM683844 (NID:g18993740)" FT misc_feature 913450..913582 FT /note="match to EST AV649723 (NID:g9870737)" FT misc_feature 913545..914199 FT /note="match to EST BF213412 (NID:g11106998)" FT misc_feature 913564..914502 FT /note="match to EST AL573480 (NID:g12932766)" FT misc_feature 913564..914003 FT /note="match to EST N41679 (NID:g1165710) yw90f03.r1" FT misc_feature 913568..914539 FT /note="similar to EST BM543890 (NID:g18774675)" FT misc_feature 913685..914086 FT /note="similar to Homo sapiens EST BE155518 (NID:g8618239)" FT misc_feature 913724..914508 FT /note="match to EST BF966718 (NID:g12333933)" FT misc_feature 913760..914056 FT /note="match to EST BG120429 (NID:g12613938)" FT misc_feature 913761..914140 FT /note="match to EST R08529 (NID:g760452) ye95d10.r1" FT misc_feature 913823..914539 FT /note="similar to EST BM671258 (NID:g18981156)" FT misc_feature 913824..914536 FT /note="match to EST BF665735 (NID:g11939630)" FT misc_feature 913834..914243 FT /note="match to EST R81295 (NID:g857898) yj01e04.r1" FT misc_feature 913884..913956 FT /note="similar to Bos taurus EST AV607976 (NID:g9738349)" FT misc_feature 913898..914287 FT /note="match to EST R77878 (NID:g852988) yi77g07.r1" FT misc_feature 913971..914411 FT /note="similar to Bos taurus EST AV607976 (NID:g9738349)" FT misc_feature 913972..914495 FT /note="similar to Bos taurus EST AV611484 (NID:g9747154)" FT misc_feature 913972..914477 FT /note="similar to Homo sapiens EST BI257420 FT (NID:g14812780)" FT misc_feature 914036..914539 FT /note="match to EST AA199866 (NID:g1795573) zq52e02.s1" FT misc_feature 914037..914536 FT /note="match to EST AV710135 (NID:g10728592)" FT misc_feature 914046..914539 FT /note="match to EST BF432386 (NID:g11444517)" FT misc_feature 914046..914324 FT /note="match to EST D61165 (NID:g962804)" FT misc_feature 914076..914535 FT /note="similar to EST BM258544 (NID:g17894143)" FT misc_feature 914081..914343 FT /note="match to EST BG120429 (NID:g12613938)" FT misc_feature 914181..914508 FT /note="match to EST AV749018 (NID:g10906866)" FT misc_feature 914250..914539 FT /note="match to EST AW874055 (NID:g8008108) hq82c08.x1" FT misc_feature 914252..914541 FT /note="match to EST AA730781 (NID:g2751985) nw49a04.s1" FT repeat_region 914369..914398 FT /rpt_family="AT_rich" FT repeat_region 914850..915038 FT /rpt_family="L1" FT repeat_region 915385..915683 FT /rpt_family="Alu" FT misc_feature 915754..916990 FT /note="CpG_island (%GC=75.1, o/e=0.96, #CpGs=159)" FT misc_feature 916189..916441 FT /note="similar to EST BM839884 (NID:g19196293)" FT repeat_region 916203..916349 FT /rpt_family="(CGG)n" FT repeat_region 916441..916519 FT /rpt_family="C-rich" FT repeat_region 916653..916827 FT /rpt_family="C-rich" FT repeat_region 916835..916859 FT /rpt_family="(TC)n" FT repeat_region 916862..917053 FT /rpt_family="CT-rich" FT repeat_region 916960..917238 FT /rpt_family="C-rich" FT repeat_region 917346..917609 FT /rpt_family="C-rich" FT misc_feature 917681..917940 FT /note="similar to EST BM747922 (NID:g19077540)" FT repeat_region 918193..918515 FT /rpt_family="Alu" FT misc_feature 918407..918856 FT /note="match to EST BG992151 (NID:g14396221)" FT repeat_region 918516..918628 FT /rpt_family="L1" FT misc_feature 918577..918854 FT /note="match to EST BG992151 (NID:g14396221)" FT misc_feature 918779..919174 FT /note="match to EST BF814714 (NID:g12147717)" FT misc_feature 919586..919732 FT /note="match to EST F06563 (NID:g672150)" FT repeat_region 919698..919990 FT /rpt_family="Alu" FT misc_feature 919920..920439 FT /note="similar to Homo sapiens EST BF928866 FT (NID:g12326994)" FT repeat_region 920508..920800 FT /rpt_family="Alu" FT misc_feature 920765..920969 FT /note="match to EST F06563 (NID:g672150)" FT repeat_region 920846..921212 FT /rpt_family="L1" FT repeat_region 920969..920998 FT /rpt_family="(CACCC)n" FT repeat_region 921321..921943 FT /rpt_family="L1" FT misc_feature 922633..922838 FT /note="match to EST BI039739 (NID:g14446365)" FT misc_feature 923594..923595 FT /note="match to EST AW877271 (NID:g8015626)" FT misc_feature 923644..924031 FT /note="match to EST BF087410 (NID:g10893120)" FT misc_feature 923769..924031 FT /note="match to EST AA004851 (NID:g1448598) zh92f02.r1" FT misc_feature 923981..924337 FT /note="match to EST AW877271 (NID:g8015626)" FT misc_feature 924405..924409 FT /note="match to EST BG992151 (NID:g14396221)" FT repeat_region 924420..924716 FT /rpt_family="Alu" FT misc_feature 924683..924953 FT /note="match to EST BE073441 (NID:g8420427)" FT misc_feature 924712..925002 FT /note="match to EST BF874571 (NID:g12264701)" FT misc_feature 924750..925420 FT /note="match to EST AU133804 (NID:g10994343)" FT misc_feature 925673..925771 FT /note="similar to Mus musculus EST AA021831 (NID:g1485585) FT mh82c08.r1" FT misc_feature 925684..925771 FT /note="match to EST BF516594 (NID:g11601773)" FT /note="match to EST BG709448 (NID:g13987794)" FT /note="match to EST T16043 (NID:g518205)" FT /note="match to EST AI200352 (NID:g3752958) qf92h12.x1" FT misc_feature 925685..925771 FT /note="match to EST AL527751 (NID:g12791244)" FT misc_feature 925693..925771 FT /note="match to EST BF087410 (NID:g10893120)" FT misc_feature 925693..925775 FT /note="match to EST AA004851 (NID:g1448598) zh92f02.r1" FT misc_feature 925717..925771 FT /note="match to EST AI174672 (NID:g6361050)" FT misc_feature 925726..925771 FT /note="match to EST BG034421 (NID:g12427714)" FT misc_feature 926204..926287 FT /note="similar to Mus musculus EST W65144 (NID:g1372795) FT me02f03.r1" FT misc_feature 926206..926287 FT /note="match to EST BF516594 (NID:g11601773)" FT /note="similar to Mus musculus EST AA021831 (NID:g1485585) FT mh82c08.r1" FT /note="match to EST AI174672 (NID:g6361050)" FT /note="match to EST T16043 (NID:g518205)" FT /note="match to EST AI200352 (NID:g3752958) qf92h12.x1" FT /note="match to EST AL527751 (NID:g12791244)" FT /note="match to EST BG034421 (NID:g12427714)" FT /note="match to EST BG709448 (NID:g13987794)" FT misc_feature 926206..926223 FT /note="match to EST BF087410 (NID:g10893120)" FT misc_feature 926222..926287 FT /note="match to EST BE855648 (NID:g10368069)" FT misc_feature 926263..926287 FT /note="match to EST BG768797 (NID:g14079450)" FT misc_feature 926278..926287 FT /note="match to EST BI084297 (NID:g14502627)" FT misc_feature 927006..927156 FT /note="similar to Mus musculus EST AA087576 (NID:g1630844) FT mm28c08.r1" FT /note="similar to Gallus gallus EST AJ396197 FT (NID:g7127890)" FT misc_feature 927007..927156 FT /note="similar to Mus musculus EST W65144 (NID:g1372795) FT me02f03.r1" FT /note="match to EST BF516594 (NID:g11601773)" FT /note="match to EST BG034421 (NID:g12427714)" FT /note="match to EST AL527751 (NID:g12791244)" FT /note="similar to Mus musculus EST AA021831 (NID:g1485585) FT mh82c08.r1" FT /note="match to EST AI174672 (NID:g6361050)" FT /note="match to EST BI084297 (NID:g14502627)" FT /note="match to EST BG768797 (NID:g14079450)" FT /note="match to EST BG709448 (NID:g13987794)" FT /note="match to EST AI200352 (NID:g3752958) qf92h12.x1" FT misc_feature 927007..927031 FT /note="match to EST BE855648 (NID:g10368069)" FT misc_feature 927007..927022 FT /note="match to EST T16043 (NID:g518205)" FT misc_feature 927009..927156 FT /note="match to EST BE293652 (NID:g9177023)" FT misc_feature 927057..927156 FT /note="match to EST AI148073 (NID:g3675755) qg61h05.r1" FT misc_feature 927096..927156 FT /note="similar to Mus musculus EST AA024244 (NID:g1489130) FT mh97c09.r1" FT misc_feature 927110..927156 FT /note="match to EST BG748368 (NID:g14059021)" FT misc_feature 927113..927156 FT /note="match to EST AI051742 (NID:g3307276) ox45b04.s1" FT misc_feature 927118..927156 FT /note="match to EST R35399 (NID:g792300) yg64g11.r1" FT misc_feature 927123..927156 FT /note="match to EST BF829690 (NID:g12175512)" FT misc_feature 927706..927981 FT /note="match to EST BF806208 (NID:g12135197)" FT misc_feature 928824..928837 FT /note="match to EST BE872468 (NID:g10321244)" FT repeat_region 929285..929459 FT /rpt_family="G-rich" FT misc_feature 929933..930015 FT /note="match to EST BF814860 (NID:g12148260)" FT misc_feature 930081 FT /note="match to EST AA077378 (NID:g1836852)" FT misc_feature 930089..930385 FT /note="match to EST AA077378 (NID:g1836852)" FT misc_feature 930231..930367 FT /note="match to EST BF808300 (NID:g12137289)" FT misc_feature 930563..930703 FT /note="match to EST BF898959 (NID:g12290418)" FT misc_feature 930565..930703 FT /note="similar to Gallus gallus EST AJ396197 FT (NID:g7127890)" FT /note="match to EST AI148073 (NID:g3675755) qg61h05.r1" FT /note="match to EST AI051742 (NID:g3307276) ox45b04.s1" FT /note="match to EST BE293652 (NID:g9177023)" FT /note="match to EST BG709448 (NID:g13987794)" FT /note="match to EST AI174672 (NID:g6361050)" FT /note="match to EST BF829690 (NID:g12175512)" FT /note="similar to Mus musculus EST AA024244 (NID:g1489130) FT mh97c09.r1" FT /note="match to EST BI084297 (NID:g14502627)" FT /note="match to EST BG768797 (NID:g14079450)" FT /note="match to EST BG034421 (NID:g12427714)" FT /note="match to EST BG748368 (NID:g14059021)" FT /note="match to EST R35399 (NID:g792300) yg64g11.r1" FT /note="match to EST AL527751 (NID:g12791244)" FT misc_feature 930565..930701 FT /note="similar to Mus musculus EST AA087576 (NID:g1630844) FT mm28c08.r1" FT misc_feature 930565..930705 FT /note="similar to Mus musculus EST W65144 (NID:g1372795) FT me02f03.r1" FT misc_feature 930565..930719 FT /note="match to EST BF516594 (NID:g11601773)" FT misc_feature 930585..930586 FT /note="match to EST R14733 (NID:g769006) yf91d11.r1" FT misc_feature 930613..930703 FT /note="similar to Homo sapiens EST AA291909 (NID:g1939912) FT zt39h10.r1" FT misc_feature 930618..930703 FT /note="match to EST R14733 (NID:g769006) yf91d11.r1" FT misc_feature 930619..930703 FT /note="match to EST BG420799 (NID:g13327305)" FT misc_feature 930624..930703 FT /note="similar to Mus musculus EST AA389031 (NID:g2041986) FT mp16a10.r1" FT misc_feature 930663..930703 FT /note="match to EST AA287434 (NID:g1933116) zs52c01.r1" FT misc_feature 930671..930703 FT /note="match to EST BG255238 (NID:g12765054)" FT misc_feature 930689..930703 FT /note="match to EST D82603 (NID:g1183225)" FT misc_feature 930724 FT /note="match to EST BF516594 (NID:g11601773)" FT misc_feature 931909..931914 FT /note="match to EST AW050627 (NID:g5912897) wz19e03.x1" FT misc_feature 931913..932262 FT /note="match to EST AW381580 (NID:g6886239)" FT misc_feature 931915..932055 FT /note="match to EST BG034421 (NID:g12427714)" FT /note="similar to Mus musculus EST AA389031 (NID:g2041986) FT mp16a10.r1" FT /note="match to EST AI051742 (NID:g3307276) ox45b04.s1" FT /note="match to EST R35399 (NID:g792300) yg64g11.r1" FT /note="match to EST R14733 (NID:g769006) yf91d11.r1" FT /note="match to EST BE293652 (NID:g9177023)" FT /note="match to EST AA287434 (NID:g1933116) zs52c01.r1" FT /note="match to EST BG748368 (NID:g14059021)" FT /note="match to EST BI084297 (NID:g14502627)" FT /note="match to EST AL527751 (NID:g12791244)" FT /note="match to EST BF898959 (NID:g12290418)" FT /note="match to EST D82603 (NID:g1183225)" FT /note="match to EST AI174672 (NID:g6361050)" FT /note="similar to Gallus gallus EST AJ396197 FT (NID:g7127890)" FT /note="match to EST BG420799 (NID:g13327305)" FT /note="match to EST BG768797 (NID:g14079450)" FT /note="similar to Mus musculus EST AA024244 (NID:g1489130) FT mh97c09.r1" FT /note="match to EST BG255238 (NID:g12765054)" FT misc_feature 931915..931992 FT /note="match to EST AI148073 (NID:g3675755) qg61h05.r1" FT /note="similar to Homo sapiens EST AA291909 (NID:g1939912) FT zt39h10.r1" FT misc_feature 931915..932117 FT /note="match to EST BF829690 (NID:g12175512)" FT misc_feature 931915..932051 FT /note="match to EST BG709448 (NID:g13987794)" FT misc_feature 931917..932055 FT /note="match to EST BF001541 (NID:g10701816)" FT misc_feature 931928..932055 FT /note="similar to Mus musculus EST AW457080 (NID:g7027297)" FT misc_feature 931931..932055 FT /note="match to EST AA046214 (NID:g1526244) zk77e03.r1" FT misc_feature 931952..932055 FT /note="similar to Homo sapiens EST W25355 (NID:g1303229) FT zb70c01.r1" FT misc_feature 931956..932055 FT /note="match to EST BF214494 (NID:g11108080)" FT misc_feature 931980..932055 FT /note="match to EST BG938741 (NID:g14338113) cn28a09.x1" FT misc_feature 931989..932055 FT /note="match to EST BG286455 (NID:g13039357)" FT misc_feature 932015..932055 FT /note="match to EST AW025442 (NID:g5878972) wu74c09.x1" FT misc_feature 932021..932055 FT /note="similar to Rattus norvegicus EST AW435023 FT (NID:g6966330)" FT misc_feature 932038..932055 FT /note="match to EST BI858137 (NID:g15998884)" FT repeat_region 932103..932280 FT /rpt_family="(TG)n" FT repeat_region 932379..932560 FT /rpt_family="(TG)n" FT repeat_region 932660..932822 FT /rpt_family="(TG)n" FT repeat_region 932799..932984 FT /rpt_family="(TGG)n" FT misc_feature 933127..933681 FT /note="similar to Homo sapiens EST AL134501 (NID:g6602688)" FT misc_feature 933365..933716 FT /note="match to EST BF934820 (NID:g12352144)" FT misc_feature 933376..933452 FT /note="similar to Mus musculus EST AW493256 (NID:g7063537)" FT misc_feature 933377..933452 FT /note="similar to Mus musculus EST AA389031 (NID:g2041986) FT mp16a10.r1" FT /note="similar to Mus musculus EST AW457080 (NID:g7027297)" FT /note="match to EST BE293652 (NID:g9177023)" FT /note="similar to Rattus norvegicus EST AW435023 FT (NID:g6966330)" FT /note="match to EST BI084297 (NID:g14502627)" FT /note="match to EST BG748368 (NID:g14059021)" FT /note="match to EST BG768797 (NID:g14079450)" FT /note="match to EST BI858137 (NID:g15998884)" FT /note="match to EST R35399 (NID:g792300) yg64g11.r1" FT /note="similar to Homo sapiens EST W25355 (NID:g1303229) FT zb70c01.r1" FT /note="match to EST BG286455 (NID:g13039357)" FT /note="match to EST BG034421 (NID:g12427714)" FT /note="match to EST AA046214 (NID:g1526244) zk77e03.r1" FT /note="match to EST AW025442 (NID:g5878972) wu74c09.x1" FT /note="match to EST BG255238 (NID:g12765054)" FT /note="match to EST BF214494 (NID:g11108080)" FT /note="similar to Gallus gallus EST AJ396197 FT (NID:g7127890)" FT /note="match to EST AI174672 (NID:g6361050)" FT /note="match to EST R14733 (NID:g769006) yf91d11.r1" FT /note="match to EST BF898959 (NID:g12290418)" FT /note="match to EST BG420799 (NID:g13327305)" FT /note="match to EST AL527751 (NID:g12791244)" FT /note="match to EST AA287434 (NID:g1933116) zs52c01.r1" FT /note="match to EST BF001541 (NID:g10701816)" FT /note="match to EST D82603 (NID:g1183225)" FT /note="similar to Mus musculus EST AA024244 (NID:g1489130) FT mh97c09.r1" FT misc_feature 933377..933398 FT /note="match to EST AI051742 (NID:g3307276) ox45b04.s1" FT misc_feature 933377..933608 FT /note="match to EST BG938741 (NID:g14338113) cn28a09.x1" FT misc_feature 933427..933452 FT /note="match to EST AI693704 (NID:g4971044) wd44d03.x1" FT misc_feature 933435..933452 FT /note="match to EST AW269623 (NID:g6656653) xv54f02.x1" FT misc_feature 933536..933557 FT /note="match to EST BE293652 (NID:g9177023)" FT misc_feature 933536..933612 FT /note="match to EST AA046214 (NID:g1526244) zk77e03.r1" FT /note="similar to Gallus gallus EST AJ396197 FT (NID:g7127890)" FT misc_feature 933536..933608 FT /note="similar to Rattus norvegicus EST AW435023 FT (NID:g6966330)" FT /note="match to EST AA287434 (NID:g1933116) zs52c01.r1" FT /note="match to EST BF214494 (NID:g11108080)" FT /note="match to EST D82603 (NID:g1183225)" FT /note="match to EST BG255238 (NID:g12765054)" FT /note="similar to Mus musculus EST AA389031 (NID:g2041986) FT mp16a10.r1" FT /note="match to EST BG748368 (NID:g14059021)" FT /note="match to EST BF001541 (NID:g10701816)" FT /note="match to EST BI084297 (NID:g14502627)" FT /note="match to EST BG420799 (NID:g13327305)" FT /note="match to EST AW269623 (NID:g6656653) xv54f02.x1" FT /note="match to EST AW025442 (NID:g5878972) wu74c09.x1" FT /note="similar to Mus musculus EST AW457080 (NID:g7027297)" FT /note="match to EST BI858137 (NID:g15998884)" FT /note="match to EST BG768797 (NID:g14079450)" FT /note="match to EST AL527751 (NID:g12791244)" FT /note="similar to Mus musculus EST AW493256 (NID:g7063537)" FT /note="match to EST BG286455 (NID:g13039357)" FT /note="match to EST AI693704 (NID:g4971044) wd44d03.x1" FT misc_feature 933536..933556 FT /note="match to EST R35399 (NID:g792300) yg64g11.r1" FT /note="match to EST AI174672 (NID:g6361050)" FT misc_feature 933536..933602 FT /note="similar to Homo sapiens EST W25355 (NID:g1303229) FT zb70c01.r1" FT misc_feature 933536..933582 FT /note="match to EST BF898959 (NID:g12290418)" FT misc_feature 933569..933608 FT /note="match to EST AA125912 (NID:g1687775) zl22e03.r1" FT misc_feature 933591..933608 FT /note="match to EST AI343725 (NID:g4080931) qp11h02.x1" FT misc_feature 933678..933681 FT /note="similar to Homo sapiens EST H83556 (NID:g1062227) FT yv83f07.r1" FT misc_feature 934436..934638 FT /note="match to EST BF814860 (NID:g12148260)" FT misc_feature 934971..935405 FT /note="match to EST BG255238 (NID:g12765054)" FT misc_feature 934971..935245 FT /note="match to EST BF001541 (NID:g10701816)" FT misc_feature 934971..935129 FT /note="similar to Mus musculus EST AA389031 (NID:g2041986) FT mp16a10.r1" FT misc_feature 934971..935331 FT /note="match to EST AI343725 (NID:g4080931) qp11h02.x1" FT /note="match to EST AI693704 (NID:g4971044) wd44d03.x1" FT misc_feature 934971..935327 FT /note="similar to Mus musculus EST AW493256 (NID:g7063537)" FT /note="match to EST BI858137 (NID:g15998884)" FT /note="similar to Rattus norvegicus EST AW435023 FT (NID:g6966330)" FT /note="match to EST AW025442 (NID:g5878972) wu74c09.x1" FT misc_feature 934971..935275 FT /note="match to EST BG748368 (NID:g14059021)" FT misc_feature 934971..935165 FT /note="match to EST BG768797 (NID:g14079450)" FT misc_feature 934971..935030 FT /note="match to EST D82603 (NID:g1183225)" FT misc_feature 934971..935088 FT /note="match to EST BG938741 (NID:g14338113) cn28a09.x1" FT misc_feature 934971..935326 FT /note="match to EST AW269623 (NID:g6656653) xv54f02.x1" FT misc_feature 934971..935153 FT /note="match to EST AA287434 (NID:g1933116) zs52c01.r1" FT misc_feature 934971..935300 FT /note="match to EST AA125912 (NID:g1687775) zl22e03.r1" FT misc_feature 934971..935268 FT /note="match to EST BF214494 (NID:g11108080)" FT misc_feature 934971..935509 FT /note="match to EST BG286455 (NID:g13039357)" FT misc_feature 934971..935091 FT /note="similar to Mus musculus EST AW457080 (NID:g7027297)" FT misc_feature 934971..935340 FT /note="match to EST BG420799 (NID:g13327305)" FT misc_feature 934971..935009 FT /note="match to EST BI084297 (NID:g14502627)" FT misc_feature 934971..935196 FT /note="match to EST AL527751 (NID:g12791244)" FT misc_feature 934979..935320 FT /note="match to EST BF795253 (NID:g12100307)" FT misc_feature 934999..935674 FT /note="match to EST BG249645 (NID:g12759461)" FT misc_feature 935012..935327 FT /note="match to EST BE855648 (NID:g10368069)" FT misc_feature 935117..935787 FT /note="match to EST BI906071 (NID:g16168720)" FT misc_feature 935135..935989 FT /note="match to EST AL562969 (NID:g12911918)" FT misc_feature 935211..935489 FT /note="match to EST BE794846 (NID:g10216044)" FT misc_feature 935237..935331 FT /note="match to EST AI051742 (NID:g3307276) ox45b04.s1" FT misc_feature 935271 FT /note="match to EST AA287434 (NID:g1933116) zs52c01.r1" FT misc_feature 935297..936071 FT /note="match to EST BG109419 (NID:g12602925)" FT misc_feature 935365..935854 FT /note="match to EST BF757645 (NID:g12105454)" FT misc_feature 935382..935833 FT /note="similar to Homo sapiens EST H83556 (NID:g1062227) FT yv83f07.r1" FT misc_feature 935452..936064 FT /note="match to EST BG938742 (NID:g14338114) cn28a09.y1" FT misc_feature 935526..935912 FT /note="similar to Homo sapiens EST AW062268 (NID:g6013653)" FT misc_feature 935623..936071 FT /note="match to EST R42510 (NID:g817273) yf91d11.s1" FT misc_feature 935662..936072 FT /note="match to EST AI139772 (NID:g3645744) qe02b07.x1" FT misc_feature 935761..936072 FT /note="match to EST BI828683 (NID:g15940233)" FT misc_feature 935876..936071 FT /note="match to EST AI872764 (NID:g5546813) wm70c04.x1" FT misc_feature 935923..936070 FT /note="match to EST BF001541 (NID:g10701816)" FT misc_feature 936042..936046 FT /note="match to EST BF874571 (NID:g12264701)" FT misc_feature 936164 FT /note="match to EST BG938742 (NID:g14338114) cn28a09.y1" FT misc_feature 937537..937901 FT /note="match to EST BM006641 (NID:g16520995)" FT misc_feature 937538..937629 FT /note="similar to Homo sapiens EST BE962307 FT (NID:g11765077)" FT misc_feature 937545..937813 FT /note="match to EST AI352280 (NID:g4089486) qr12c12.x1" FT misc_feature 937551..938021 FT /note="match to EST AW050627 (NID:g5912897) wz19e03.x1" FT misc_feature 937565..937955 FT /note="similar to Homo sapiens EST BG112277 FT (NID:g12605783)" FT misc_feature 937596..938410 FT /note="match to EST AL561976 (NID:g12909940)" FT misc_feature 937693..937697 FT /note="match to EST BE563412 (NID:g9807132)" FT misc_feature 937735 FT /note="match to EST AL562419 (NID:g12910819)" FT misc_feature 937773..938290 FT /note="match to EST AL562419 (NID:g12910819)" FT misc_feature 937789..938296 FT /note="similar to Homo sapiens EST BG821979 FT (NID:g14169566)" FT misc_feature 937982..938581 FT /note="match to EST BG386774 (NID:g13280220)" FT repeat_region 937991..938107 FT /rpt_family="L2" FT misc_feature 938036..938586 FT /note="match to EST AL559106 (NID:g12904279)" FT misc_feature 938304..938557 FT /note="similar to Homo sapiens EST BF869471 FT (NID:g12259601)" FT misc_feature 938320..938586 FT /note="match to EST BM008132 (NID:g16522486)" FT misc_feature 938326..938586 FT /note="match to EST BE617265 (NID:g9888203)" FT misc_feature 938352..938586 FT /note="match to EST BF812893 (NID:g12143196)" FT misc_feature 938380..938586 FT /note="match to EST BE872468 (NID:g10321244)" FT misc_feature 938420..938586 FT /note="similar to Mus musculus EST AV262765 FT (NID:g16389077)" FT misc_feature 938514..938586 FT /note="match to EST BE871723 (NID:g10320499)" FT misc_feature 938560..938586 FT /note="match to EST AL536857 (NID:g12800350)" FT repeat_region 938644..938665 FT /rpt_family="GC_rich" FT misc_feature 938668..938898 FT /note="similar to Homo sapiens EST BF364882 FT (NID:g11326907)" FT misc_feature 938670..938898 FT /note="match to EST AL536857 (NID:g12800350)" FT /note="match to EST BE871723 (NID:g10320499)" FT /note="match to EST BE872468 (NID:g10321244)" FT /note="similar to Mus musculus EST AV262765 FT (NID:g16389077)" FT /note="match to EST BE617265 (NID:g9888203)" FT /note="match to EST AL559106 (NID:g12904279)" FT /note="match to EST BM008132 (NID:g16522486)" FT misc_feature 938670..938892 FT /note="match to EST BF812893 (NID:g12143196)" FT misc_feature 938674..938898 FT /note="match to EST R86874 (NID:g945538) ym86h03.r1" FT /note="similar to Mus musculus EST AU051140 (NID:g4434149)" FT misc_feature 938679..938898 FT /note="match to EST T09325 (NID:g390353)" FT misc_feature 938725..938898 FT /note="match to EST BI914641 (NID:g16198994)" FT misc_feature 938782..938898 FT /note="match to EST BG959488 (NID:g14377659)" FT misc_feature 938825..938898 FT /note="match to EST BE563412 (NID:g9807132)" FT misc_feature 938834..938898 FT /note="match to EST BE047744 (NID:g8364797) tz41e12.y1" FT misc_feature 939056..939091 FT /note="match to EST R86874 (NID:g945538) ym86h03.r1" FT misc_feature 939056..939077 FT /note="match to EST AL559106 (NID:g12904279)" FT misc_feature 939056..939139 FT /note="match to EST BG959488 (NID:g14377659)" FT misc_feature 939056..939127 FT /note="match to EST AL536857 (NID:g12800350)" FT /note="match to EST BE563412 (NID:g9807132)" FT /note="match to EST BI914641 (NID:g16198994)" FT /note="match to EST BE047744 (NID:g8364797) tz41e12.y1" FT /note="match to EST BE871723 (NID:g10320499)" FT /note="similar to Mus musculus EST AU051140 (NID:g4434149)" FT /note="match to EST BE872468 (NID:g10321244)" FT /note="match to EST BE617265 (NID:g9888203)" FT /note="similar to Mus musculus EST AV262765 FT (NID:g16389077)" FT /note="match to EST T09325 (NID:g390353)" FT /note="match to EST BM008132 (NID:g16522486)" FT /note="similar to Homo sapiens EST BF364882 FT (NID:g11326907)" FT misc_feature 939059..939127 FT /note="match to EST AL534979 (NID:g12798472)" FT misc_feature 939739..939801 FT /note="match to EST AL534979 (NID:g12798472)" FT /note="match to EST AL536857 (NID:g12800350)" FT /note="match to EST BE563412 (NID:g9807132)" FT /note="similar to Mus musculus EST BB615223 FT (NID:g16455512)" FT /note="match to EST BI914641 (NID:g16198994)" FT /note="match to EST BE047744 (NID:g8364797) tz41e12.y1" FT /note="match to EST BE871723 (NID:g10320499)" FT /note="similar to Mus musculus EST AU051140 (NID:g4434149)" FT /note="match to EST BE872468 (NID:g10321244)" FT /note="match to EST BE617265 (NID:g9888203)" FT /note="similar to Mus musculus EST AV262765 FT (NID:g16389077)" FT /note="match to EST T09325 (NID:g390353)" FT /note="match to EST BM008132 (NID:g16522486)" FT /note="similar to Homo sapiens EST BF364882 FT (NID:g11326907)" FT misc_feature 939740..939801 FT /note="match to EST BI197120 (NID:g14652140)" FT misc_feature 939741..939801 FT /note="match to EST BI757921 (NID:g15749499)" FT misc_feature 939775..939801 FT /note="match to EST BI818405 (NID:g15929215)" FT misc_feature 940167..940253 FT /note="match to EST BF081816 (NID:g10875646)" FT misc_feature 940170..940250 FT /note="match to EST BE047744 (NID:g8364797) tz41e12.y1" FT /note="match to EST BE563412 (NID:g9807132)" FT misc_feature 940170..940253 FT /note="match to EST BI914641 (NID:g16198994)" FT /note="match to EST AL534979 (NID:g12798472)" FT /note="match to EST AL536857 (NID:g12800350)" FT /note="match to EST BI757921 (NID:g15749499)" FT /note="match to EST BI818405 (NID:g15929215)" FT /note="match to EST BI197120 (NID:g14652140)" FT /note="similar to Mus musculus EST BB615223 FT (NID:g16455512)" FT /note="match to EST BE871723 (NID:g10320499)" FT /note="similar to Mus musculus EST AU051140 (NID:g4434149)" FT /note="match to EST BE872468 (NID:g10321244)" FT /note="similar to Homo sapiens EST BF364882 FT (NID:g11326907)" FT misc_feature 940170..940252 FT /note="match to EST BE617265 (NID:g9888203)" FT misc_feature 940170..940239 FT /note="similar to Mus musculus EST AV262765 FT (NID:g16389077)" FT misc_feature 940170..940190 FT /note="match to EST T09325 (NID:g390353)" FT misc_feature 940172..940253 FT /note="match to EST AW894341 (NID:g8058546)" FT misc_feature 940176..940253 FT /note="match to EST AL536701 (NID:g12800194)" FT repeat_region 940521..940553 FT /rpt_family="(CCGGG)n" FT repeat_region 941382..941455 FT /rpt_family="(CCCCG)n" FT repeat_region 941722..941811 FT /rpt_family="Alu" FT repeat_region 941814..942125 FT /rpt_family="Alu" FT repeat_region 942096..942135 FT /rpt_family="(A)n" FT repeat_region 942127..942467 FT /rpt_family="L1" FT repeat_region 942490..942580 FT /rpt_family="L1" FT misc_feature 942729..943122 FT /note="match to EST BG955304 (NID:g14373475)" FT repeat_region 942955..943061 FT /rpt_family="L1" FT misc_feature 943190..943206 FT /note="match to EST BE902906 (NID:g10393555)" FT misc_feature 943594..943909 FT /note="match to EST BF755894 (NID:g12103794)" FT misc_feature 943752..943909 FT /note="match to EST BE314656 (NID:g9136052)" FT misc_feature 943756..943909 FT /note="similar to Homo sapiens EST H17347 (NID:g883587) FT ym38c07.r1" FT misc_feature 943763..943890 FT /note="similar to Homo sapiens EST BF364882 FT (NID:g11326907)" FT misc_feature 943763..943909 FT /note="match to EST AL536857 (NID:g12800350)" FT /note="match to EST AW894341 (NID:g8058546)" FT /note="match to EST AL536701 (NID:g12800194)" FT /note="match to EST AL534979 (NID:g12798472)" FT /note="match to EST BI757921 (NID:g15749499)" FT /note="match to EST BI818405 (NID:g15929215)" FT /note="match to EST BI197120 (NID:g14652140)" FT /note="match to EST BE563412 (NID:g9807132)" FT /note="similar to Mus musculus EST BB615223 FT (NID:g16455512)" FT /note="match to EST BI914641 (NID:g16198994)" FT /note="match to EST BE047744 (NID:g8364797) tz41e12.y1" FT /note="match to EST BE871723 (NID:g10320499)" FT /note="similar to Mus musculus EST AU051140 (NID:g4434149)" FT /note="match to EST BF081816 (NID:g10875646)" FT misc_feature 943763..943784 FT /note="match to EST BE872468 (NID:g10321244)" FT misc_feature 943775..943909 FT /note="match to EST BG960017 (NID:g14378188)" FT repeat_region 944000..944104 FT /rpt_family="MIR" FT repeat_region 944459..944479 FT /rpt_family="GC_rich" FT misc_feature 944697..944809 FT /note="match to EST BI197120 (NID:g14652140)" FT /note="similar to Homo sapiens EST H17347 (NID:g883587) FT ym38c07.r1" FT /note="match to EST AL536701 (NID:g12800194)" FT /note="match to EST AL534979 (NID:g12798472)" FT /note="match to EST AL536857 (NID:g12800350)" FT /note="match to EST BI757921 (NID:g15749499)" FT /note="match to EST BI818405 (NID:g15929215)" FT /note="match to EST BE314656 (NID:g9136052)" FT /note="match to EST BE563412 (NID:g9807132)" FT /note="similar to Mus musculus EST BB615223 FT (NID:g16455512)" FT /note="match to EST BI914641 (NID:g16198994)" FT /note="match to EST AW894341 (NID:g8058546)" FT misc_feature 944697..944781 FT /note="match to EST BF755894 (NID:g12103794)" FT misc_feature 944697..944721 FT /note="match to EST BE047744 (NID:g8364797) tz41e12.y1" FT misc_feature 944697..944699 FT /note="match to EST BE871723 (NID:g10320499)" FT misc_feature 944697..944810 FT /note="match to EST BG960017 (NID:g14378188)" FT misc_feature 944697..944779 FT /note="match to EST BF081816 (NID:g10875646)" FT misc_feature 944703..944809 FT /note="match to EST AL524960 (NID:g12788453)" FT misc_feature 944750..944809 FT /note="match to EST BM007107 (NID:g16521461)" FT repeat_region 944994..945095 FT /rpt_family="GA-rich" FT repeat_region 945096..945295 FT /rpt_family="(GGAGAA)n" FT repeat_region 945315..946290 FT /rpt_family="(GGAGAA)n" FT repeat_region 945811..946179 FT /rpt_family="L1" FT misc_feature 946467..946823 FT /note="match to EST BG982135 (NID:g14384870)" FT misc_feature 948295..949168 FT /note="CpG_island (%GC=73.3, o/e=0.90, #CpGs=94)" FT repeat_region 949925..950183 FT /rpt_family="Alu" FT misc_feature 950346..950909 FT /note="match to EST AW966290 (NID:g8156126)" FT misc_feature 950396..950650 FT /note="match to EST AA593722 (NID:g2408400) nm64f10.s1" FT misc_feature 950657..950910 FT /note="match to EST AA339210 (NID:g1991499)" FT misc_feature 951177..952236 FT /note="CpG_island (%GC=71.7, o/e=0.70, #CpGs=68)" FT repeat_region 951202..951422 FT /rpt_family="(CGGGGG)n" FT repeat_region 952345..952472 FT /rpt_family="Alu" FT repeat_region 952492..952779 FT /rpt_family="Alu" FT repeat_region 952790..952831 FT /rpt_family="L1" FT repeat_region 952832..953135 FT /rpt_family="Alu" FT repeat_region 952836..952855 FT /rpt_family="(T)n" FT misc_feature 952836..952853 FT /note="match to EST AW129621 (NID:g6117565) xe19h11.x1" FT misc_feature 952836..952850 FT /note="match to EST BF508795 (NID:g11592093)" FT misc_feature 952836..952852 FT /note="match to EST AI189552 (NID:g3740761) qd28a06.x1" FT repeat_region 953136..953288 FT /rpt_family="L1" FT repeat_region 953290..953582 FT /rpt_family="Alu" FT misc_feature 955192..955195 FT /note="match to EST BG716328 (NID:g13995515)" FT repeat_region 955876..956053 FT /rpt_family="MaLR" FT repeat_region 957116..957372 FT /rpt_family="Alu" FT repeat_region 957411..957729 FT /rpt_family="Alu" FT repeat_region 957730..957857 FT /rpt_family="Alu" FT repeat_region 957860..958142 FT /rpt_family="Alu" FT repeat_region 959157..959330 FT /rpt_family="GA-rich" FT repeat_region 959367..959556 FT /rpt_family="GA-rich" FT misc_feature 959592 FT /note="match to EST AA326859 (NID:g1979126)" FT misc_feature 959605..959687 FT /note="match to EST AL524960 (NID:g12788453)" FT /note="match to EST AL536701 (NID:g12800194)" FT /note="match to EST BG716328 (NID:g13995515)" FT /note="match to EST AL534979 (NID:g12798472)" FT /note="match to EST AL536857 (NID:g12800350)" FT /note="match to EST BI757921 (NID:g15749499)" FT /note="match to EST BI818405 (NID:g15929215)" FT /note="match to EST BE314656 (NID:g9136052)" FT /note="match to EST BI197120 (NID:g14652140)" FT /note="match to EST AA326859 (NID:g1979126)" FT /note="match to EST BE563412 (NID:g9807132)" FT /note="similar to Mus musculus EST BB615223 FT (NID:g16455512)" FT /note="similar to Homo sapiens EST H17347 (NID:g883587) FT ym38c07.r1" FT /note="match to EST BI914641 (NID:g16198994)" FT /note="match to EST BM007107 (NID:g16521461)" FT misc_feature 959605..959633 FT /note="match to EST AW894341 (NID:g8058546)" FT misc_feature 960114..960436 FT /note="match to EST AA633289 (NID:g2556703) nq58d01.s1" FT repeat_region 960682..960962 FT /rpt_family="MaLR" FT repeat_region 960963..961250 FT /rpt_family="Alu" FT repeat_region 961251..961329 FT /rpt_family="MaLR" FT repeat_region 962437..962507 FT /rpt_family="C-rich" FT repeat_region 962568..962856 FT /rpt_family="MaLR" FT misc_feature 962589..963087 FT /note="match to EST BF512073 (NID:g11597285)" FT misc_feature 963171..963180 FT /note="match to EST AI823968 (NID:g5444639) wj29a02.x1" FT repeat_region 964878..965012 FT /rpt_family="Alu" FT repeat_region 964998..965019 FT /rpt_family="(A)n" FT repeat_region 965064..965135 FT /rpt_family="C-rich" FT misc_feature 966189..966280 FT /note="match to EST AL534979 (NID:g12798472)" FT /note="match to EST AL536701 (NID:g12800194)" FT /note="match to EST AL524960 (NID:g12788453)" FT /note="match to EST AL536857 (NID:g12800350)" FT /note="match to EST BI197120 (NID:g14652140)" FT /note="match to EST BG716328 (NID:g13995515)" FT /note="match to EST BI757921 (NID:g15749499)" FT /note="match to EST BE563412 (NID:g9807132)" FT /note="match to EST AA326859 (NID:g1979126)" FT /note="match to EST BI818405 (NID:g15929215)" FT /note="match to EST BE314656 (NID:g9136052)" FT /note="match to EST BM007107 (NID:g16521461)" FT misc_feature 966189..966291 FT /note="similar to Mus musculus EST BB615223 FT (NID:g16455512)" FT misc_feature 966189..966285 FT /note="similar to Homo sapiens EST H17347 (NID:g883587) FT ym38c07.r1" FT misc_feature 966189..966263 FT /note="match to EST BI914641 (NID:g16198994)" FT misc_feature 966248..966280 FT /note="match to EST AL119572 (NID:g5925471)" FT repeat_region 967570..967855 FT /rpt_family="Alu" FT misc_feature 967686..967710 FT /note="match to EST BI828683 (NID:g15940233)" FT repeat_region 967688..967709 FT /rpt_family="AT_rich" FT repeat_region 967858..968021 FT /rpt_family="Alu" FT repeat_region 968016..968039 FT /rpt_family="AT_rich" FT repeat_region 968082..968172 FT /rpt_family="Alu" FT repeat_region 968173..968647 FT /rpt_family="L1" FT misc_feature 968578..968582 FT /note="match to EST BI907126 (NID:g16169911)" FT repeat_region 968648..968945 FT /rpt_family="Alu" FT repeat_region 968946..969034 FT /rpt_family="L1" FT repeat_region 969035..969167 FT /rpt_family="Alu" FT repeat_region 969151..969171 FT /rpt_family="(A)n" FT misc_feature 969159..969176 FT /note="match to EST BI858137 (NID:g15998884)" FT repeat_region 969168..969447 FT /rpt_family="L1" FT repeat_region 969458..969763 FT /rpt_family="Alu" FT repeat_region 969738..969763 FT /rpt_family="(A)n" FT repeat_region 969767..970030 FT /rpt_family="L1" FT misc_feature 970011..970017 FT /note="match to EST BE673583 (NID:g10034124)" FT repeat_region 970032..970177 FT /rpt_family="Alu" FT repeat_region 970178..970463 FT /rpt_family="Alu" FT repeat_region 970464..970644 FT /rpt_family="Alu" FT repeat_region 970632..970804 FT /rpt_family="GA-rich" FT misc_feature 970698..971099 FT /note="match to EST BF923580 (NID:g12319468)" FT repeat_region 970948..971380 FT /rpt_family="L1" FT repeat_region 971390..971457 FT /rpt_family="A-rich" FT misc_feature 971590..971930 FT /note="match to EST BG958970 (NID:g14377141)" FT repeat_region 972221..972280 FT /rpt_family="MIR" FT repeat_region 972551..972625 FT /rpt_family="Alu" FT repeat_region 972626..972921 FT /rpt_family="Alu" FT repeat_region 972922..972995 FT /rpt_family="Alu" FT misc_feature 973123..973888 FT /note="CpG_island (%GC=75.3, o/e=0.80, #CpGs=52)" FT repeat_region 973151..973171 FT /rpt_family="GC_rich" FT misc_feature 974079..974326 FT /note="similar to Homo sapiens EST BF899972 FT (NID:g12291431)" FT misc_feature 974563..975715 FT /note="CpG_island (%GC=69.0, o/e=0.70, #CpGs=78)" FT misc_feature 975011..975145 FT /note="match to EST BI818405 (NID:g15929215)" FT misc_feature 975011..975141 FT /note="match to EST AL536701 (NID:g12800194)" FT /note="match to EST AL524960 (NID:g12788453)" FT /note="match to EST BG716328 (NID:g13995515)" FT /note="match to EST AL119572 (NID:g5925471)" FT /note="match to EST AL534979 (NID:g12798472)" FT /note="match to EST BI757921 (NID:g15749499)" FT /note="match to EST BE314656 (NID:g9136052)" FT /note="match to EST BI197120 (NID:g14652140)" FT misc_feature 975011..975100 FT /note="match to EST AA326859 (NID:g1979126)" FT misc_feature 975011..975059 FT /note="match to EST BE563412 (NID:g9807132)" FT misc_feature 975011..975080 FT /note="match to EST BM007107 (NID:g16521461)" FT misc_feature 975060..975141 FT /note="match to EST AU098762 (NID:g13549891)" FT misc_feature 975259..975261 FT /note="match to EST BI197120 (NID:g14652140)" FT misc_feature 975314..975318 FT /note="match to EST BE314656 (NID:g9136052)" FT repeat_region 975780..975852 FT /rpt_family="Alu" FT repeat_region 975853..976119 FT /rpt_family="Alu" FT repeat_region 977794..977828 FT /rpt_family="(TTTTG)n" FT repeat_region 977795..978116 FT /rpt_family="Alu" FT repeat_region 978282..978328 FT /rpt_family="MIR" FT misc_feature 978332..978842 FT /note="match to EST BG957059 (NID:g14375230)" FT repeat_region 978720..978857 FT /rpt_family="MER1_type" FT repeat_region 978858..979152 FT /rpt_family="Alu" FT repeat_region 979153..979183 FT /rpt_family="MER1_type" FT repeat_region 979185..979482 FT /rpt_family="Alu" FT repeat_region 979812..979970 FT /rpt_family="Alu" FT repeat_region 979967..980010 FT /rpt_family="(CA)n" FT repeat_region 980151..980617 FT /rpt_family="L1" FT repeat_region 980618..980710 FT /rpt_family="L1" FT repeat_region 980706..981918 FT /rpt_family="L1" FT repeat_region 981917..981949 FT /rpt_family="(GGA)n" FT repeat_region 981950..982675 FT /rpt_family="GA-rich" FT repeat_region 982638..982829 FT /rpt_family="(GGGA)n" FT repeat_region 982826..983525 FT /rpt_family="GA-rich" FT repeat_region 983546..983569 FT /rpt_family="(TTA)n" FT repeat_region 983556..983847 FT /rpt_family="Alu" FT repeat_region 983862..983908 FT /rpt_family="T-rich" FT repeat_region 983872..984188 FT /rpt_family="Alu" FT repeat_region 984209..984491 FT /rpt_family="L1" FT repeat_region 986403..986484 FT /rpt_family="L1" FT repeat_region 986490..986597 FT /rpt_family="Alu" FT repeat_region 986669..986991 FT /rpt_family="Alu" FT repeat_region 986843..986874 FT /rpt_family="(T)n" FT repeat_region 987261..987606 FT /rpt_family="L2" FT repeat_region 988338..988629 FT /rpt_family="Alu" FT repeat_region 988653..988818 FT /rpt_family="L2" FT repeat_region 989508..989839 FT /rpt_family="L1" FT repeat_region 989840..990142 FT /rpt_family="Alu" FT repeat_region 990122..990142 FT /rpt_family="(A)n" FT repeat_region 990143..990210 FT /rpt_family="L1" FT repeat_region 990211..990522 FT /rpt_family="Alu" FT repeat_region 990493..990525 FT /rpt_family="(A)n" FT repeat_region 990523..990718 FT /rpt_family="L1" FT repeat_region 990705..990726 FT /rpt_family="AT_rich" FT repeat_region 990729..991023 FT /rpt_family="Alu" FT repeat_region 991129..991180 FT /rpt_family="Alu" FT repeat_region 991183..991386 FT /rpt_family="Alu" FT repeat_region 991452..991600 FT /rpt_family="Alu" FT misc_feature 993402..994574 FT /note="CpG_island (%GC=80.6, o/e=0.90, #CpGs=172)" FT repeat_region 993805..993836 FT /rpt_family="GC_rich" FT repeat_region 993908..994023 FT /rpt_family="(CCCCG)n" FT misc_feature 994026..994113 FT /note="match to EST AL536857 (NID:g12800350)" FT misc_feature 994032..994294 FT /note="match to EST AL536701 (NID:g12800194)" FT /note="match to EST AL524960 (NID:g12788453)" FT misc_feature 994032..994239 FT /note="match to EST AU098762 (NID:g13549891)" FT misc_feature 994032..994324 FT /note="match to EST BG716328 (NID:g13995515)" FT misc_feature 994032..994196 FT /note="match to EST AL119572 (NID:g5925471)" FT misc_feature 994032..994125 FT /note="match to EST AL534979 (NID:g12798472)" FT misc_feature 994032..994085 FT /note="match to EST BI757921 (NID:g15749499)" FT repeat_region 994178..994211 FT /rpt_family="GC_rich" FT misc_feature 994235..994295 FT /note="match to EST AL534979 (NID:g12798472)" FT repeat_region 994317..994338 FT /rpt_family="GC_rich" FT repeat_region 994410..994446 FT /rpt_family="GC_rich" FT repeat_region 995180..995474 FT /rpt_family="Alu" FT repeat_region 995451..995474 FT /rpt_family="(A)n" FT repeat_region 995854..995966 FT /rpt_family="L2" FT repeat_region 996041..996095 FT /rpt_family="(T)n" FT repeat_region 996066..996377 FT /rpt_family="Alu" FT repeat_region 996387..996412 FT /rpt_family="(T)n" FT repeat_region 996707..996781 FT /rpt_family="MIR" FT repeat_region 998868..999278 FT /rpt_family="L1" FT repeat_region 999276..999308 FT /rpt_family="T-rich" FT repeat_region 999279..999574 FT /rpt_family="Alu" FT repeat_region 999583..999875 FT /rpt_family="Alu" FT misc_feature 999760..999766 FT /note="similar to Homo sapiens EST H83556 (NID:g1062227) FT yv83f07.r1" FT repeat_region 999876..1000056 FT /rpt_family="L1" FT repeat_region 1000309..1001266 FT /rpt_family="ERVK" FT repeat_region 1003327..1003535 FT /rpt_family="MaLR" FT repeat_region 1003778..1003835 FT /rpt_family="MaLR" FT repeat_region 1003836..1004132 FT /rpt_family="Alu" FT misc_feature 1003999..1004610 FT /note="match to EST BI492612 (NID:g15331956)" FT misc_feature 1004015..1004361 FT /note="match to EST AI436263 (NID:g4308962) th75h08.x1" FT repeat_region 1004133..1004233 FT /rpt_family="MaLR" FT misc_feature 1004178..1004721 FT /note="match to EST N76282 (NID:g1238860) yv38d03.r1" FT misc_feature 1004488..1005003 FT /note="match to EST AI814246 (NID:g5425461) wj70f10.x1" FT misc_feature 1004490..1004743 FT /note="match to EST AA342305 (NID:g1994603)" FT misc_feature 1004502..1004961 FT /note="match to EST AA442296 (NID:g2154174) zv54c07.r1" FT repeat_region 1004885..1004971 FT /rpt_family="L1" FT repeat_region 1004986..1005292 FT /rpt_family="L1" FT repeat_region 1005293..1005574 FT /rpt_family="Alu" FT repeat_region 1005575..1005779 FT /rpt_family="L1" FT repeat_region 1005775..1005806 FT /rpt_family="(T)n" FT repeat_region 1005780..1006088 FT /rpt_family="Alu" FT misc_feature 1005802..1006298 FT /note="match to EST AU153267 (NID:g11014788)" FT misc_feature 1005875..1005878 FT /note="similar to Homo sapiens EST BF869471 FT (NID:g12259601)" FT misc_feature 1005958..1006461 FT /note="match to EST BG163420 (NID:g12670123)" FT repeat_region 1006089..1006199 FT /rpt_family="L1" FT repeat_region 1006326..1006827 FT /rpt_family="MER2_type" FT repeat_region 1006821..1006919 FT /rpt_family="MER2_type" FT repeat_region 1006994..1007127 FT /rpt_family="L1" FT misc_feature 1007264..1007881 FT /note="similar to Homo sapiens EST AL528926 FT (NID:g12792419)" FT misc_feature 1007282..1007825 FT /note="match to EST BE264996 (NID:g9138572)" FT misc_feature 1007526..1007733 FT /note="match to EST AA158197 (NID:g1733008) zo55e09.r1" FT misc_feature 1007611..1007825 FT /note="similar to Homo sapiens EST BF766503 FT (NID:g12114507)" FT misc_feature 1007744..1008360 FT /note="match to EST BF815268 (NID:g12149179)" FT misc_feature 1008009..1008559 FT /note="similar to Homo sapiens EST BE867002 FT (NID:g10315778)" FT misc_feature 1008399..1008690 FT /note="match to EST AI916132 (NID:g5635987) wi47b09.x1" FT misc_feature 1008440..1009048 FT /note="similar to Homo sapiens EST AL528927 FT (NID:g12792420)" FT misc_feature 1008524..1009092 FT /note="match to EST AU131540 (NID:g10991894)" FT misc_feature 1008558..1009047 FT /note="match to EST AA830784 (NID:g2903883) oc56b06.s1" FT misc_feature 1008567..1009046 FT /note="match to EST W86291 (NID:g1398729) zh54c03.s1" FT misc_feature 1008603..1009092 FT /note="match to EST AW467010 (NID:g7037116) ha07e08.x1" FT misc_feature 1008616..1009092 FT /note="match to EST BG285021 (NID:g13036561)" FT misc_feature 1008661..1009033 FT /note="match to EST F36562 (NID:g4822188)" FT misc_feature 1008799..1009092 FT /note="match to EST BI907126 (NID:g16169911)" FT misc_feature 1008824..1009092 FT /note="match to EST AI525498 (NID:g4439633)" FT misc_feature 1008865..1009058 FT /note="match to EST F30988 (NID:g4816614)" FT repeat_region 1009445..1009501 FT /rpt_family="MaLR" FT misc_feature 1009472..1009474 FT /note="match to EST W86291 (NID:g1398729) zh54c03.s1" FT repeat_region 1009593..1009615 FT /rpt_family="(T)n" FT repeat_region 1009774..1010068 FT /rpt_family="Alu" FT repeat_region 1010076..1010096 FT /rpt_family="(T)n" FT repeat_region 1010370..1010504 FT /rpt_family="Alu" FT misc_feature 1010932..1011051 FT /note="match to EST BF990682 (NID:g12397007)" FT repeat_region 1011186..1011225 FT /rpt_family="(A)n" FT repeat_region 1011228..1011536 FT /rpt_family="Alu" FT repeat_region 1011507..1011534 FT /rpt_family="(TAAAAA)n" FT misc_feature 1012809..1012928 FT /note="similar to Bos taurus EST BF040810 (NID:g10757865)" FT misc_feature 1012817..1012928 FT /note="match to EST AU131540 (NID:g10991894)" FT /note="match to EST BI907126 (NID:g16169911)" FT /note="match to EST AI525498 (NID:g4439633)" FT /note="match to EST AW467010 (NID:g7037116) ha07e08.x1" FT misc_feature 1012817..1012890 FT /note="match to EST BG285021 (NID:g13036561)" FT misc_feature 1012836..1012928 FT /note="match to EST BG977998 (NID:g14380746)" FT repeat_region 1013036..1013315 FT /rpt_family="Alu" FT repeat_region 1013320..1013618 FT /rpt_family="Alu" FT repeat_region 1013623..1013852 FT /rpt_family="Alu" FT repeat_region 1013653..1013686 FT /rpt_family="AT_rich" FT repeat_region 1013833..1013853 FT /rpt_family="AT_rich" FT repeat_region 1013854..1014078 FT /rpt_family="Alu" FT repeat_region 1013887..1013908 FT /rpt_family="(A)n" FT repeat_region 1014283..1014311 FT /rpt_family="(TTTTC)n" FT misc_feature 1014345..1014441 FT /note="match to EST BF990682 (NID:g12397007)" FT misc_feature 1014583..1015555 FT /note="CpG_island (%GC=69.2, o/e=0.80, #CpGs=90)" FT misc_feature 1015064..1015143 FT /note="match to EST BI907126 (NID:g16169911)" FT misc_feature 1015064..1015246 FT /note="similar to Bos taurus EST BF040810 (NID:g10757865)" FT misc_feature 1015064..1015170 FT /note="match to EST AU131540 (NID:g10991894)" FT misc_feature 1015064..1015166 FT /note="match to EST BG977998 (NID:g14380746)" FT misc_feature 1015064..1015153 FT /note="match to EST AI525498 (NID:g4439633)" FT misc_feature 1015064..1015099 FT /note="match to EST AW467010 (NID:g7037116) ha07e08.x1" FT repeat_region 1015242..1015307 FT /rpt_family="(CCCCAG)n" FT repeat_region 1015408..1015460 FT /rpt_family="MIR" FT repeat_region 1015596..1015821 FT /rpt_family="MaLR" FT repeat_region 1015822..1016115 FT /rpt_family="Alu" FT repeat_region 1016116..1016212 FT /rpt_family="MaLR" FT repeat_region 1016213..1016380 FT /rpt_family="Alu" FT repeat_region 1016390..1016680 FT /rpt_family="Alu" FT repeat_region 1017872..1018170 FT /rpt_family="Alu" FT repeat_region 1018234..1018306 FT /rpt_family="L2" FT repeat_region 1018392..1018743 FT /rpt_family="MaLR" FT repeat_region 1018779..1019105 FT /rpt_family="ERVK" FT repeat_region 1019106..1019383 FT /rpt_family="Alu" FT repeat_region 1019384..1019479 FT /rpt_family="ERVK" FT repeat_region 1019622..1019666 FT /rpt_family="ERVK" FT repeat_region 1019667..1019781 FT /rpt_family="MaLR" FT repeat_region 1019844..1019871 FT /rpt_family="(CCCA)n" FT repeat_region 1019868..1019988 FT /rpt_family="MaLR" FT repeat_region 1020093..1020231 FT /rpt_family="L1" FT repeat_region 1020321..1020341 FT /rpt_family="(T)n" FT repeat_region 1020650..1020962 FT /rpt_family="Alu" FT repeat_region 1020934..1020962 FT /rpt_family="(GAAAA)n" FT repeat_region 1020966..1021084 FT /rpt_family="Alu" FT repeat_region 1021095..1021378 FT /rpt_family="Alu" FT repeat_region 1021382..1021695 FT /rpt_family="Alu" FT repeat_region 1021831..1021865 FT /rpt_family="CR1" FT misc_feature 1022534..1022536 FT /note="match to EST BI772553 (NID:g15764131)" FT misc_feature 1022838..1023021 FT /note="match to EST BI772553 (NID:g15764131)" FT repeat_region 1023407..1023492 FT /rpt_family="MIR" FT misc_feature 1024048..1024210 FT /note="match to EST BI772553 (NID:g15764131)" FT misc_feature 1024586..1024735 FT /note="match to EST BI772553 (NID:g15764131)" FT misc_feature 1024802..1024959 FT /note="match to EST BI772553 (NID:g15764131)" FT misc_feature 1025586..1026376 FT /note="match to EST AU119534 (NID:g10934769)" FT misc_feature 1026043..1026050 FT /note="match to EST BF814860 (NID:g12148260)" FT misc_feature 1026260..1026415 FT /note="match to EST BI772553 (NID:g15764131)" FT misc_feature 1026301..1026433 FT /note="match to EST AL520637 (NID:g12784130)" FT repeat_region 1026557..1026613 FT /rpt_family="MIR" FT misc_feature 1026743..1026881 FT /note="match to EST AL520637 (NID:g12784130)" FT misc_feature 1026983..1027167 FT /note="match to EST AL520637 (NID:g12784130)" FT misc_feature 1027913..1028054 FT /note="match to EST AL520637 (NID:g12784130)" FT misc_feature 1028158..1028440 FT /note="match to EST AL520637 (NID:g12784130)" FT misc_feature 1028345..1029244 FT /note="match to EST AL561898 (NID:g12909784)" FT repeat_region 1028569..1028594 FT /rpt_family="(CCCCCA)n" FT misc_feature 1028793..1029276 FT /note="match to EST AU145848 (NID:g11007369)" FT repeat_region 1029135..1029432 FT /rpt_family="Alu" FT misc_feature 1029466..1030325 FT /note="CpG_island (%GC=69.9, o/e=0.80, #CpGs=75)" FT repeat_region 1029579..1029749 FT /rpt_family="(GTGTG)n" FT misc_feature 1029697..1029849 FT /note="match to EST BI030176 (NID:g14436806)" FT repeat_region 1029776..1029950 FT /rpt_family="(GTGTG)n" FT misc_feature 1029916..1030345 FT /note="match to EST BI030182 (NID:g14436812)" FT misc_feature 1030009..1030241 FT /note="match to EST BI030176 (NID:g14436806)" FT misc_feature 1030020..1030345 FT /note="match to EST BI030566 (NID:g14437196)" FT repeat_region 1031329..1031558 FT /rpt_family="L1" FT misc_feature 1031367..1031651 FT /note="match to EST AA077562 (NID:g1837036)" FT misc_feature 1031829..1031833 FT /note="similar to Homo sapiens EST BI001248 FT (NID:g14405322)" FT repeat_region 1033154..1033420 FT /rpt_family="Alu" FT repeat_region 1033769..1033811 FT /rpt_family="AT_rich" FT repeat_region 1033787..1034085 FT /rpt_family="Alu" FT repeat_region 1034132..1034373 FT /rpt_family="Alu" FT misc_feature 1034172..1034175 FT /note="match to EST BF827786 (NID:g12171998)" FT misc_feature 1034194..1034616 FT /note="similar to Homo sapiens EST BI001248 FT (NID:g14405322)" FT misc_feature 1035825..1036069 FT /note="similar to Homo sapiens EST BG115190 FT (NID:g12608696)" FT misc_feature 1036622..1036872 FT /note="match to EST AI916893 (NID:g5636748) wb46h01.x1" FT misc_feature 1036627..1036894 FT /note="match to EST BE673583 (NID:g10034124)" FT misc_feature 1036632..1036818 FT /note="match to EST AI823968 (NID:g5444639) wj29a02.x1" FT misc_feature 1036641..1037159 FT /note="match to EST BI912390 (NID:g16176449)" FT misc_feature 1036642..1037083 FT /note="match to EST BE275433 (NID:g9150387)" FT misc_feature 1036642..1036954 FT /note="match to EST AA478173 (NID:g2206807) zu40b05.r1" FT misc_feature 1036642..1037069 FT /note="match to EST BF434845 (NID:g11447133)" FT misc_feature 1036643..1036835 FT /note="match to EST AI468167 (NID:g4330257) tg56a10.x1" FT misc_feature 1036643..1036788 FT /note="match to EST AI421445 (NID:g4267376) tf15b04.x1" FT misc_feature 1036644..1037095 FT /note="match to EST AW166500 (NID:g6398025) xn54b05.x1" FT misc_feature 1036645..1037287 FT /note="similar to Homo sapiens EST BF338054 FT (NID:g11284452)" FT misc_feature 1036649..1037440 FT /note="match to EST AL529998 (NID:g12793491)" FT misc_feature 1036651..1037434 FT /note="match to EST BG121683 (NID:g12615192)" FT misc_feature 1036658..1037298 FT /note="match to EST AW577397 (NID:g7252446)" FT misc_feature 1036669..1037440 FT /note="match to EST BG744999 (NID:g14055652)" FT misc_feature 1036674..1037442 FT /note="match to EST BG832044 (NID:g14179631)" FT misc_feature 1036677..1037440 FT /note="match to EST BG282868 (NID:g13032178)" FT misc_feature 1036716..1037358 FT /note="similar to Homo sapiens EST BF689031 FT (NID:g11974439)" FT misc_feature 1036730..1037440 FT /note="match to EST BM011467 (NID:g16525821)" FT misc_feature 1036783..1037440 FT /note="match to EST AL536886 (NID:g12800379)" FT misc_feature 1036852..1037149 FT /note="match to EST AI421445 (NID:g4267376) tf15b04.x1" FT misc_feature 1036859..1037069 FT /note="match to EST BE896386 (NID:g10360735)" FT misc_feature 1036860..1037107 FT /note="match to EST AA335239 (NID:g1987481)" FT misc_feature 1036876..1037440 FT /note="match to EST BG329705 (NID:g13136143)" FT misc_feature 1036892..1037300 FT /note="match to EST BG337819 (NID:g13144355)" FT misc_feature 1036895..1037272 FT /note="match to EST BE903122 (NID:g10393986)" FT misc_feature 1036906..1037440 FT /note="match to EST BE902906 (NID:g10393555)" FT misc_feature 1036911..1037440 FT /note="match to EST BM018413 (NID:g16532767)" FT misc_feature 1036924..1037184 FT /note="match to EST BF346362 (NID:g11293957)" FT misc_feature 1036931..1037069 FT /note="match to EST BF827786 (NID:g12171998)" FT misc_feature 1036936..1037440 FT /note="match to EST BG709625 (NID:g13988154)" FT misc_feature 1036970..1037405 FT /note="similar to Homo sapiens EST W79098 (NID:g1390534) FT zd75h10.r1" FT misc_feature 1036983..1037436 FT /note="similar to Homo sapiens EST N99361 (NID:g1270917) FT za39c08.r1" FT misc_feature 1037004..1037440 FT /note="match to EST BE906714 (NID:g10400057)" FT misc_feature 1037047..1037440 FT /note="match to EST AL529999 (NID:g12793492)" FT misc_feature 1037084..1037440 FT /note="similar to Homo sapiens EST BE736728 FT (NID:g10150720)" FT misc_feature 1037086..1037440 FT /note="match to EST AL566548 (NID:g12919014)" FT misc_feature 1037114..1037272 FT /note="match to EST BG773988 (NID:g14044287)" FT misc_feature 1037134..1037165 FT /note="match to EST AI468167 (NID:g4330257) tg56a10.x1" FT misc_feature 1037166..1037196 FT /note="match to EST BE275433 (NID:g9150387)" FT misc_feature 1037218..1037393 FT /note="match to EST AI916893 (NID:g5636748) wb46h01.x1" FT misc_feature 1037223..1037440 FT /note="match to EST BF129057 (NID:g10968097)" FT misc_feature 1037274..1037440 FT /note="match to EST BE254266 (NID:g9124692)" FT misc_feature 1037282..1037440 FT /note="match to EST BE896386 (NID:g10360735)" FT /note="match to EST BF827786 (NID:g12171998)" FT misc_feature 1037282..1037329 FT /note="match to EST BF434845 (NID:g11447133)" FT misc_feature 1037306..1037440 FT /note="similar to Homo sapiens EST AA357437 (NID:g2009766)" FT misc_feature 1037316..1037440 FT /note="match to EST BE150214 (NID:g8612935)" FT misc_feature 1037325..1037440 FT /note="match to EST BF346362 (NID:g11293957)" FT misc_feature 1037399..1037440 FT /note="match to EST BE903122 (NID:g10393986)" FT /note="match to EST BG773988 (NID:g14044287)" FT repeat_region 1037631..1037780 FT /rpt_family="L1" FT repeat_region 1037881..1038090 FT /rpt_family="L1" FT repeat_region 1038091..1038116 FT /rpt_family="(T)n" FT repeat_region 1038382..1038587 FT /rpt_family="L1" FT repeat_region 1038876..1039072 FT /rpt_family="L1" FT repeat_region 1039110..1039236 FT /rpt_family="Alu" FT repeat_region 1039591..1039682 FT /rpt_family="(CA)n" FT misc_feature 1040101..1040187 FT /note="match to EST BI254689 (NID:g14807357)" FT misc_feature 1040104..1040187 FT /note="similar to Homo sapiens EST N30494 (NID:g1149014) FT yx48g05.r1" FT misc_feature 1040106..1040191 FT /note="match to EST BM011467 (NID:g16525821)" FT misc_feature 1040106..1040168 FT /note="match to EST BM018413 (NID:g16532767)" FT misc_feature 1040106..1040146 FT /note="match to EST BG282868 (NID:g13032178)" FT misc_feature 1040106..1040150 FT /note="match to EST BF827786 (NID:g12171998)" FT misc_feature 1040106..1040187 FT /note="similar to Homo sapiens EST BE736728 FT (NID:g10150720)" FT /note="match to EST BF129057 (NID:g10968097)" FT /note="match to EST BG709625 (NID:g13988154)" FT /note="match to EST BE903122 (NID:g10393986)" FT /note="match to EST BG773988 (NID:g14044287)" FT /note="match to EST AL536886 (NID:g12800379)" FT /note="match to EST BF346362 (NID:g11293957)" FT /note="match to EST BE906714 (NID:g10400057)" FT /note="match to EST BE896386 (NID:g10360735)" FT /note="match to EST BE254266 (NID:g9124692)" FT /note="match to EST AL529999 (NID:g12793492)" FT /note="match to EST BE902906 (NID:g10393555)" FT /note="match to EST BG329705 (NID:g13136143)" FT /note="match to EST BE150214 (NID:g8612935)" FT /note="match to EST AL566548 (NID:g12919014)" FT /note="match to EST BG744999 (NID:g14055652)" FT /note="match to EST AL529998 (NID:g12793491)" FT misc_feature 1040114..1040145 FT /note="similar to Homo sapiens EST AA357437 (NID:g2009766)" FT misc_feature 1040132..1040160 FT /note="similar to Homo sapiens EST BF689031 FT (NID:g11974439)" FT misc_feature complement(1040160..1040161) FT /note="match to EST BF827786 (NID:g12171998)" FT misc_feature 1041254..1041293 FT /note="similar to Homo sapiens EST AA077459 (NID:g1836933)" FT misc_feature 1041547..1041561 FT /note="similar to Homo sapiens EST AA077459 (NID:g1836933)" FT misc_feature 1041785..1041801 FT /note="similar to Homo sapiens EST AA077459 (NID:g1836933)" FT misc_feature 1041835..1041851 FT /note="similar to Homo sapiens EST AA077459 (NID:g1836933)" FT misc_feature 1042387..1042401 FT /note="similar to Homo sapiens EST AA077459 (NID:g1836933)" FT misc_feature 1042607..1042623 FT /note="similar to Homo sapiens EST AA077459 (NID:g1836933)" FT misc_feature 1042675..1042691 FT /note="similar to Homo sapiens EST AA077459 (NID:g1836933)" FT misc_feature 1042795..1042811 FT /note="similar to Homo sapiens EST AA077459 (NID:g1836933)" FT misc_feature 1043003..1043058 FT /note="similar to Homo sapiens EST AA077459 (NID:g1836933)" FT misc_feature 1044209..1044247 FT /note="match to EST BE150214 (NID:g8612935)" FT repeat_region 1044649..1044937 FT /rpt_family="Alu" FT misc_feature 1044752..1044756 FT /note="similar to Homo sapiens EST AA077459 (NID:g1836933)" FT misc_feature 1046158..1046422 FT /note="match to EST AA078427 (NID:g1838111)" FT repeat_region 1048360..1048504 FT /rpt_family="(CA)n" FT repeat_region 1048524..1048690 FT /rpt_family="(CA)n" FT misc_feature 1049586..1049719 FT /note="match to EST BF346362 (NID:g11293957)" FT misc_feature 1049586..1049779 FT /note="similar to Homo sapiens EST BE736728 FT (NID:g10150720)" FT /note="match to EST BF129057 (NID:g10968097)" FT /note="match to EST BG709625 (NID:g13988154)" FT /note="similar to Homo sapiens EST N30494 (NID:g1149014) FT yx48g05.r1" FT /note="match to EST BE903122 (NID:g10393986)" FT /note="match to EST BG773988 (NID:g14044287)" FT /note="match to EST AL536886 (NID:g12800379)" FT /note="match to EST BE906714 (NID:g10400057)" FT /note="match to EST BE896386 (NID:g10360735)" FT misc_feature 1049586..1049713 FT /note="match to EST BE902906 (NID:g10393555)" FT misc_feature 1049586..1049781 FT /note="match to EST BE254266 (NID:g9124692)" FT /note="match to EST AL529999 (NID:g12793492)" FT /note="match to EST BI254689 (NID:g14807357)" FT misc_feature 1049586..1049674 FT /note="match to EST BG329705 (NID:g13136143)" FT misc_feature 1049586..1049632 FT /note="match to EST AL566548 (NID:g12919014)" FT misc_feature 1049586..1049690 FT /note="match to EST BG744999 (NID:g14055652)" FT misc_feature 1049586..1049608 FT /note="match to EST AL529998 (NID:g12793491)" FT misc_feature 1049592..1049638 FT /note="match to EST BM011467 (NID:g16525821)" FT misc_feature 1049648..1049772 FT /note="match to EST H16643 (NID:g882883) ym26f04.r1" FT misc_feature 1049688..1050050 FT /note="match to EST AI568339 (NID:g4531713) tn68h11.x1" FT misc_feature 1049717..1049779 FT /note="match to EST BG337819 (NID:g13144355)" FT misc_feature 1049717 FT /note="match to EST BG329705 (NID:g13136143)" FT misc_feature 1049738..1049781 FT /note="match to EST AI823968 (NID:g5444639) wj29a02.x1" FT misc_feature 1049756..1049781 FT /note="match to EST BE902906 (NID:g10393555)" FT misc_feature 1050026..1050027 FT /note="match to EST BM011467 (NID:g16525821)" FT repeat_region 1050812..1050987 FT /rpt_family="(CA)n" FT repeat_region 1051045..1051220 FT /rpt_family="(CA)n" FT repeat_region 1051241..1051405 FT /rpt_family="(CA)n" FT misc_feature 1055076..1055428 FT /note="match to EST BF874857 (NID:g12264987)" FT repeat_region 1055707..1055879 FT /rpt_family="(CACAG)n" FT repeat_region 1055898..1056065 FT /rpt_family="(CACAG)n" FT repeat_region 1056029..1056201 FT /rpt_family="(CAGCG)n" FT repeat_region 1056099..1056272 FT /rpt_family="(CACAG)n" FT repeat_region 1056215..1056572 FT /rpt_family="(CAGCG)n" FT repeat_region 1056496..1056661 FT /rpt_family="(CACCG)n" FT misc_feature 1057550..1057975 FT /note="match to EST AI189552 (NID:g3740761) qd28a06.x1" FT repeat_region 1057904..1058015 FT /rpt_family="MER1_type" FT repeat_region 1058276..1058425 FT /rpt_family="Alu" FT repeat_region 1058591..1058847 FT /rpt_family="Alu" FT repeat_region 1062116..1062227 FT /rpt_family="L1" FT misc_feature 1062121..1062360 FT /note="match to EST N40045 (NID:g1163590) yw71h12.r1" FT misc_feature 1062179..1062658 FT /note="match to EST AI421412 (NID:g4267343) tf25f12.x1" FT misc_feature 1062718..1063142 FT /note="match to EST H28120 (NID:g898473) yo78b01.s1" FT misc_feature 1063114..1063120 FT /note="match to EST BG163420 (NID:g12670123)" FT misc_feature 1063143..1063999 FT /note="match to EST BG742732 (NID:g14053385)" FT repeat_region 1063261..1063314 FT /rpt_family="(CA)n" FT repeat_region 1063486..1063747 FT /rpt_family="Alu" FT misc_feature 1063669..1064051 FT /note="match to EST H14132 (NID:g878882) ym65c06.r1" FT repeat_region 1063749..1063830 FT /rpt_family="Alu" FT misc_feature 1064138..1064443 FT /note="match to EST AA215436 (NID:g1815162) zr95e01.s1" FT misc_feature 1064148..1064629 FT /note="match to EST BG056328 (NID:g12520693)" FT misc_feature 1064447..1064689 FT /note="match to EST AA215615 (NID:g1815359) zr95e01.r1" FT misc_feature 1064543..1064923 FT /note="similar to Homo sapiens EST H23521 (NID:g892216) FT ym53d03.r1" FT misc_feature 1064907..1065684 FT /note="match to EST BF791529 (NID:g12096583)" FT misc_feature 1064941 FT /note="similar to Homo sapiens EST H23521 (NID:g892216) FT ym53d03.r1" FT misc_feature 1065071..1065403 FT /note="match to EST BF800077 (NID:g12129066)" FT misc_feature 1065931..1066663 FT /note="match to EST BG831385 (NID:g14178972)" FT misc_feature 1066083..1066663 FT /note="match to EST BG831976 (NID:g14179563)" FT misc_feature 1066203..1066663 FT /note="similar to Homo sapiens EST BG830386 FT (NID:g14177973)" FT misc_feature 1066262..1066668 FT /note="match to EST BF508795 (NID:g11592093)" FT misc_feature 1066932..1068245 FT /note="CpG_island (%GC=74.5, o/e=0.70, #CpGs=142)" FT misc_feature 1067893..1067953 FT /note="match to EST BF346362 (NID:g11293957)" FT misc_feature 1067894..1068076 FT /note="similar to Homo sapiens EST BE736728 FT (NID:g10150720)" FT misc_feature 1067894..1068068 FT /note="match to EST BF129057 (NID:g10968097)" FT misc_feature 1067894..1067994 FT /note="match to EST BG709625 (NID:g13988154)" FT misc_feature 1067894..1067992 FT /note="match to EST BG337819 (NID:g13144355)" FT misc_feature 1067894..1067973 FT /note="similar to Homo sapiens EST N30494 (NID:g1149014) FT yx48g05.r1" FT misc_feature 1067894..1067986 FT /note="match to EST BG831976 (NID:g14179563)" FT misc_feature 1067894..1067989 FT /note="match to EST BG831385 (NID:g14178972)" FT /note="similar to Homo sapiens EST BG830386 FT (NID:g14177973)" FT misc_feature 1067894..1067987 FT /note="match to EST BE903122 (NID:g10393986)" FT misc_feature 1067894..1067969 FT /note="match to EST BG773988 (NID:g14044287)" FT misc_feature 1067894..1067966 FT /note="match to EST AL536886 (NID:g12800379)" FT misc_feature 1067894..1067951 FT /note="match to EST BE906714 (NID:g10400057)" FT misc_feature 1067894..1067948 FT /note="match to EST BE896386 (NID:g10360735)" FT repeat_region 1068010..1068030 FT /rpt_family="GC_rich" FT misc_feature 1068087..1068088 FT /note="match to EST BG709625 (NID:g13988154)" FT misc_feature 1068461..1068463 FT /note="match to EST BG831976 (NID:g14179563)" FT repeat_region 1068760..1069060 FT /rpt_family="Alu" FT repeat_region 1069061..1069199 FT /rpt_family="Alu" FT repeat_region 1071118..1071280 FT /rpt_family="(CAGGG)n" FT repeat_region 1071303..1071465 FT /rpt_family="(CAGGG)n" FT repeat_region 1072706..1072911 FT /rpt_family="L1" FT repeat_region 1072912..1073209 FT /rpt_family="Alu" FT repeat_region 1073210..1073323 FT /rpt_family="L1" FT repeat_region 1073523..1074148 FT /rpt_family="L1" FT misc_feature 1074041..1074374 FT /note="match to EST AA631891 (NID:g2554502) np69c11.s1" FT repeat_region 1074246..1074766 FT /rpt_family="L1" FT repeat_region 1074383..1074446 FT /rpt_family="C-rich" FT repeat_region 1074801..1074840 FT /rpt_family="L1" FT repeat_region 1074893..1075024 FT /rpt_family="L1" FT repeat_region 1075031..1075138 FT /rpt_family="L1" FT repeat_region 1075129..1075924 FT /rpt_family="L1" FT repeat_region 1076129..1076319 FT /rpt_family="L1" FT misc_feature 1076323..1076470 FT /note="match to EST BG943875 (NID:g14343247) ax43b06.x2" FT repeat_region 1076464..1076755 FT /rpt_family="Alu" FT repeat_region 1076760..1076887 FT /rpt_family="L1" FT repeat_region 1076933..1078061 FT /rpt_family="SVA" FT misc_feature 1077037..1079251 FT /note="CpG_island (%GC=76.3, o/e=0.80, #CpGs=178)" FT repeat_region 1078178..1078817 FT /rpt_family="SVA" FT repeat_region 1078835..1079828 FT /rpt_family="SVA" FT repeat_region 1079011..1079089 FT /rpt_family="GC_rich" FT repeat_region 1079820..1079840 FT /rpt_family="(A)n" FT repeat_region 1079829..1079844 FT /rpt_family="L1" FT repeat_region 1079845..1080159 FT /rpt_family="Alu" FT repeat_region 1080160..1080493 FT /rpt_family="L1" FT repeat_region 1082510..1082605 FT /rpt_family="MIR" FT repeat_region 1082606..1082875 FT /rpt_family="Alu" FT misc_feature 1082728..1082744 FT /note="match to EST AI139772 (NID:g3645744) qe02b07.x1" FT repeat_region 1082861..1082884 FT /rpt_family="AT_rich" FT repeat_region 1082876..1082897 FT /rpt_family="MIR" FT repeat_region 1082898..1083070 FT /rpt_family="MER2_type" FT repeat_region 1083071..1083152 FT /rpt_family="MIR" FT repeat_region 1084086..1084145 FT /rpt_family="G-rich" FT repeat_region 1084159..1084285 FT /rpt_family="GC_rich" FT misc_feature 1084215..1084294 FT /note="match to EST BI825260 (NID:g15936810)" FT repeat_region 1085205..1085273 FT /rpt_family="AcHobo" FT misc_feature 1085914..1086274 FT /note="match to EST BF724322 (NID:g12040231) bx03e07.y1" FT misc_feature 1086645..1087063 FT /note="match to EST R23291 (NID:g778179) yh28a06.r1" FT misc_feature 1086768..1087236 FT /note="match to EST AI566217 (NID:g4524669) tq69h09.x1" FT misc_feature 1086939..1087353 FT /note="similar to Homo sapiens EST AA203711 (NID:g1799438) FT zx52e09.r1" FT misc_feature 1087061..1087595 FT /note="similar to Homo sapiens EST H91962 (NID:g1087540) FT ys82b05.r1" FT misc_feature 1087198 FT /note="match to EST BE833296 (NID:g10265674)" FT misc_feature 1087216..1087523 FT /note="match to EST BE833296 (NID:g10265674)" FT misc_feature 1087464..1087589 FT /note="similar to Homo sapiens EST AA203711 (NID:g1799438) FT zx52e09.r1" FT repeat_region 1087601..1087846 FT /rpt_family="L2" FT misc_feature 1088086..1088304 FT /note="match to EST AI352061 (NID:g4089267) qq24e06.x1" FT misc_feature 1088543..1088817 FT /note="match to EST AW129621 (NID:g6117565) xe19h11.x1" FT repeat_region 1088979..1089185 FT /rpt_family="MIR" FT repeat_region 1091328..1091636 FT /rpt_family="Alu" FT repeat_region 1093183..1093488 FT /rpt_family="Alu" FT misc_feature 1094156..1094299 FT /note="match to EST AI905240 (NID:g6495627)" FT misc_feature 1095023..1095119 FT /note="match to EST BI818819 (NID:g15930369)" FT misc_feature 1095073..1095119 FT /note="match to EST BE731281 (NID:g10145273)" FT misc_feature 1097128..1097888 FT /note="match to EST BI825260 (NID:g15936810)" FT misc_feature 1097128..1097551 FT /note="match to EST BE731281 (NID:g10145273)" FT misc_feature 1097128..1097816 FT /note="match to EST BI818819 (NID:g15930369)" FT misc_feature 1097140..1097879 FT /note="match to EST BG326599 (NID:g13133036)" FT misc_feature 1097146..1097708 FT /note="similar to Mus musculus EST BB643707 FT (NID:g16478408)" FT misc_feature 1097458..1098057 FT /note="similar to Mus musculus EST AA189791 (NID:g1776377) FT mt91c04.r1" FT misc_feature 1097470..1098013 FT /note="match to EST BG570221 (NID:g13577874)" FT misc_feature 1097720..1098452 FT /note="match to EST BI489911 (NID:g15329139)" FT misc_feature 1097797..1098324 FT /note="similar to Mus musculus EST BB667360 FT (NID:g16398809)" FT misc_feature 1097939..1098836 FT /note="match to EST BI490558 (NID:g15329786)" FT misc_feature 1098055..1098056 FT /note="match to EST AA151242 (NID:g1719433) zl40f11.r1" FT misc_feature 1098333..1098884 FT /note="match to EST BE645027 (NID:g9969338)" FT misc_feature 1098412..1098866 FT /note="match to EST AA151242 (NID:g1719433) zl40f11.r1" FT misc_feature 1098554..1098897 FT /note="match to EST AI052606 (NID:g3308597) oz10b01.x1" FT repeat_region 1099124..1099299 FT /rpt_family="(CGGGG)n" FT repeat_region 1099474..1099650 FT /rpt_family="(CGGGG)n" FT misc_feature 1099684..1099928 FT /note="match to EST AA077217 (NID:g1836691)" FT repeat_region 1099856..1099975 FT /rpt_family="MER2_type" FT repeat_region 1102512..1102631 FT /rpt_family="(CCCTAA)n" FT repeat_region 1103102..1103180 FT /rpt_family="L1" FT repeat_region 1103725..1103797 FT /rpt_family="(CA)n" FT repeat_region 1104889..1105171 FT /rpt_family="L1" FT misc_feature 1105041..1105330 FT /note="match to EST AA076948 (NID:g1836422)" FT misc_feature 1105252..1105502 FT /note="match to EST H16643 (NID:g882883) ym26f04.r1" FT misc_feature 1106539..1106773 FT /note="match to EST AA077314 (NID:g1836788)" FT misc_feature 1106743..1106968 FT /note="similar to Homo sapiens EST AA078272 (NID:g1837746)" FT misc_feature 1106948..1107173 FT /note="match to EST AA077900 (NID:g1837374)" FT misc_feature 1107362..1107703 FT /note="match to EST BF820926 (NID:g12159772)" FT misc_feature 1107403..1107754 FT /note="match to EST BF946563 (NID:g12363838)" FT repeat_region 1108150..1108684 FT /rpt_family="ERV1" FT repeat_region 1108687..1108979 FT /rpt_family="Alu" FT repeat_region 1108983..1109038 FT /rpt_family="(TCTCCC)n" FT misc_feature 1109120..1110642 FT /note="CpG_island (%GC=65.7, o/e=0.70, #CpGs=122)" FT repeat_region 1110134..1110475 FT /rpt_family="(CA)n" FT repeat_region 1110277..1110348 FT /rpt_family="ERV1" FT repeat_region 1110507..1110666 FT /rpt_family="(CA)n" FT misc_feature 1110814..1111004 FT /note="match to EST AW615807 (NID:g7316505) ba16e02.x1" FT repeat_region 1112206..1112305 FT /rpt_family="L1" FT repeat_region 1112299..1112335 FT /rpt_family="(T)n" FT repeat_region 1112306..1112576 FT /rpt_family="Alu" FT repeat_region 1112577..1112656 FT /rpt_family="L1" FT misc_feature 1113226..1113997 FT /note="CpG_island (%GC=75.1, o/e=1.20, #CpGs=92)" FT repeat_region 1113288..1113455 FT /rpt_family="C-rich" FT repeat_region 1113477..1113700 FT /rpt_family="C-rich" FT repeat_region 1113722..1113898 FT /rpt_family="C-rich" FT misc_feature 1114086..1114410 FT /note="match to EST BI828786 (NID:g15940336)" FT repeat_region 1114868..1115190 FT /rpt_family="Alu" FT misc_feature 1115065..1115102 FT /note="similar to Homo sapiens EST AA863195 (NID:g2955674) FT og91g11.s1" FT repeat_region 1115191..1115244 FT /rpt_family="L1" FT misc_feature 1115243..1115258 FT /note="match to EST AI673074 (NID:g4852805) we60d05.x1" FT repeat_region 1115245..1115535 FT /rpt_family="Alu" FT repeat_region 1115536..1115646 FT /rpt_family="L1" FT misc_feature 1115577..1115847 FT /note="match to EST BI828786 (NID:g15940336)" FT repeat_region 1116787..1117090 FT /rpt_family="Alu" FT repeat_region 1117118..1117163 FT /rpt_family="Alu" FT misc_feature 1117400..1117672 FT /note="match to EST BI828786 (NID:g15940336)" FT misc_feature 1119025..1119253 FT /note="match to EST BF934217 (NID:g12351541)" FT repeat_region 1119748..1119977 FT /rpt_family="L1" FT misc_feature 1120499..1120559 FT /note="match to EST AA313701 (NID:g1966030)" FT misc_feature 1121077..1121082 FT /note="match to EST AW963147 (NID:g8152983)" FT misc_feature 1121574..1121814 FT /note="match to EST AA313701 (NID:g1966030)" FT repeat_region 1122979..1123292 FT /rpt_family="Alu" FT misc_feature 1123365..1123702 FT /note="match to EST BE184092 (NID:g8663276)" FT repeat_region 1124309..1124431 FT /rpt_family="MIR" FT misc_feature 1124519..1124749 FT /note="match to EST AA077819 (NID:g1837293)" FT misc_feature 1124556..1124842 FT /note="match to EST AA077351 (NID:g1836825)" FT repeat_region 1124992..1125195 FT /rpt_family="MIR" FT repeat_region 1125221..1125491 FT /rpt_family="Alu" FT misc_feature 1126767..1126880 FT /note="match to EST BI823199 (NID:g15934749)" FT misc_feature 1126773..1126778 FT /note="similar to Homo sapiens EST BE717607 FT (NID:g10105872)" FT misc_feature 1126775..1126880 FT /note="similar to Homo sapiens EST AL561148 FT (NID:g12908291)" FT /note="match to EST AL521050 (NID:g12784543)" FT repeat_region 1126955..1127276 FT /rpt_family="MER2_type" FT misc_feature 1127759..1127957 FT /note="match to EST AU076620 (NID:g7439067)" FT misc_feature 1127767..1127957 FT /note="match to EST BI820958 (NID:g15932508)" FT misc_feature 1127834..1127957 FT /note="match to EST BI823199 (NID:g15934749)" FT misc_feature 1128120..1128683 FT /note="match to EST BF920122 (NID:g12316010)" FT misc_feature 1128292..1128649 FT /note="match to EST AA906294 (NID:g3041417) oj98h05.s1" FT repeat_region 1129005..1129065 FT /rpt_family="Alu" FT repeat_region 1129098..1129338 FT /rpt_family="Alu" FT repeat_region 1129344..1129363 FT /rpt_family="(T)n" FT repeat_region 1129437..1129701 FT /rpt_family="Alu" FT repeat_region 1129826..1129903 FT /rpt_family="MER1_type" FT misc_feature 1130491..1130928 FT /note="match to EST AI670776 (NID:g4850507) tz10b01.x1" FT misc_feature 1130534..1130771 FT /note="match to EST AA077716 (NID:g1837190)" FT misc_feature 1131043..1131688 FT /note="match to EST BI820958 (NID:g15932508)" FT misc_feature 1131043..1131586 FT /note="match to EST BI823199 (NID:g15934749)" FT misc_feature 1131043..1131598 FT /note="match to EST AL521050 (NID:g12784543)" FT misc_feature 1131043..1131414 FT /note="match to EST AU076620 (NID:g7439067)" FT misc_feature 1131043..1131338 FT /note="similar to Homo sapiens EST AL561148 FT (NID:g12908291)" FT misc_feature 1131090..1131434 FT /note="match to EST BF511824 (NID:g11595122)" FT misc_feature 1131263..1132081 FT /note="match to EST BM016792 (NID:g16531146)" FT misc_feature 1131264..1131997 FT /note="match to EST BI259114 (NID:g14816133)" FT misc_feature 1131282..1131726 FT /note="match to EST BG337179 (NID:g13143617)" FT misc_feature 1131282..1131461 FT /note="similar to Homo sapiens EST BF237671 FT (NID:g11151589)" FT misc_feature 1131434..1131850 FT /note="similar to Mus musculus EST BI134865 FT (NID:g14585113)" FT misc_feature 1131541..1132311 FT /note="match to EST BG340203 (NID:g13146630)" FT misc_feature 1131675..1132024 FT /note="match to EST H14301 (NID:g879121) ym63c04.r1" FT misc_feature 1131805..1132462 FT /note="similar to Mus musculus EST BE533777 (NID:g9762422)" FT misc_feature 1132093 FT /note="match to EST BM016792 (NID:g16531146)" FT misc_feature 1132117..1132860 FT /note="match to EST BM016871 (NID:g16531225)" FT misc_feature 1132429 FT /note="match to EST BF511642 (NID:g11594940)" FT misc_feature 1132495..1132825 FT /note="match to EST BF511642 (NID:g11594940)" FT misc_feature 1132556..1132923 FT /note="match to EST R11954 (NID:g764689) yf54e03.r1" FT misc_feature 1132598..1132972 FT /note="match to EST R96674 (NID:g982334) yq55c03.r1" FT misc_feature 1132732..1133394 FT /note="match to EST AL561950 (NID:g12909888)" FT misc_feature 1132964..1133445 FT /note="match to EST AI934511 (NID:g5673471) wp58g08.x1" FT misc_feature 1133181..1133448 FT /note="match to EST BF941220 (NID:g12358540)" FT misc_feature 1133312..1133448 FT /note="match to EST BF511642 (NID:g11594940)" FT repeat_region 1135289..1135441 FT /rpt_family="MIR" FT repeat_region 1136826..1137742 FT /rpt_family="L1" FT repeat_region 1137896..1138154 FT /rpt_family="L1" FT repeat_region 1138341..1138642 FT /rpt_family="L1" FT repeat_region 1139509..1139940 FT /rpt_family="ERVL" FT repeat_region 1142224..1142433 FT /rpt_family="ERV1" FT misc_feature 1143455..1144044 FT /note="match to EST BE266114 (NID:g9139686)" FT misc_feature 1143887..1144300 FT /note="match to EST AI971778 (NID:g5768604) wv28b08.x1" FT repeat_region 1143920..1144043 FT /rpt_family="Alu" FT misc_feature 1144692..1145201 FT /note="match to EST AI655846 (NID:g4739825) tt40f04.x1" FT repeat_region 1145244..1145428 FT /rpt_family="Alu" FT misc_feature 1145367..1145705 FT /note="match to EST AA188970 (NID:g1775996) zq48f12.s1" FT repeat_region 1146228..1146371 FT /rpt_family="L2" FT misc_feature 1146351..1146670 FT /note="match to EST BG986175 (NID:g14390245)" FT repeat_region 1148532..1148820 FT /rpt_family="Alu" FT misc_feature 1149180..1150306 FT /note="CpG_island (%GC=67.7, o/e=0.70, #CpGs=90)" FT repeat_region 1150331..1150540 FT /rpt_family="L1" FT repeat_region 1150548..1150741 FT /rpt_family="Alu" FT misc_feature 1150720..1150878 FT /note="similar to Homo sapiens EST AA863195 (NID:g2955674) FT og91g11.s1" FT repeat_region 1150867..1150892 FT /rpt_family="AT_rich" FT repeat_region 1150979..1151152 FT /rpt_family="MER2_type" FT misc_feature 1151087..1151191 FT /note="similar to Homo sapiens EST BG285426 FT (NID:g13037371)" FT repeat_region 1151154..1151447 FT /rpt_family="Alu" FT misc_feature 1151224..1151607 FT /note="similar to Homo sapiens EST BG285426 FT (NID:g13037371)" FT misc_feature 1151659..1151901 FT /note="match to EST AA078159 (NID:g1837633)" FT repeat_region 1152353..1152609 FT /rpt_family="L1" FT repeat_region 1152632..1152816 FT /rpt_family="L1" FT repeat_region 1153196..1153425 FT /rpt_family="CR1" FT misc_feature 1155304..1157445 FT /note="CpG_island (%GC=57.3, o/e=1.00, #CpGs=153)" FT repeat_region 1157470..1157595 FT /rpt_family="Alu" FT repeat_region 1157852..1158314 FT /rpt_family="L1" FT repeat_region 1158315..1158450 FT /rpt_family="Alu" FT repeat_region 1158451..1158530 FT /rpt_family="L1" FT repeat_region 1158498..1158604 FT /rpt_family="L1" FT repeat_region 1158609..1158766 FT /rpt_family="Alu" FT repeat_region 1158777..1158938 FT /rpt_family="L1" FT repeat_region 1158939..1159004 FT /rpt_family="Alu" FT repeat_region 1159005..1159142 FT /rpt_family="L1" FT repeat_region 1159153..1159228 FT /rpt_family="L1" FT repeat_region 1159230..1159525 FT /rpt_family="Alu" FT misc_feature 1159288..1159294 FT /note="match to EST BG819268 (NID:g14166855)" FT repeat_region 1159527..1159840 FT /rpt_family="L1" FT repeat_region 1159842..1159946 FT /rpt_family="L1" FT repeat_region 1159947..1160228 FT /rpt_family="Alu" FT repeat_region 1160229..1160449 FT /rpt_family="L1" FT misc_feature 1160467..1160672 FT /note="match to EST AA679942 (NID:g2656409) ac85h02.s1" FT misc_feature 1163234..1163377 FT /note="match to EST AV728629 (NID:g10838050)" FT misc_feature 1163362..1163596 FT /note="match to EST AA076752 (NID:g1836436)" FT misc_feature 1163382..1163972 FT /note="similar to Homo sapiens EST BF855069 FT (NID:g12242813)" FT misc_feature 1163432..1163656 FT /note="match to EST AV728629 (NID:g10838050)" FT repeat_region 1164187..1164362 FT /rpt_family="L1" FT misc_feature 1164382..1164395 FT /note="match to EST BF941220 (NID:g12358540)" FT repeat_region 1164938..1165098 FT /rpt_family="MER1_type" FT misc_feature 1165020..1165478 FT /note="match to EST BF801526 (NID:g12130515)" FT repeat_region 1165225..1165711 FT /rpt_family="MER1_type" FT repeat_region 1165716..1166025 FT /rpt_family="Alu" FT repeat_region 1166033..1166332 FT /rpt_family="Alu" FT misc_feature 1166888..1167022 FT /note="match to EST BG752653 (NID:g14063306)" FT repeat_region 1167221..1167327 FT /rpt_family="Alu" FT misc_feature 1167296..1169103 FT /note="CpG_island (%GC=67.8, o/e=0.80, #CpGs=148)" FT repeat_region 1167354..1167419 FT /rpt_family="Alu" FT repeat_region 1167400..1167465 FT /rpt_family="Alu" FT repeat_region 1167446..1167511 FT /rpt_family="Alu" FT repeat_region 1167492..1167557 FT /rpt_family="Alu" FT repeat_region 1167538..1167605 FT /rpt_family="Alu" FT repeat_region 1167579..1167651 FT /rpt_family="Alu" FT repeat_region 1167632..1167697 FT /rpt_family="Alu" FT repeat_region 1167678..1167743 FT /rpt_family="Alu" FT repeat_region 1167724..1167789 FT /rpt_family="Alu" FT repeat_region 1167770..1167835 FT /rpt_family="Alu" FT repeat_region 1167816..1167881 FT /rpt_family="Alu" FT repeat_region 1167862..1167927 FT /rpt_family="Alu" FT repeat_region 1167908..1167973 FT /rpt_family="Alu" FT repeat_region 1167954..1168019 FT /rpt_family="Alu" FT repeat_region 1168000..1168065 FT /rpt_family="Alu" FT repeat_region 1168046..1168111 FT /rpt_family="Alu" FT repeat_region 1168092..1168157 FT /rpt_family="Alu" FT repeat_region 1168138..1168203 FT /rpt_family="Alu" FT repeat_region 1168184..1168249 FT /rpt_family="Alu" FT repeat_region 1168230..1168295 FT /rpt_family="Alu" FT repeat_region 1168276..1168341 FT /rpt_family="Alu" FT repeat_region 1168322..1168389 FT /rpt_family="Alu" FT repeat_region 1168363..1168437 FT /rpt_family="Alu" FT repeat_region 1168411..1168485 FT /rpt_family="Alu" FT repeat_region 1168459..1168531 FT /rpt_family="Alu" FT repeat_region 1168515..1168579 FT /rpt_family="Alu" FT repeat_region 1168553..1168627 FT /rpt_family="Alu" FT repeat_region 1168601..1168673 FT /rpt_family="Alu" FT repeat_region 1168654..1168719 FT /rpt_family="Alu" FT repeat_region 1168703..1168740 FT /rpt_family="Alu" FT repeat_region 1168746..1168811 FT /rpt_family="Alu" FT repeat_region 1168792..1168857 FT /rpt_family="Alu" FT repeat_region 1168838..1168903 FT /rpt_family="Alu" FT repeat_region 1168884..1168949 FT /rpt_family="Alu" FT repeat_region 1168930..1168995 FT /rpt_family="Alu" FT repeat_region 1168976..1169041 FT /rpt_family="Alu" FT repeat_region 1169022..1169087 FT /rpt_family="Alu" FT repeat_region 1169068..1169108 FT /rpt_family="Alu" FT repeat_region 1169109..1169378 FT /rpt_family="Alu" FT repeat_region 1170144..1170278 FT /rpt_family="C-rich" FT repeat_region 1170339..1170366 FT /rpt_family="GC_rich" FT repeat_region 1170544..1170853 FT /rpt_family="Alu" FT repeat_region 1170915..1170985 FT /rpt_family="L1" FT misc_feature 1170957..1171331 FT /note="match to EST AW084517 (NID:g6039669) wz24h07.x1" FT repeat_region 1171555..1171901 FT /rpt_family="L1" FT repeat_region 1171902..1172042 FT /rpt_family="Alu" FT repeat_region 1172047..1172354 FT /rpt_family="Alu" FT misc_feature 1172335..1172352 FT /note="match to EST AW084517 (NID:g6039669) wz24h07.x1" FT repeat_region 1172356..1172581 FT /rpt_family="L1" FT repeat_region 1172580..1173031 FT /rpt_family="L1" FT misc_feature 1173036..1173049 FT /note="match to EST AI655846 (NID:g4739825) tt40f04.x1" FT repeat_region 1173105..1173402 FT /rpt_family="Alu" FT repeat_region 1173486..1173732 FT /rpt_family="Alu" FT repeat_region 1173735..1173757 FT /rpt_family="AT_rich" FT repeat_region 1173758..1173914 FT /rpt_family="Alu" FT repeat_region 1173928..1174220 FT /rpt_family="Alu" FT repeat_region 1174223..1174541 FT /rpt_family="Alu" FT repeat_region 1174542..1174981 FT /rpt_family="L2" FT repeat_region 1174982..1175035 FT /rpt_family="(CATATA)n" FT repeat_region 1175037..1175120 FT /rpt_family="L1" FT repeat_region 1175121..1175408 FT /rpt_family="Alu" FT repeat_region 1175409..1175429 FT /rpt_family="(TA)n" FT repeat_region 1175430..1176359 FT /rpt_family="L1" FT repeat_region 1176360..1176878 FT /rpt_family="L2" FT repeat_region 1176886..1177105 FT /rpt_family="L2" FT repeat_region 1177154..1177462 FT /rpt_family="Alu" FT repeat_region 1177624..1177724 FT /rpt_family="(CCGCG)n" FT misc_feature 1177825..1177894 FT /note="match to EST BG752653 (NID:g14063306)" FT repeat_region 1178364..1178683 FT /rpt_family="Alu" FT repeat_region 1178684..1178852 FT /rpt_family="Alu" FT repeat_region 1178976..1179452 FT /rpt_family="MaLR" FT repeat_region 1179455..1179757 FT /rpt_family="Alu" FT repeat_region 1179767..1180059 FT /rpt_family="Alu" FT repeat_region 1180087..1180446 FT /rpt_family="MaLR" FT misc_feature 1180370..1180814 FT /note="match to EST AI142434 (NID:g3658793) qb27b03.x1" FT repeat_region 1180453..1180615 FT /rpt_family="L1" FT repeat_region 1180820..1181063 FT /rpt_family="L1" FT repeat_region 1181162..1181450 FT /rpt_family="Alu" FT repeat_region 1182282..1182580 FT /rpt_family="Alu" FT repeat_region 1182791..1183100 FT /rpt_family="Alu" FT repeat_region 1183335..1183631 FT /rpt_family="Alu" FT repeat_region 1184342..1184641 FT /rpt_family="Alu" FT repeat_region 1184771..1185063 FT /rpt_family="Alu" FT repeat_region 1185075..1185109 FT /rpt_family="(T)n" FT repeat_region 1185116..1186089 FT /rpt_family="SVA" FT misc_feature 1185645..1187491 FT /note="CpG_island (%GC=74.6, o/e=0.70, #CpGs=144)" FT repeat_region 1186109..1186695 FT /rpt_family="SVA" FT repeat_region 1186755..1187587 FT /rpt_family="SVA" FT repeat_region 1187588..1187654 FT /rpt_family="(GGGAGA)n" FT repeat_region 1187784..1187919 FT /rpt_family="MER1_type" FT repeat_region 1188005..1188065 FT /rpt_family="MER2_type" FT repeat_region 1188168..1188451 FT /rpt_family="Alu" FT misc_feature 1188457..1188475 FT /note="similar to Homo sapiens EST BG285426 FT (NID:g13037371)" FT repeat_region 1188465..1188732 FT /rpt_family="Alu" FT misc_feature 1188498..1189080 FT /note="match to EST AA180893 (NID:g1764369) zp41g01.s1" FT repeat_region 1188984..1189149 FT /rpt_family="MER1_type" FT repeat_region 1189204..1189409 FT /rpt_family="MER2_type" FT misc_feature 1189490..1189520 FT /note="similar to Homo sapiens EST BG285426 FT (NID:g13037371)" FT repeat_region 1189490..1189716 FT /rpt_family="Alu" FT repeat_region 1189719..1189771 FT /rpt_family="L1" FT repeat_region 1189796..1189873 FT /rpt_family="MER2_type" FT misc_feature 1190050..1190376 FT /note="match to EST T08493 (NID:g389521)" FT misc_feature 1190518..1190542 FT /note="similar to Homo sapiens EST BG285426 FT (NID:g13037371)" FT repeat_region 1190524..1190823 FT /rpt_family="Alu" FT repeat_region 1191088..1191176 FT /rpt_family="Alu" FT repeat_region 1191221..1191415 FT /rpt_family="Alu" FT repeat_region 1192155..1192535 FT /rpt_family="MaLR" FT misc_feature 1192538..1192860 FT /note="match to EST AI673074 (NID:g4852805) we60d05.x1" FT misc_feature 1192543..1192860 FT /note="match to EST AI435373 (NID:g4302729) th77g03.x1" FT /note="match to EST BG113548 (NID:g12607054)" FT misc_feature 1192543..1192859 FT /note="match to EST BF437234 (NID:g11449567)" FT misc_feature 1192544..1192860 FT /note="match to EST AI659863 (NID:g4763433) tu18h08.x1" FT misc_feature 1192547..1192877 FT /note="match to EST BG163433 (NID:g12670136)" FT misc_feature 1192595..1192862 FT /note="match to EST AW580416 (NID:g7255465)" FT misc_feature 1192608..1192860 FT /note="match to EST BI551418 (NID:g15438730)" FT misc_feature 1192672..1192877 FT /note="match to EST BG176749 (NID:g12683452)" FT misc_feature 1192743..1192860 FT /note="match to EST AI338453 (NID:g4075380) qq92c11.x1" FT misc_feature 1192751..1193006 FT /note="similar to Homo sapiens EST BF089992 FT (NID:g10895702)" FT repeat_region 1192891..1193171 FT /rpt_family="Alu" FT repeat_region 1193299..1193599 FT /rpt_family="Alu" FT repeat_region 1193820..1193839 FT /rpt_family="(T)n" FT misc_feature 1193840..1194261 FT /note="match to EST AI079500 (NID:g3415751) oy95e08.x1" FT misc_feature 1194018..1194590 FT /note="match to EST AW963147 (NID:g8152983)" FT repeat_region 1194474..1194786 FT /rpt_family="Alu" FT misc_feature 1194494..1195216 FT /note="match to EST BG819268 (NID:g14166855)" FT misc_feature 1195089..1195220 FT /note="match to EST AI659863 (NID:g4763433) tu18h08.x1" FT /note="match to EST BI551418 (NID:g15438730)" FT /note="match to EST BG176749 (NID:g12683452)" FT /note="match to EST BG113548 (NID:g12607054)" FT /note="match to EST AI338453 (NID:g4075380) qq92c11.x1" FT /note="match to EST AI673074 (NID:g4852805) we60d05.x1" FT misc_feature 1195089..1195222 FT /note="match to EST BG163433 (NID:g12670136)" FT misc_feature 1195089..1195215 FT /note="match to EST AI435373 (NID:g4302729) th77g03.x1" FT misc_feature 1195109..1195220 FT /note="similar to Homo sapiens EST BE717607 FT (NID:g10105872)" FT misc_feature 1195129..1195220 FT /note="match to EST AW366251 (NID:g6870901)" FT repeat_region 1197139..1197245 FT /rpt_family="MER1_type" FT misc_feature 1197292..1197338 FT /note="similar to Homo sapiens EST BE717607 FT (NID:g10105872)" FT misc_feature 1197292..1197386 FT /note="match to EST BI551418 (NID:g15438730)" FT /note="match to EST BG176749 (NID:g12683452)" FT /note="match to EST AI338453 (NID:g4075380) qq92c11.x1" FT /note="match to EST AW366251 (NID:g6870901)" FT /note="match to EST AI659863 (NID:g4763433) tu18h08.x1" FT misc_feature 1197292..1197383 FT /note="match to EST AI673074 (NID:g4852805) we60d05.x1" FT misc_feature 1197364..1197386 FT /note="match to EST BG108788 (NID:g14277485)" FT misc_feature 1197794..1197893 FT /note="match to EST BI551418 (NID:g15438730)" FT /note="match to EST BG176749 (NID:g12683452)" FT /note="match to EST BG108788 (NID:g14277485)" FT misc_feature 1197794..1197830 FT /note="match to EST AI338453 (NID:g4075380) qq92c11.x1" FT misc_feature 1197794..1197834 FT /note="match to EST AW366251 (NID:g6870901)" FT misc_feature 1197794..1197845 FT /note="match to EST AI659863 (NID:g4763433) tu18h08.x1" FT repeat_region 1198834..1198882 FT /rpt_family="L2" FT misc_feature 1198966..1200219 FT /note="CpG_island (%GC=72.6, o/e=0.80, #CpGs=120)" FT misc_feature 1199600..1199802 FT /note="match to EST BI551418 (NID:g15438730)" FT misc_feature 1199600..1199789 FT /note="match to EST BG176749 (NID:g12683452)" FT misc_feature 1199600..1199783 FT /note="match to EST BG108788 (NID:g14277485)" FT misc_feature 1199600..1199762 FT /note="match to EST BG113548 (NID:g12607054)" FT misc_feature 1199852..1200180 FT /note="match to EST AI184941 (NID:g3735579) ok28d12.x1" FT repeat_region 1199944..1199973 FT /rpt_family="GC_rich" FT misc_feature 1200010..1200259 FT /note="match to EST BG478902 (NID:g13411181)" FT misc_feature 1200030..1200259 FT /note="match to EST BF026578 (NID:g10734290)" FT /note="similar to Homo sapiens EST BE729722 FT (NID:g10143714)" FT misc_feature 1200093..1200423 FT /note="match to EST BG569629 (NID:g13577282)" FT repeat_region 1200173..1200211 FT /rpt_family="GC_rich" FT misc_feature 1200229..1200259 FT /note="match to EST C17637 (NID:g1579240)" FT repeat_region 1200251..1200338 FT /rpt_family="L1" FT repeat_region 1200482..1200573 FT /rpt_family="Alu" FT misc_feature 1200546 FT /note="match to EST BG108788 (NID:g14277485)" FT repeat_region 1200576..1200643 FT /rpt_family="Alu" FT repeat_region 1200644..1201076 FT /rpt_family="ERV1" FT repeat_region 1201077..1201260 FT /rpt_family="Alu" FT repeat_region 1201261..1201345 FT /rpt_family="ERVK" FT repeat_region 1201346..1201658 FT /rpt_family="Alu" FT repeat_region 1201659..1201954 FT /rpt_family="Alu" FT repeat_region 1201955..1202212 FT /rpt_family="ERVK" FT repeat_region 1202213..1202507 FT /rpt_family="Alu" FT repeat_region 1202508..1202796 FT /rpt_family="ERVK" FT repeat_region 1202877..1203116 FT /rpt_family="MER2_type" FT misc_feature 1203088..1203131 FT /note="match to EST C17637 (NID:g1579240)" FT /note="match to EST BF026578 (NID:g10734290)" FT /note="similar to Homo sapiens EST BE729722 FT (NID:g10143714)" FT /note="match to EST BG478902 (NID:g13411181)" FT repeat_region 1203126..1203415 FT /rpt_family="Alu" FT repeat_region 1203416..1203593 FT /rpt_family="Alu" FT repeat_region 1203625..1203747 FT /rpt_family="Alu" FT misc_feature 1203797..1204300 FT /note="similar to Homo sapiens EST BE729722 FT (NID:g10143714)" FT misc_feature 1203797..1204057 FT /note="match to EST BG478902 (NID:g13411181)" FT misc_feature 1203797..1204019 FT /note="match to EST C17637 (NID:g1579240)" FT misc_feature 1203797..1204270 FT /note="match to EST BF026578 (NID:g10734290)" FT repeat_region 1203905..1204105 FT /rpt_family="L1" FT repeat_region 1204112..1204643 FT /rpt_family="ERVL" FT repeat_region 1204661..1205126 FT /rpt_family="L1" FT repeat_region 1205127..1205435 FT /rpt_family="Alu" FT repeat_region 1205436..1205720 FT /rpt_family="L1" FT repeat_region 1205721..1206030 FT /rpt_family="Alu" FT repeat_region 1206325..1206629 FT /rpt_family="Alu" FT misc_feature 1206614..1206627 FT /note="match to EST BF511642 (NID:g11594940)" FT repeat_region 1206703..1206759 FT /rpt_family="MIR" FT repeat_region 1206960..1207266 FT /rpt_family="Alu" FT repeat_region 1207268..1207403 FT /rpt_family="Alu" FT repeat_region 1207488..1207613 FT /rpt_family="AcHobo" FT repeat_region 1207637..1207930 FT /rpt_family="Alu" FT repeat_region 1208133..1208213 FT /rpt_family="MaLR" FT repeat_region 1208450..1208761 FT /rpt_family="Alu" FT misc_feature 1208930..1209622 FT /note="match to EST BF032715 (NID:g10740427)" FT repeat_region 1209009..1209224 FT /rpt_family="L2" FT repeat_region 1209286..1209413 FT /rpt_family="Alu" FT repeat_region 1210044..1210112 FT /rpt_family="(TA)n" FT repeat_region 1210123..1210430 FT /rpt_family="Alu" FT repeat_region 1211035..1211372 FT /rpt_family="ERV1" FT repeat_region 1211508..1211606 FT /rpt_family="ERV1" FT misc_feature 1211602..1211605 FT /note="match to EST BF026578 (NID:g10734290)" FT repeat_region 1211607..1211712 FT /rpt_family="ERV1" FT repeat_region 1213206..1213511 FT /rpt_family="Alu" FT misc_feature 1213333..1213455 FT /note="similar to Homo sapiens EST BF089992 FT (NID:g10895702)" FT repeat_region 1214224..1214536 FT /rpt_family="Alu" FT repeat_region 1214537..1214619 FT /rpt_family="ERV1" FT repeat_region 1215301..1215463 FT /rpt_family="Alu" FT repeat_region 1215464..1215926 FT /rpt_family="ERVL" FT repeat_region 1216140..1216343 FT /rpt_family="ERVL" FT repeat_region 1216716..1216799 FT /rpt_family="Alu" FT repeat_region 1217033..1217054 FT /rpt_family="AT_rich" FT repeat_region 1217030..1217340 FT /rpt_family="Alu" FT repeat_region 1217359..1217685 FT /rpt_family="Alu" FT repeat_region 1217686..1218195 FT /rpt_family="L1" FT repeat_region 1218224..1218356 FT /rpt_family="Alu" FT repeat_region 1218360..1218533 FT /rpt_family="L1" FT repeat_region 1218547..1218568 FT /rpt_family="(TTTAA)n" FT repeat_region 1218569..1218855 FT /rpt_family="Alu" FT repeat_region 1218868..1219090 FT /rpt_family="L1" FT repeat_region 1219262..1219404 FT /rpt_family="ERVL" FT repeat_region 1219405..1219701 FT /rpt_family="Alu" FT repeat_region 1219702..1219792 FT /rpt_family="ERVL" FT repeat_region 1221385..1221680 FT /rpt_family="L1" FT repeat_region 1221685..1221897 FT /rpt_family="Alu" FT repeat_region 1221901..1222018 FT /rpt_family="L1" FT repeat_region 1222019..1222357 FT /rpt_family="Alu" FT repeat_region 1222898..1223207 FT /rpt_family="Alu" FT repeat_region 1223460..1223758 FT /rpt_family="Alu" FT repeat_region 1223763..1224063 FT /rpt_family="Alu" FT repeat_region 1224065..1224202 FT /rpt_family="Alu" FT repeat_region 1224209..1224329 FT /rpt_family="L1" FT repeat_region 1224335..1224515 FT /rpt_family="Alu" FT repeat_region 1224516..1224774 FT /rpt_family="Alu" FT repeat_region 1224775..1224819 FT /rpt_family="Alu" FT repeat_region 1224821..1224928 FT /rpt_family="L1" FT repeat_region 1225640..1225948 FT /rpt_family="Alu" FT repeat_region 1226450..1226751 FT /rpt_family="Alu" FT repeat_region 1226947..1227104 FT /rpt_family="L1" FT repeat_region 1227119..1227415 FT /rpt_family="Alu" FT repeat_region 1227440..1227748 FT /rpt_family="Alu" FT repeat_region 1227803..1228114 FT /rpt_family="Alu" FT repeat_region 1228281..1228317 FT /rpt_family="(CCCTAA)n" FT repeat_region 1228324..1228405 FT /rpt_family="Alu" FT repeat_region 1228407..1228586 FT /rpt_family="GA-rich" FT repeat_region 1228602..1228780 FT /rpt_family="(GGA)n" FT repeat_region 1228938..1229249 FT /rpt_family="Alu" FT repeat_region 1230415..1230714 FT /rpt_family="Alu" FT repeat_region 1230964..1231074 FT /rpt_family="MER1_type" FT repeat_region 1231075..1231371 FT /rpt_family="Alu" FT repeat_region 1231372..1231797 FT /rpt_family="MER1_type" FT repeat_region 1231920..1232130 FT /rpt_family="L2" FT repeat_region 1232311..1232629 FT /rpt_family="Alu" FT repeat_region 1232632..1232881 FT /rpt_family="Alu" FT repeat_region 1232895..1233071 FT /rpt_family="Alu" FT repeat_region 1233316..1233441 FT /rpt_family="MIR" FT repeat_region 1234279..1234585 FT /rpt_family="Alu" FT repeat_region 1234605..1234902 FT /rpt_family="Alu" FT repeat_region 1235019..1235113 FT /rpt_family="MIR" FT repeat_region 1235268..1235549 FT /rpt_family="Alu" FT repeat_region 1235562..1235613 FT /rpt_family="(CA)n" FT repeat_region 1236117..1236275 FT /rpt_family="G-rich" FT repeat_region 1236296..1236452 FT /rpt_family="G-rich" FT repeat_region 1236627..1236936 FT /rpt_family="Alu" FT repeat_region 1236997..1237211 FT /rpt_family="L2" FT repeat_region 1237347..1237663 FT /rpt_family="Alu" FT repeat_region 1238238..1238397 FT /rpt_family="Alu" FT repeat_region 1238399..1238410 FT /rpt_family="Alu" FT repeat_region 1238411..1238493 FT /rpt_family="(TCTA)n" FT repeat_region 1238494..1238779 FT /rpt_family="Alu" FT repeat_region 1238792..1239081 FT /rpt_family="Alu" FT repeat_region 1239112..1239258 FT /rpt_family="Alu" FT repeat_region 1239267..1239535 FT /rpt_family="Alu" FT repeat_region 1239536..1239557 FT /rpt_family="(CAAT)n" FT repeat_region 1239558..1239570 FT /rpt_family="Alu" FT repeat_region 1240185..1240474 FT /rpt_family="Alu" FT repeat_region 1240477..1240788 FT /rpt_family="Alu" FT repeat_region 1240960..1241694 FT /rpt_family="ERV1" FT repeat_region 1241980..1242286 FT /rpt_family="Alu" FT repeat_region 1242294..1242602 FT /rpt_family="Alu" FT repeat_region 1242603..1242659 FT /rpt_family="Alu" FT repeat_region 1242660..1242883 FT /rpt_family="Alu" FT repeat_region 1243174..1243485 FT /rpt_family="Alu" FT repeat_region 1243843..1244143 FT /rpt_family="Alu" FT repeat_region 1244321..1244392 FT /rpt_family="(TG)n" FT repeat_region 1244863..1245040 FT /rpt_family="Alu" FT repeat_region 1245041..1245220 FT /rpt_family="Alu" FT repeat_region 1245221..1245512 FT /rpt_family="Alu" FT repeat_region 1245513..1245658 FT /rpt_family="Alu" FT repeat_region 1245769..1245924 FT /rpt_family="MER1_type" FT repeat_region 1246031..1246183 FT /rpt_family="L1" FT repeat_region 1246364..1246596 FT /rpt_family="MER2_type" FT repeat_region 1246606..1246902 FT /rpt_family="Alu" FT repeat_region 1246914..1247111 FT /rpt_family="Alu" FT repeat_region 1247259..1247428 FT /rpt_family="Alu" FT repeat_region 1247429..1247755 FT /rpt_family="Alu" FT repeat_region 1247756..1247885 FT /rpt_family="Alu" FT repeat_region 1247967..1248276 FT /rpt_family="Alu" FT repeat_region 1248366..1248643 FT /rpt_family="Alu" FT repeat_region 1248676..1248817 FT /rpt_family="Alu" FT repeat_region 1248823..1249062 FT /rpt_family="L1" FT repeat_region 1249065..1249180 FT /rpt_family="L1" FT repeat_region 1249456..1249801 FT /rpt_family="Alu" FT repeat_region 1249802..1249974 FT /rpt_family="Alu" FT misc_feature 1250827..1251141 FT /note="CpG_island (%GC=69.5, o/e=0.67, #CpGs=26)" FT repeat_region 1251583..1251884 FT /rpt_family="Alu" FT repeat_region 1251888..1252199 FT /rpt_family="Alu" FT repeat_region 1252202..1252255 FT /rpt_family="L1" FT repeat_region 1252852..1253137 FT /rpt_family="Alu" FT repeat_region 1253140..1253520 FT /rpt_family="Alu" FT repeat_region 1253708..1254003 FT /rpt_family="Alu" FT repeat_region 1254773..1254825 FT /rpt_family="L1" FT repeat_region 1254823..1254932 FT /rpt_family="L1" FT repeat_region 1254940..1255199 FT /rpt_family="Alu" FT repeat_region 1255200..1255512 FT /rpt_family="Alu" FT repeat_region 1255534..1255736 FT /rpt_family="L1" FT repeat_region 1255737..1256029 FT /rpt_family="Alu" FT repeat_region 1256030..1256212 FT /rpt_family="L1" FT repeat_region 1256268..1256578 FT /rpt_family="Alu" FT repeat_region 1256582..1256990 FT /rpt_family="L1" FT repeat_region 1257024..1257167 FT /rpt_family="Alu" FT repeat_region 1257168..1257227 FT /rpt_family="AT_rich" FT repeat_region 1257228..1257503 FT /rpt_family="Alu" FT repeat_region 1258028..1258123 FT /rpt_family="Alu" FT repeat_region 1258976..1259269 FT /rpt_family="Alu" FT repeat_region 1260326..1260629 FT /rpt_family="Alu" FT repeat_region 1261151..1261390 FT /rpt_family="L1" FT repeat_region 1261399..1261679 FT /rpt_family="Alu" FT repeat_region 1261937..1262232 FT /rpt_family="Alu" FT repeat_region 1262284..1262597 FT /rpt_family="Alu" FT misc_feature 1263497..1264390 FT /note="CpG_island (%GC=69.6, o/e=0.83, #CpGs=90)" FT repeat_region 1263982..1264011 FT /rpt_family="(CCGGG)n" FT repeat_region 1264455..1264508 FT /rpt_family="(TGAA)n" FT repeat_region 1264593..1264666 FT /rpt_family="(TGAA)n" FT repeat_region 1264748..1264804 FT /rpt_family="(TGAA)n" FT repeat_region 1264885..1264938 FT /rpt_family="(TGAA)n" FT repeat_region 1265005..1265035 FT /rpt_family="(GGGA)n" FT repeat_region 1265031..1265084 FT /rpt_family="(TGAA)n" FT misc_feature 1265112..1265725 FT /note="CpG_island (%GC=58.1, o/e=0.84, #CpGs=51)" FT repeat_region 1265640..1265684 FT /rpt_family="GC_rich" FT misc_feature 1269166..1282864 FT /note="CpG_island (%GC=61.9, o/e=0.76, #CpGs=1051)" FT repeat_region 1269836..1269938 FT /rpt_family="G-rich" FT repeat_region 1271877..1271908 FT /rpt_family="(TCC)n" FT repeat_region 1272152..1272202 FT /rpt_family="GC_rich" FT repeat_region 1272279..1272304 FT /rpt_family="(TCCC)n" FT repeat_region 1272561..1272638 FT /rpt_family="C-rich" FT repeat_region 1275752..1275837 FT /rpt_family="GC_rich" FT repeat_region 1276067..1276087 FT /rpt_family="(CCG)n" FT repeat_region 1276241..1276276 FT /rpt_family="GC_rich" FT repeat_region 1276303..1276323 FT /rpt_family="GC_rich" FT repeat_region 1276363..1276393 FT /rpt_family="GC_rich" FT repeat_region 1276427..1276507 FT /rpt_family="GC_rich" FT repeat_region 1276712..1276755 FT /rpt_family="T-rich" FT repeat_region 1277190..1277262 FT /rpt_family="(CG)n" FT repeat_region 1279389..1279457 FT /rpt_family="GA-rich" FT repeat_region 1282547..1282608 FT /rpt_family="MIR" FT misc_feature 1283840..1284040 FT /note="CpG_island (%GC=61.7, o/e=0.88, #CpGs=15)" FT misc_feature 1286023..1287658 FT /note="CpG_island (%GC=69.7, o/e=0.86, #CpGs=160)" FT repeat_region 1286568..1286595 FT /rpt_family="(TTTA)n" FT repeat_region 1287675..1287736 FT /rpt_family="A-rich" FT repeat_region 1288443..1288651 FT /rpt_family="ERVL" FT repeat_region 1289169..1289219 FT /rpt_family="C-rich" FT repeat_region 1290071..1290365 FT /rpt_family="Alu" FT repeat_region 1290837..1291216 FT /rpt_family="MaLR" FT repeat_region 1291931..1292012 FT /rpt_family="G-rich" FT repeat_region 1294383..1294500 FT /rpt_family="MIR" FT misc_feature 1295706..1295920 FT /note="CpG_island (%GC=69.8, o/e=0.81, #CpGs=17)" FT repeat_region 1295746..1296180 FT /rpt_family="L2" FT repeat_region 1296679..1296743 FT /rpt_family="MIR" FT repeat_region 1297324..1297349 FT /rpt_family="AT_rich" FT repeat_region 1297947..1298094 FT /rpt_family="Alu" FT repeat_region 1298144..1298363 FT /rpt_family="Alu" FT repeat_region 1298408..1298566 FT /rpt_family="Alu" FT repeat_region 1298567..1298865 FT /rpt_family="Alu" FT repeat_region 1298866..1298890 FT /rpt_family="Alu" FT repeat_region 1298892..1299070 FT /rpt_family="Alu" FT repeat_region 1300808..1300969 FT /rpt_family="(GGATG)n" FT repeat_region 1300983..1301299 FT /rpt_family="(GGATG)n" FT repeat_region 1301524..1301630 FT /rpt_family="(TCCA)n" FT repeat_region 1301637..1301698 FT /rpt_family="L2" FT repeat_region 1301699..1302008 FT /rpt_family="Alu" FT repeat_region 1302355..1302484 FT /rpt_family="MER1_type" FT repeat_region 1302491..1302587 FT /rpt_family="L1" FT repeat_region 1302717..1303017 FT /rpt_family="Alu" FT repeat_region 1304451..1304582 FT /rpt_family="MIR" FT repeat_region 1304816..1305049 FT /rpt_family="L2" FT repeat_region 1305617..1305905 FT /rpt_family="(GGTTG)n" FT repeat_region 1307559..1307818 FT /rpt_family="Alu" FT repeat_region 1310667..1310761 FT /rpt_family="MIR" FT repeat_region 1310907..1311209 FT /rpt_family="Alu" FT repeat_region 1312785..1312962 FT /rpt_family="G-rich" FT repeat_region 1313021..1313199 FT /rpt_family="G-rich" FT repeat_region 1313222..1313400 FT /rpt_family="G-rich" FT repeat_region 1313433..1313609 FT /rpt_family="(GGGTG)n" FT repeat_region 1313490..1313843 FT /rpt_family="G-rich" FT misc_feature 1315051..1315947 FT /note="CpG_island (%GC=60.6, o/e=0.74, #CpGs=62)" FT repeat_region 1316224..1316468 FT /rpt_family="L1" FT repeat_region 1316677..1316995 FT /rpt_family="CT-rich" FT repeat_region 1317105..1317182 FT /rpt_family="L1" FT repeat_region 1317287..1317691 FT /rpt_family="L1" FT repeat_region 1317692..1317810 FT /rpt_family="Alu" FT repeat_region 1317811..1317833 FT /rpt_family="(CAAAA)n" FT repeat_region 1317834..1318012 FT /rpt_family="Alu" FT repeat_region 1318020..1318322 FT /rpt_family="Alu" FT repeat_region 1318323..1318438 FT /rpt_family="ERVL" FT repeat_region 1318469..1318798 FT /rpt_family="L1" FT repeat_region 1318864..1318982 FT /rpt_family="Alu" FT repeat_region 1318983..1319077 FT /rpt_family="Alu" FT repeat_region 1319078..1319277 FT /rpt_family="Alu" FT repeat_region 1319312..1319385 FT /rpt_family="Alu" FT repeat_region 1319389..1320069 FT /rpt_family="L1" FT repeat_region 1320070..1320170 FT /rpt_family="GA-rich" FT repeat_region 1320171..1320765 FT /rpt_family="L1" FT repeat_region 1320766..1320795 FT /rpt_family="(CAG)n" FT repeat_region 1320922..1321150 FT /rpt_family="MER1_type" FT repeat_region 1321280..1321576 FT /rpt_family="Alu" FT repeat_region 1321600..1321920 FT /rpt_family="Alu" FT repeat_region 1321923..1322201 FT /rpt_family="Alu" FT repeat_region 1322208..1322662 FT /rpt_family="L1" FT repeat_region 1322676..1322977 FT /rpt_family="Alu" FT repeat_region 1323294..1323592 FT /rpt_family="Alu" FT misc_feature 1325708..1326027 FT /note="CpG_island (%GC=73.4, o/e=0.85, #CpGs=28)" FT repeat_region 1325825..1326022 FT /rpt_family="L2" FT repeat_region 1326024..1326123 FT /rpt_family="MER1_type" FT repeat_region 1326131..1326223 FT /rpt_family="Alu" FT repeat_region 1326224..1326329 FT /rpt_family="MER1_type" FT repeat_region 1326318..1326330 FT /rpt_family="MER1_type" FT repeat_region 1326331..1326625 FT /rpt_family="Alu" FT repeat_region 1326626..1326719 FT /rpt_family="MER1_type" FT repeat_region 1327160..1327272 FT /rpt_family="MIR" FT repeat_region 1328303..1328350 FT /rpt_family="MIR" FT misc_feature 1328526..1329029 FT /note="CpG_island (%GC=67.1, o/e=0.78, #CpGs=35)" FT misc_feature 1329382..1330208 FT /note="CpG_island (%GC=58.6, o/e=0.96, #CpGs=68)" FT repeat_region 1329698..1329723 FT /rpt_family="GC_rich" FT repeat_region 1329913..1329965 FT /rpt_family="GA-rich" FT repeat_region 1330302..1330344 FT /rpt_family="MIR" FT repeat_region 1331793..1331916 FT /rpt_family="MER1_type" FT repeat_region 1334348..1334502 FT /rpt_family="(TG)n" FT repeat_region 1334515..1334694 FT /rpt_family="(TG)n" FT repeat_region 1334707..1334882 FT /rpt_family="(TG)n" FT repeat_region 1334909..1335010 FT /rpt_family="(TG)n" FT repeat_region 1335028..1335196 FT /rpt_family="(TG)n" FT repeat_region 1336869..1336995 FT /rpt_family="CR1" FT misc_feature 1337106..1337388 FT /note="CpG_island (%GC=60.8, o/e=0.84, #CpGs=21)" FT repeat_region 1338187..1338325 FT /rpt_family="MIR" FT repeat_region 1339556..1339865 FT /rpt_family="Alu" FT repeat_region 1340685..1340740 FT /rpt_family="MIR" FT repeat_region 1340810..1340956 FT /rpt_family="MIR" FT repeat_region 1341988..1342298 FT /rpt_family="Alu" FT repeat_region 1342911..1343194 FT /rpt_family="Alu" FT repeat_region 1343198..1343472 FT /rpt_family="GA-rich" FT repeat_region 1343573..1343858 FT /rpt_family="Alu" FT repeat_region 1343868..1344166 FT /rpt_family="L1" FT repeat_region 1344167..1344466 FT /rpt_family="Alu" FT repeat_region 1344467..1344493 FT /rpt_family="L1" FT repeat_region 1344525..1344868 FT /rpt_family="L1" FT repeat_region 1344894..1345052 FT /rpt_family="MER1_type" FT repeat_region 1345103..1345208 FT /rpt_family="L1" FT repeat_region 1345209..1345237 FT /rpt_family="AT_rich" FT repeat_region 1345348..1345473 FT /rpt_family="L2" FT repeat_region 1345476..1345652 FT /rpt_family="(TCCA)n" FT repeat_region 1345669..1346032 FT /rpt_family="(TCCA)n" FT repeat_region 1346033..1346254 FT /rpt_family="(CCCA)n" FT repeat_region 1346284..1347008 FT /rpt_family="L2" FT repeat_region 1347378..1347759 FT /rpt_family="L1" FT repeat_region 1347958..1348031 FT /rpt_family="L1" FT repeat_region 1348399..1348543 FT /rpt_family="MIR" FT repeat_region 1348527..1348582 FT /rpt_family="MER1_type" FT repeat_region 1348740..1348807 FT /rpt_family="(ATG)n" FT repeat_region 1348838..1349012 FT /rpt_family="(TGG)n" FT repeat_region 1348977..1349153 FT /rpt_family="(ATG)n" FT repeat_region 1349174..1349357 FT /rpt_family="(ATGGTG)n" FT repeat_region 1349368..1349503 FT /rpt_family="(ATG)n" FT repeat_region 1349504..1349689 FT /rpt_family="MIR" FT repeat_region 1349960..1350013 FT /rpt_family="MIR" FT repeat_region 1350050..1350088 FT /rpt_family="AT_rich" FT repeat_region 1350089..1350110 FT /rpt_family="ERVL" FT repeat_region 1350111..1350399 FT /rpt_family="Alu" FT repeat_region 1350400..1350924 FT /rpt_family="ERVL" FT misc_feature 1351465..1351904 FT /note="CpG_island (%GC=65.0, o/e=0.63, #CpGs=33)" FT repeat_region 1352268..1352399 FT /rpt_family="MaLR" FT repeat_region 1352619..1352904 FT /rpt_family="Alu" FT repeat_region 1352911..1353232 FT /rpt_family="Alu" FT repeat_region 1353239..1353377 FT /rpt_family="Alu" FT repeat_region 1354076..1354178 FT /rpt_family="MIR" FT repeat_region 1355012..1355173 FT /rpt_family="MER1_type" FT repeat_region 1355174..1355488 FT /rpt_family="Alu" FT repeat_region 1355489..1355589 FT /rpt_family="MER1_type" FT repeat_region 1356055..1356345 FT /rpt_family="Alu" FT repeat_region 1356538..1356711 FT /rpt_family="Alu" FT repeat_region 1356750..1356781 FT /rpt_family="MaLR" FT repeat_region 1356782..1357084 FT /rpt_family="Alu" FT repeat_region 1357087..1357379 FT /rpt_family="Alu" FT repeat_region 1357380..1357494 FT /rpt_family="MaLR" FT repeat_region 1357585..1357711 FT /rpt_family="MaLR" FT repeat_region 1357884..1358097 FT /rpt_family="L1" FT repeat_region 1358133..1358308 FT /rpt_family="L1" FT misc_feature 1358274..1358514 FT /note="CpG_island (%GC=66.0, o/e=1.19, #CpGs=19)" FT repeat_region 1358743..1358928 FT /rpt_family="(TG)n" FT repeat_region 1358944..1359376 FT /rpt_family="(TG)n" FT repeat_region 1359391..1359713 FT /rpt_family="(TG)n" FT repeat_region 1359728..1360102 FT /rpt_family="(TG)n" FT repeat_region 1360404..1360475 FT /rpt_family="(TG)n" FT repeat_region 1362422..1362590 FT /rpt_family="MER1_type" FT repeat_region 1362663..1362727 FT /rpt_family="MIR" FT misc_feature 1362812..1363643 FT /note="CpG_island (%GC=66.3, o/e=0.67, #CpGs=64)" FT repeat_region 1363658..1363830 FT /rpt_family="MIR" FT repeat_region 1364740..1365043 FT /rpt_family="MaLR" FT repeat_region 1365893..1365934 FT /rpt_family="MaLR" FT repeat_region 1366274..1366388 FT /rpt_family="L2" FT repeat_region 1366609..1366675 FT /rpt_family="L1" FT repeat_region 1366676..1366825 FT /rpt_family="Alu" FT repeat_region 1366826..1367125 FT /rpt_family="Alu" FT misc_feature 1366829..1367064 FT /note="CpG_island (%GC=61.4, o/e=0.86, #CpGs=19)" FT repeat_region 1367126..1367289 FT /rpt_family="Alu" FT repeat_region 1367290..1367366 FT /rpt_family="L1" FT repeat_region 1367371..1367776 FT /rpt_family="ERV1" FT repeat_region 1367777..1368080 FT /rpt_family="Alu" FT repeat_region 1368081..1368137 FT /rpt_family="ERV1" FT repeat_region 1368161..1368245 FT /rpt_family="L1" FT repeat_region 1368250..1368292 FT /rpt_family="(TATATG)n" FT repeat_region 1368293..1368406 FT /rpt_family="L1" FT repeat_region 1368410..1368502 FT /rpt_family="(TATATG)n" FT repeat_region 1368504..1368573 FT /rpt_family="L1" FT repeat_region 1368584..1368762 FT /rpt_family="(TATATG)n" FT repeat_region 1368777..1369083 FT /rpt_family="ERVL" FT misc_feature 1370387..1370863 FT /note="CpG_island (%GC=60.4, o/e=0.72, #CpGs=39)" FT repeat_region 1371152..1371217 FT /rpt_family="MIR" FT repeat_region 1371500..1371634 FT /rpt_family="L2" FT repeat_region 1371675..1371766 FT /rpt_family="L2" FT repeat_region 1372506..1372645 FT /rpt_family="MIR" FT repeat_region 1372650..1372768 FT /rpt_family="Alu" FT repeat_region 1372943..1373126 FT /rpt_family="(TCC)n" FT repeat_region 1373149..1373421 FT /rpt_family="Alu" FT repeat_region 1373422..1373457 FT /rpt_family="AT_rich" FT repeat_region 1373480..1373677 FT /rpt_family="Alu" FT repeat_region 1373682..1373970 FT /rpt_family="Alu" FT repeat_region 1373981..1374257 FT /rpt_family="L1" FT repeat_region 1374263..1374430 FT /rpt_family="Alu" FT repeat_region 1374431..1374739 FT /rpt_family="Alu" FT repeat_region 1374772..1374844 FT /rpt_family="L1" FT repeat_region 1375116..1375427 FT /rpt_family="Alu" FT repeat_region 1375438..1375553 FT /rpt_family="L1" FT repeat_region 1375554..1375851 FT /rpt_family="Alu" FT repeat_region 1375852..1375897 FT /rpt_family="L1" FT repeat_region 1375935..1376483 FT /rpt_family="L1" FT repeat_region 1376484..1376780 FT /rpt_family="Alu" FT repeat_region 1376781..1377211 FT /rpt_family="L1" FT repeat_region 1377212..1377260 FT /rpt_family="(TCCC)n" FT repeat_region 1377261..1377352 FT /rpt_family="L1" FT repeat_region 1377366..1377509 FT /rpt_family="CT-rich" FT repeat_region 1377515..1377817 FT /rpt_family="Alu" FT repeat_region 1377818..1378096 FT /rpt_family="L1" FT repeat_region 1378097..1378394 FT /rpt_family="Alu" FT repeat_region 1378395..1378694 FT /rpt_family="Alu" FT repeat_region 1378695..1379329 FT /rpt_family="L1" FT repeat_region 1379357..1379527 FT /rpt_family="MaLR" FT repeat_region 1379788..1379894 FT /rpt_family="L2" FT repeat_region 1382320..1382400 FT /rpt_family="L2" FT repeat_region 1382471..1382504 FT /rpt_family="MaLR" FT repeat_region 1382553..1382862 FT /rpt_family="MaLR" FT repeat_region 1382863..1383168 FT /rpt_family="Alu" FT repeat_region 1383169..1383239 FT /rpt_family="MaLR" FT repeat_region 1383547..1383617 FT /rpt_family="MaLR" FT repeat_region 1383618..1383933 FT /rpt_family="Alu" FT repeat_region 1383934..1384227 FT /rpt_family="MaLR" FT repeat_region 1384541..1384605 FT /rpt_family="MIR" FT repeat_region 1385380..1385430 FT /rpt_family="(CAGAGA)n" FT repeat_region 1385717..1385794 FT /rpt_family="MIR" FT repeat_region 1386805..1387113 FT /rpt_family="Alu" FT repeat_region 1388738..1388838 FT /rpt_family="MIR" FT repeat_region 1388928..1388989 FT /rpt_family="MIR" FT repeat_region 1389093..1389254 FT /rpt_family="MIR" FT repeat_region 1389567..1389658 FT /rpt_family="L1" FT repeat_region 1389659..1389794 FT /rpt_family="Alu" FT repeat_region 1389795..1390077 FT /rpt_family="Alu" FT repeat_region 1390078..1390254 FT /rpt_family="Alu" FT repeat_region 1390255..1390848 FT /rpt_family="L1" FT repeat_region 1390849..1390934 FT /rpt_family="Alu" FT repeat_region 1391016..1391257 FT /rpt_family="Alu" FT repeat_region 1391259..1391516 FT /rpt_family="L1" FT repeat_region 1392829..1393153 FT /rpt_family="Alu" FT repeat_region 1393158..1393281 FT /rpt_family="L1" FT repeat_region 1393365..1393463 FT /rpt_family="MER1_type" FT repeat_region 1393476..1393779 FT /rpt_family="Alu" FT repeat_region 1395638..1395897 FT /rpt_family="L2" FT repeat_region 1395978..1396096 FT /rpt_family="MER1_type" FT repeat_region 1396106..1396146 FT /rpt_family="(TTCC)n" FT repeat_region 1396147..1396427 FT /rpt_family="Alu" FT repeat_region 1396428..1396440 FT /rpt_family="MER1_type" FT repeat_region 1396447..1396586 FT /rpt_family="L2" FT repeat_region 1397704..1397765 FT /rpt_family="MIR" FT repeat_region 1398371..1398479 FT /rpt_family="MIR" FT repeat_region 1399012..1399331 FT /rpt_family="Alu" FT repeat_region 1400552..1400671 FT /rpt_family="MIR" FT repeat_region 1401014..1401042 FT /rpt_family="AT_rich" FT repeat_region 1401048..1401353 FT /rpt_family="Alu" FT repeat_region 1401414..1401508 FT /rpt_family="MIR" FT repeat_region 1402368..1402659 FT /rpt_family="Alu" FT repeat_region 1402688..1402857 FT /rpt_family="Alu" FT repeat_region 1402867..1403164 FT /rpt_family="Alu" FT repeat_region 1403192..1403464 FT /rpt_family="Alu" FT repeat_region 1403474..1403662 FT /rpt_family="L1" FT repeat_region 1405350..1405531 FT /rpt_family="L2" FT repeat_region 1405652..1405903 FT /rpt_family="MaLR" FT repeat_region 1406053..1406158 FT /rpt_family="L2" FT repeat_region 1406325..1406463 FT /rpt_family="MIR" FT repeat_region 1407171..1407223 FT /rpt_family="L1" FT repeat_region 1407518..1407635 FT /rpt_family="L1" FT repeat_region 1407809..1407864 FT /rpt_family="MIR" FT repeat_region 1408164..1408246 FT /rpt_family="MIR" FT repeat_region 1408400..1408512 FT /rpt_family="MIR" FT misc_feature 1408488..1409307 FT /note="CpG_island (%GC=72.4, o/e=0.80, #CpGs=75)" FT repeat_region 1408880..1409065 FT /rpt_family="(CACCC)n" FT repeat_region 1409474..1409574 FT /rpt_family="MIR" FT repeat_region 1410539..1410709 FT /rpt_family="CR1" FT repeat_region 1410748..1410792 FT /rpt_family="L2" FT repeat_region 1410953..1411067 FT /rpt_family="MIR" FT repeat_region 1411184..1411236 FT /rpt_family="MaLR" FT repeat_region 1411237..1411563 FT /rpt_family="Alu" FT repeat_region 1411564..1411778 FT /rpt_family="MaLR" FT repeat_region 1411970..1412273 FT /rpt_family="Alu" FT repeat_region 1412276..1412325 FT /rpt_family="MIR" FT repeat_region 1412341..1412758 FT /rpt_family="MaLR" FT repeat_region 1413054..1413346 FT /rpt_family="Alu" FT repeat_region 1413476..1413698 FT /rpt_family="MaLR" FT repeat_region 1413699..1413811 FT /rpt_family="Alu" FT repeat_region 1413812..1413822 FT /rpt_family="MaLR" FT repeat_region 1413823..1414121 FT /rpt_family="Alu" FT repeat_region 1414122..1414322 FT /rpt_family="MaLR" FT repeat_region 1414412..1414722 FT /rpt_family="Alu" FT repeat_region 1414731..1415040 FT /rpt_family="Alu" FT repeat_region 1415068..1415195 FT /rpt_family="L2" FT repeat_region 1415415..1415735 FT /rpt_family="Alu" FT repeat_region 1416034..1416297 FT /rpt_family="L1" FT repeat_region 1416305..1416383 FT /rpt_family="L1" FT repeat_region 1416388..1416668 FT /rpt_family="Alu" FT repeat_region 1416669..1416846 FT /rpt_family="L1" FT repeat_region 1417009..1417409 FT /rpt_family="MaLR" FT repeat_region 1417595..1417620 FT /rpt_family="(TGGA)n" FT repeat_region 1417694..1417717 FT /rpt_family="L1" FT repeat_region 1417718..1418012 FT /rpt_family="Alu" FT repeat_region 1418013..1418982 FT /rpt_family="L1" FT repeat_region 1418989..1419062 FT /rpt_family="(TGGA)n" FT repeat_region 1419076..1419243 FT /rpt_family="(TGGA)n" FT repeat_region 1419271..1419431 FT /rpt_family="(TGGA)n" FT repeat_region 1419460..1419570 FT /rpt_family="(TGGA)n" FT repeat_region 1419587..1419615 FT /rpt_family="(TGGA)n" FT repeat_region 1419672..1419839 FT /rpt_family="(TAGA)n" FT repeat_region 1420417..1420720 FT /rpt_family="Alu" FT repeat_region 1421253..1421283 FT /rpt_family="AT_rich" FT repeat_region 1421698..1421983 FT /rpt_family="Alu" FT repeat_region 1422016..1422318 FT /rpt_family="Alu" FT repeat_region 1423675..1423789 FT /rpt_family="MER1_type" FT repeat_region 1424067..1424437 FT /rpt_family="L1" FT repeat_region 1424445..1424545 FT /rpt_family="(TCTCTG)n" FT repeat_region 1424883..1424919 FT /rpt_family="(CAGGG)n" FT repeat_region 1427183..1427488 FT /rpt_family="Alu" FT repeat_region 1427489..1427673 FT /rpt_family="Alu" FT repeat_region 1428492..1428621 FT /rpt_family="L2" FT repeat_region 1429355..1429447 FT /rpt_family="MIR" FT repeat_region 1429468..1429749 FT /rpt_family="Alu" FT repeat_region 1429753..1429849 FT /rpt_family="(GGAA)n" FT repeat_region 1429866..1430283 FT /rpt_family="Alu" FT repeat_region 1430592..1430816 FT /rpt_family="Alu" FT repeat_region 1431237..1431702 FT /rpt_family="MaLR" FT repeat_region 1431829..1432249 FT /rpt_family="MaLR" FT repeat_region 1433714..1433894 FT /rpt_family="L2" FT repeat_region 1433987..1434605 FT /rpt_family="MaLR" FT repeat_region 1435866..1436280 FT /rpt_family="L1" FT repeat_region 1436710..1437025 FT /rpt_family="Alu" FT repeat_region 1437150..1437833 FT /rpt_family="L1" FT repeat_region 1437850..1437985 FT /rpt_family="Alu" FT repeat_region 1437988..1438282 FT /rpt_family="Alu" FT repeat_region 1438316..1438623 FT /rpt_family="Alu" FT repeat_region 1439328..1439456 FT /rpt_family="AcHobo" FT repeat_region 1439501..1439548 FT /rpt_family="L1" FT repeat_region 1439549..1439839 FT /rpt_family="Alu" FT repeat_region 1439840..1440035 FT /rpt_family="L1" FT repeat_region 1440036..1440444 FT /rpt_family="ERV1" FT repeat_region 1440445..1440486 FT /rpt_family="L1" FT repeat_region 1440541..1440941 FT /rpt_family="ERV1" FT repeat_region 1440942..1441084 FT /rpt_family="Alu" FT repeat_region 1441092..1441240 FT /rpt_family="ERV1" FT repeat_region 1441242..1441259 FT /rpt_family="MaLR" FT repeat_region 1441260..1441558 FT /rpt_family="Alu" FT repeat_region 1441559..1441659 FT /rpt_family="MaLR" FT repeat_region 1441702..1442034 FT /rpt_family="MaLR" FT repeat_region 1442077..1442174 FT /rpt_family="MaLR" FT repeat_region 1442442..1442490 FT /rpt_family="L2" FT repeat_region 1442508..1442575 FT /rpt_family="L2" FT repeat_region 1442586..1442667 FT /rpt_family="L2" FT repeat_region 1443271..1443360 FT /rpt_family="MIR" FT repeat_region 1444069..1444106 FT /rpt_family="(CA)n" FT repeat_region 1444350..1444611 FT /rpt_family="GA-rich" FT repeat_region 1445510..1445658 FT /rpt_family="Alu" FT repeat_region 1445673..1445938 FT /rpt_family="Alu" FT repeat_region 1446492..1446796 FT /rpt_family="Alu" FT repeat_region 1446855..1447153 FT /rpt_family="Alu" FT repeat_region 1447949..1447971 FT /rpt_family="AT_rich" FT repeat_region 1448178..1448309 FT /rpt_family="MIR" FT repeat_region 1448421..1448928 FT /rpt_family="ERVL" FT repeat_region 1448929..1449220 FT /rpt_family="Alu" FT repeat_region 1449221..1449607 FT /rpt_family="MaLR" FT repeat_region 1449634..1449936 FT /rpt_family="Alu" FT repeat_region 1449974..1450261 FT /rpt_family="Alu" FT repeat_region 1450264..1450582 FT /rpt_family="Alu" FT repeat_region 1451436..1451524 FT /rpt_family="MIR" FT repeat_region 1451657..1451780 FT /rpt_family="MIR" FT repeat_region 1452914..1453048 FT /rpt_family="MIR" FT repeat_region 1453282..1453468 FT /rpt_family="MIR" FT repeat_region 1454017..1454101 FT /rpt_family="MIR" FT repeat_region 1454200..1454330 FT /rpt_family="MIR" FT repeat_region 1454792..1454857 FT /rpt_family="(TGGA)n" FT repeat_region 1454871..1455480 FT /rpt_family="(TGGA)n" FT repeat_region 1455510..1455690 FT /rpt_family="(TGGA)n" FT repeat_region 1455704..1456060 FT /rpt_family="(TGGA)n" FT repeat_region 1456154..1456251 FT /rpt_family="MIR" FT repeat_region 1457048..1457485 FT /rpt_family="L1" FT repeat_region 1457495..1457794 FT /rpt_family="Alu" FT repeat_region 1458722..1458810 FT /rpt_family="MIR" FT repeat_region 1458978..1459007 FT /rpt_family="(TCC)n" FT repeat_region 1459880..1460171 FT /rpt_family="Alu" FT repeat_region 1460231..1460534 FT /rpt_family="Alu" FT repeat_region 1461006..1461100 FT /rpt_family="L2" FT repeat_region 1461563..1461683 FT /rpt_family="MIR" FT repeat_region 1463071..1463366 FT /rpt_family="GA-rich" FT repeat_region 1463382..1463561 FT /rpt_family="GA-rich" FT repeat_region 1464041..1464259 FT /rpt_family="MaLR" FT repeat_region 1464598..1464771 FT /rpt_family="Alu" FT repeat_region 1464772..1465072 FT /rpt_family="Alu" FT repeat_region 1465073..1465209 FT /rpt_family="Alu" FT repeat_region 1465211..1465299 FT /rpt_family="MaLR" FT repeat_region 1465343..1465445 FT /rpt_family="MaLR" FT repeat_region 1465918..1466208 FT /rpt_family="Alu" FT repeat_region 1466714..1466781 FT /rpt_family="MER1_type" FT repeat_region 1466782..1466905 FT /rpt_family="Alu" FT repeat_region 1466906..1467185 FT /rpt_family="Alu" FT repeat_region 1467186..1467199 FT /rpt_family="MER1_type" FT repeat_region 1467514..1467787 FT /rpt_family="Alu" FT repeat_region 1467789..1467809 FT /rpt_family="(TC)n" FT repeat_region 1467810..1467834 FT /rpt_family="AT_rich" FT repeat_region 1468649..1468734 FT /rpt_family="AcHobo" FT repeat_region 1470317..1470404 FT /rpt_family="L2" FT repeat_region 1470507..1470796 FT /rpt_family="Alu" FT repeat_region 1472151..1472235 FT /rpt_family="MIR" FT repeat_region 1472574..1472626 FT /rpt_family="(CCCCG)n" FT repeat_region 1473125..1473234 FT /rpt_family="MIR" FT repeat_region 1475409..1475718 FT /rpt_family="Alu" FT repeat_region 1475744..1476039 FT /rpt_family="Alu" FT repeat_region 1476040..1476207 FT /rpt_family="Alu" FT repeat_region 1476627..1476661 FT /rpt_family="(TGAA)n" FT repeat_region 1476875..1477059 FT /rpt_family="MIR" FT repeat_region 1478938..1479123 FT /rpt_family="(CACG)n" FT repeat_region 1479026..1479207 FT /rpt_family="(CA)n" FT repeat_region 1479222..1479408 FT /rpt_family="(CA)n" FT repeat_region 1480171..1480209 FT /rpt_family="L2" FT repeat_region 1480457..1480612 FT /rpt_family="MIR" FT repeat_region 1483103..1483503 FT /rpt_family="MaLR" FT repeat_region 1484119..1484236 FT /rpt_family="MIR" FT repeat_region 1485830..1486261 FT /rpt_family="GA-rich" FT repeat_region 1488854..1488943 FT /rpt_family="MER1_type" FT repeat_region 1488944..1489149 FT /rpt_family="Alu" FT repeat_region 1490515..1490631 FT /rpt_family="MIR" FT repeat_region 1491022..1491149 FT /rpt_family="Alu" FT repeat_region 1491518..1491593 FT /rpt_family="MIR" FT repeat_region 1492783..1493189 FT /rpt_family="MaLR" FT repeat_region 1493896..1493953 FT /rpt_family="GA-rich" FT repeat_region 1495356..1495451 FT /rpt_family="CR1" FT repeat_region 1495775..1495935 FT /rpt_family="Alu" FT repeat_region 1495936..1496273 FT /rpt_family="Alu" FT repeat_region 1496274..1496421 FT /rpt_family="Alu" FT repeat_region 1496547..1496788 FT /rpt_family="MaLR" FT repeat_region 1496877..1496972 FT /rpt_family="L2" FT repeat_region 1497179..1497224 FT /rpt_family="L2" FT misc_feature 1498576..1499606 FT /note="CpG_island (%GC=74.7, o/e=0.80, #CpGs=110)" FT repeat_region 1498965..1498989 FT /rpt_family="GC_rich" FT repeat_region 1499143..1499312 FT /rpt_family="(CCCCG)n" FT repeat_region 1499525..1499569 FT /rpt_family="(CCCCG)n" FT repeat_region 1500438..1500513 FT /rpt_family="CR1" FT repeat_region 1501500..1501535 FT /rpt_family="MIR" FT repeat_region 1501757..1501831 FT /rpt_family="GA-rich" FT repeat_region 1501834..1502044 FT /rpt_family="L2" FT repeat_region 1502151..1502425 FT /rpt_family="Alu" FT repeat_region 1502469..1502593 FT /rpt_family="Alu" FT repeat_region 1502664..1502946 FT /rpt_family="Alu" FT repeat_region 1503003..1503061 FT /rpt_family="G-rich" FT repeat_region 1503622..1503727 FT /rpt_family="MER103" FT repeat_region 1504481..1504533 FT /rpt_family="MIR" FT repeat_region 1504625..1504928 FT /rpt_family="Alu" FT repeat_region 1504929..1505223 FT /rpt_family="Alu" FT repeat_region 1505226..1505339 FT /rpt_family="MIR" FT repeat_region 1514741..1515021 FT /rpt_family="Alu" FT repeat_region 1515185..1515356 FT /rpt_family="L1" FT repeat_region 1519344..1519372 FT /rpt_family="(GGA)n" FT repeat_region 1522484..1522575 FT /rpt_family="MIR" FT repeat_region 1525444..1525736 FT /rpt_family="Alu" FT repeat_region 1525737..1525871 FT /rpt_family="Alu" FT repeat_region 1525891..1526200 FT /rpt_family="Alu" FT repeat_region 1529517..1529577 FT /rpt_family="MIR" FT repeat_region 1530213..1530838 FT /rpt_family="L1" FT repeat_region 1530960..1531249 FT /rpt_family="L1" FT repeat_region 1531250..1531555 FT /rpt_family="Alu" FT repeat_region 1531556..1532242 FT /rpt_family="L1" FT repeat_region 1532471..1532641 FT /rpt_family="G-rich" FT misc_feature 1533253..1533552 FT /note="CpG_island (%GC=68.0, o/e=0.59, #CpGs=23)" FT misc_feature 1535618..1536099 FT /note="CpG_island (%GC=68.7, o/e=0.82, #CpGs=37)" FT repeat_region 1536157..1536196 FT /rpt_family="(CA)n" FT misc_feature 1536622..1537489 FT /note="CpG_island (%GC=63.7, o/e=0.64, #CpGs=57)" FT repeat_region 1537568..1537703 FT /rpt_family="Alu" FT misc_feature 1538221..1538951 FT /note="CpG_island (%GC=69.6, o/e=0.66, #CpGs=54)" FT repeat_region 1538251..1538318 FT /rpt_family="C-rich" FT repeat_region 1538579..1538608 FT /rpt_family="GC_rich" FT repeat_region 1538833..1538862 FT /rpt_family="GC_rich" FT repeat_region 1540639..1540969 FT /rpt_family="Alu" FT repeat_region 1542178..1542286 FT /rpt_family="L2" FT repeat_region 1542891..1542989 FT /rpt_family="MIR" FT repeat_region 1543014..1543251 FT /rpt_family="MIR" FT misc_feature 1543155..1544399 FT /note="CpG_island (%GC=71.6, o/e=0.86, #CpGs=141)" FT repeat_region 1543668..1543701 FT /rpt_family="(CTCG)n" FT repeat_region 1543745..1543766 FT /rpt_family="GC_rich" FT repeat_region 1544418..1544442 FT /rpt_family="(TAA)n" FT repeat_region 1544483..1544765 FT /rpt_family="Alu" FT repeat_region 1544859..1544983 FT /rpt_family="Alu" FT repeat_region 1544984..1545270 FT /rpt_family="Alu" FT repeat_region 1545354..1545519 FT /rpt_family="L1" FT repeat_region 1546143..1546183 FT /rpt_family="(TCC)n" FT repeat_region 1546185..1546362 FT /rpt_family="CT-rich" FT repeat_region 1546375..1546424 FT /rpt_family="CT-rich" FT repeat_region 1546452..1546543 FT /rpt_family="CT-rich" FT repeat_region 1546551..1546670 FT /rpt_family="L1" FT repeat_region 1546720..1546833 FT /rpt_family="L1" FT repeat_region 1546834..1547142 FT /rpt_family="Alu" FT misc_feature 1546895..1547139 FT /note="CpG_island (%GC=57.1, o/e=0.86, #CpGs=18)" FT repeat_region 1547143..1547226 FT /rpt_family="L1" FT repeat_region 1547297..1547442 FT /rpt_family="L1" FT repeat_region 1547443..1547736 FT /rpt_family="Alu" FT repeat_region 1547758..1548056 FT /rpt_family="Alu" FT repeat_region 1548132..1548475 FT /rpt_family="MaLR" FT repeat_region 1548481..1548607 FT /rpt_family="Alu" FT repeat_region 1548618..1548922 FT /rpt_family="Alu" FT repeat_region 1548925..1548979 FT /rpt_family="MaLR" FT repeat_region 1549052..1549220 FT /rpt_family="L2" FT repeat_region 1549275..1549444 FT /rpt_family="Alu" FT repeat_region 1549445..1549738 FT /rpt_family="Alu" FT repeat_region 1549739..1549883 FT /rpt_family="Alu" FT repeat_region 1549910..1550065 FT /rpt_family="Alu" FT repeat_region 1551767..1552068 FT /rpt_family="Alu" FT repeat_region 1552078..1552372 FT /rpt_family="Alu" FT repeat_region 1552824..1552937 FT /rpt_family="MIR" FT repeat_region 1553470..1553622 FT /rpt_family="CR1" FT repeat_region 1553736..1553999 FT /rpt_family="Alu" FT repeat_region 1554081..1554225 FT /rpt_family="MIR" FT repeat_region 1554440..1554558 FT /rpt_family="Alu" FT repeat_region 1554559..1554586 FT /rpt_family="(TAA)n" FT repeat_region 1554587..1554766 FT /rpt_family="Alu" FT repeat_region 1555032..1555340 FT /rpt_family="Alu" FT repeat_region 1555808..1556128 FT /rpt_family="Alu" FT misc_feature 1555894..1556129 FT /note="CpG_island (%GC=60.6, o/e=0.86, #CpGs=18)" FT repeat_region 1556727..1557034 FT /rpt_family="Alu" FT repeat_region 1557049..1557175 FT /rpt_family="Alu" FT repeat_region 1557283..1557360 FT /rpt_family="ERV1" FT repeat_region 1557361..1557523 FT /rpt_family="Alu" FT repeat_region 1557524..1557821 FT /rpt_family="Alu" FT repeat_region 1557822..1557962 FT /rpt_family="Alu" FT repeat_region 1557963..1558140 FT /rpt_family="ERV1" FT repeat_region 1558141..1558463 FT /rpt_family="Alu" FT repeat_region 1558464..1558864 FT /rpt_family="ERV1" FT repeat_region 1558864..1559215 FT /rpt_family="centr" FT repeat_region 1559207..1559265 FT /rpt_family="ERVL" FT repeat_region 1559266..1559451 FT /rpt_family="Alu" FT repeat_region 1559452..1559744 FT /rpt_family="Alu" FT repeat_region 1559745..1559879 FT /rpt_family="Alu" FT repeat_region 1559880..1560329 FT /rpt_family="ERVL" FT repeat_region 1560360..1560559 FT /rpt_family="MaLR" FT repeat_region 1560763..1560803 FT /rpt_family="MaLR" FT repeat_region 1560804..1561102 FT /rpt_family="Alu" FT repeat_region 1561103..1561432 FT /rpt_family="MaLR" FT repeat_region 1561629..1561718 FT /rpt_family="MER1_type" FT repeat_region 1561773..1561946 FT /rpt_family="Alu" FT repeat_region 1561950..1562253 FT /rpt_family="Alu" FT repeat_region 1562404..1562466 FT /rpt_family="Alu" FT repeat_region 1562467..1562612 FT /rpt_family="Alu" FT repeat_region 1564007..1564173 FT /rpt_family="Alu" FT repeat_region 1564174..1564457 FT /rpt_family="Alu" FT repeat_region 1564458..1564593 FT /rpt_family="Alu" FT repeat_region 1564594..1564728 FT /rpt_family="Alu" FT repeat_region 1564738..1565038 FT /rpt_family="Alu" FT repeat_region 1565047..1565420 FT /rpt_family="L1" FT repeat_region 1565422..1565718 FT /rpt_family="Alu" FT repeat_region 1565719..1566223 FT /rpt_family="GA-rich" FT repeat_region 1566236..1566631 FT /rpt_family="L1" FT repeat_region 1566747..1567032 FT /rpt_family="Alu" FT repeat_region 1567033..1567084 FT /rpt_family="(CA)n" FT repeat_region 1567085..1567380 FT /rpt_family="Alu" FT repeat_region 1567383..1567514 FT /rpt_family="Alu" FT repeat_region 1567552..1567643 FT /rpt_family="L1" FT repeat_region 1567688..1567795 FT /rpt_family="Alu" FT repeat_region 1567813..1567866 FT /rpt_family="L1" FT repeat_region 1567876..1568182 FT /rpt_family="Alu" FT repeat_region 1568202..1568338 FT /rpt_family="Alu" FT repeat_region 1568339..1568647 FT /rpt_family="Alu" FT repeat_region 1568648..1568825 FT /rpt_family="Alu" FT repeat_region 1569773..1570070 FT /rpt_family="Alu" FT repeat_region 1570081..1570212 FT /rpt_family="Alu" FT misc_feature 1570174..1571136 FT /note="CpG_island (%GC=81.5, o/e=0.96, #CpGs=151)" FT repeat_region 1570230..1570393 FT /rpt_family="G-rich" FT gene 1570368..1580366 FT /gene="MAFK" FT mRNA join(1570368..1570534,1578785..1578864,1579577..1580366) FT /gene="MAFK" FT repeat_region 1570500..1570527 FT /rpt_family="GC_rich" FT repeat_region 1570539..1570602 FT /rpt_family="G-rich" FT repeat_region 1570684..1570744 FT /rpt_family="GC_rich" FT repeat_region 1570892..1570950 FT /rpt_family="GC_rich" FT repeat_region 1572697..1572814 FT /rpt_family="MIR" FT repeat_region 1574536..1574847 FT /rpt_family="Alu" FT repeat_region 1575009..1575309 FT /rpt_family="Alu" FT misc_feature 1575737..1575993 FT /gene="MAFK" FT /note="CpG_island (%GC=64.6, o/e=0.82, #CpGs=23)" FT CDS join(1578829..1578864,1579577..1580011) FT /codon_start=1 FT /gene="MAFK" FT /product="unknown" FT /note="Homo sapiens v-maf musculoaponeurotic fibrosarcoma FT oncogene homolog K (avian) (MAFK), mRNA.; H_NH0016P10.1 FT This gene was based on gi(4505074)" FT /protein_id="AAP21866.1" FT /translation="MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLT FT KEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLEL FT DALRSKYEALQTFARTVARGPVAPSKVATTSVITIVKSTELSSTSVPFSAAS" FT repeat_region 1580022..1580064 FT /rpt_family="(CGGG)n" FT gene 1581073..1582679 FT /gene="FLJ32205" FT mRNA 1581073..1582679 FT /gene="FLJ32205" FT repeat_region 1583277..1583565 FT /rpt_family="Alu" FT repeat_region 1584006..1584053 FT /rpt_family="MIR" FT misc_feature 1584055..1584345 FT /note="CpG_island (%GC=67.7, o/e=0.79, #CpGs=26)" FT repeat_region 1584366..1584457 FT /rpt_family="MIR" FT misc_feature 1587241..1587693 FT /note="CpG_island (%GC=68.4, o/e=0.65, #CpGs=34)" FT repeat_region 1588708..1588886 FT /rpt_family="(TG)n" FT repeat_region 1591291..1591585 FT /rpt_family="Alu" FT repeat_region 1591625..1591913 FT /rpt_family="Alu" FT repeat_region 1591920..1592150 FT /rpt_family="L1" FT repeat_region 1592409..1592702 FT /rpt_family="Alu" FT repeat_region 1592773..1593088 FT /rpt_family="Alu" FT repeat_region 1593328..1593451 FT /rpt_family="MIR" FT repeat_region 1593771..1593870 FT /rpt_family="Alu" FT repeat_region 1594544..1594623 FT /rpt_family="MIR" FT repeat_region 1596137..1596316 FT /rpt_family="L1" FT repeat_region 1596360..1596668 FT /rpt_family="Alu" FT repeat_region 1597032..1597338 FT /rpt_family="Alu" FT repeat_region 1598145..1598213 FT /rpt_family="MIR" FT repeat_region 1601483..1601669 FT /rpt_family="Alu" FT repeat_region 1602846..1602896 FT /rpt_family="Alu" FT repeat_region 1602897..1603105 FT /rpt_family="Alu" FT repeat_region 1603319..1603612 FT /rpt_family="Alu" FT repeat_region 1603981..1604088 FT /rpt_family="(TATG)n" FT repeat_region 1604096..1604214 FT /rpt_family="(CATG)n" FT repeat_region 1604217..1604331 FT /rpt_family="Alu" FT repeat_region 1605255..1605571 FT /rpt_family="Alu" FT repeat_region 1605612..1605908 FT /rpt_family="Alu" FT repeat_region 1605990..1606116 FT /rpt_family="Alu" FT gene complement(1606968..1609208) FT /gene="MGC10911" FT mRNA complement(join(1606968..1607486,1608760..1609208)) FT /gene="MGC10911" FT CDS complement(join(1607334..1607486,1608760..1608975)) FT /codon_start=1 FT /gene="MGC10911" FT /product="unknown" FT /note="Homo sapiens, Similar to RIKEN cDNA 1810042K04 gene, FT clone MGC:10911 IMAGE:3627097, mRNA, complete cds.; FT H_NH0016P10.2 This gene was based on gi(13279190 14150059)" FT /protein_id="AAP21867.1" FT /translation="MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTL FT VSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDK FT SMEGLKALREVIRVCQVW" FT repeat_region 1608090..1608271 FT /rpt_family="Alu" FT repeat_region 1608272..1608583 FT /rpt_family="Alu" FT repeat_region 1608584..1608747 FT /rpt_family="Alu" FT misc_feature 1609077..1610256 FT /note="CpG_island (%GC=66.9, o/e=0.89, #CpGs=122)" FT repeat_region 1609122..1609418 FT /rpt_family="Alu" FT repeat_region 1609513..1609561 FT /rpt_family="GC_rich" FT repeat_region 1610040..1610179 FT /rpt_family="MIR" FT repeat_region 1610368..1610670 FT /rpt_family="Alu" FT repeat_region 1610841..1610933 FT /rpt_family="ERV1" FT repeat_region 1610934..1611205 FT /rpt_family="ERV1" FT repeat_region 1611206..1611510 FT /rpt_family="Alu" FT repeat_region 1611511..1611579 FT /rpt_family="ERV1" FT repeat_region 1611580..1612007 FT /rpt_family="ERV1" FT repeat_region 1612536..1612828 FT /rpt_family="Alu" FT repeat_region 1613444..1613751 FT /rpt_family="Alu" FT repeat_region 1613940..1614242 FT /rpt_family="Alu" FT repeat_region 1614574..1614634 FT /rpt_family="MIR" FT repeat_region 1614686..1614997 FT /rpt_family="Alu" FT repeat_region 1615524..1615719 FT /rpt_family="MIR" FT repeat_region 1615943..1616116 FT /rpt_family="CR1" FT repeat_region 1616210..1616475 FT /rpt_family="Alu" FT repeat_region 1616476..1616901 FT /rpt_family="ERV1" FT repeat_region 1616902..1617314 FT /rpt_family="L1" FT repeat_region 1617317..1617674 FT /rpt_family="(TCCA)n" FT unsure 1617323..1618473 FT /note="unresolved tandem repeat" FT repeat_region 1617675..1617702 FT /rpt_family="(TCCA)n" FT repeat_region 1617703..1617882 FT /rpt_family="(TCCA)n" FT repeat_region 1617911..1618270 FT /rpt_family="(TCCA)n" FT repeat_region 1618309..1618473 FT /rpt_family="(TCCA)n" FT repeat_region 1618898..1619061 FT /rpt_family="Alu" FT repeat_region 1619344..1619379 FT /rpt_family="(CTGGGG)n" FT repeat_region 1619485..1619864 FT /rpt_family="L1" FT repeat_region 1619903..1620027 FT /rpt_family="(TCTCTG)n" FT repeat_region 1620090..1620140 FT /rpt_family="CT-rich" FT repeat_region 1620862..1621155 FT /rpt_family="Alu" FT repeat_region 1621160..1621248 FT /rpt_family="L1" FT repeat_region 1621249..1621473 FT /rpt_family="Alu" FT repeat_region 1621474..1621535 FT /rpt_family="L1" FT repeat_region 1621952..1622248 FT /rpt_family="Alu" FT repeat_region 1622261..1622568 FT /rpt_family="Alu" FT repeat_region 1622574..1623141 FT /rpt_family="L1" FT repeat_region 1623145..1623449 FT /rpt_family="Alu" FT repeat_region 1623464..1623633 FT /rpt_family="Alu" FT repeat_region 1623634..1623940 FT /rpt_family="Alu" FT repeat_region 1624003..1624107 FT /rpt_family="L2" FT repeat_region 1627422..1627540 FT /rpt_family="MIR" FT repeat_region 1627611..1627771 FT /rpt_family="MIR" FT repeat_region 1627875..1627964 FT /rpt_family="ERVL" FT repeat_region 1627965..1628427 FT /rpt_family="ERVL" FT repeat_region 1628428..1628500 FT /rpt_family="ERVL" FT repeat_region 1628502..1628581 FT /rpt_family="ERVL" FT repeat_region 1628758..1629121 FT /rpt_family="MaLR" FT repeat_region 1629123..1629470 FT /rpt_family="L1" FT repeat_region 1629471..1629500 FT /rpt_family="(TTTA)n" FT repeat_region 1629501..1629789 FT /rpt_family="Alu" FT repeat_region 1629790..1629932 FT /rpt_family="L1" FT repeat_region 1629973..1630032 FT /rpt_family="MaLR" FT repeat_region 1630033..1630331 FT /rpt_family="Alu" FT repeat_region 1630621..1630767 FT /rpt_family="MIR" FT repeat_region 1630802..1630895 FT /rpt_family="ERVL" FT repeat_region 1631134..1631476 FT /rpt_family="ERVL" FT repeat_region 1631511..1631560 FT /rpt_family="ERVL" FT repeat_region 1633580..1633742 FT /rpt_family="CT-rich" FT unsure 1633693..1634915 FT /note="unresolved tandem repeat" FT repeat_region 1633743..1634259 FT /rpt_family="(TCCA)n" FT repeat_region 1634275..1634453 FT /rpt_family="(TCCA)n" FT repeat_region 1634466..1635088 FT /rpt_family="(TCCA)n" FT repeat_region 1635092..1635234 FT /rpt_family="L2" FT repeat_region 1636585..1636748 FT /rpt_family="L2" FT repeat_region 1636768..1637191 FT /rpt_family="MaLR" FT repeat_region 1638284..1638656 FT /rpt_family="MaLR" FT repeat_region 1638640..1638683 FT /rpt_family="MaLR" FT repeat_region 1639245..1639340 FT /rpt_family="MIR" FT repeat_region 1640210..1640601 FT /rpt_family="CR1" FT repeat_region 1641013..1641281 FT /rpt_family="Alu" FT repeat_region 1641305..1641439 FT /rpt_family="Alu" FT repeat_region 1641478..1641498 FT /rpt_family="AT_rich" FT misc_feature 1641705..1641923 FT /note="CpG_island (%GC=67.1, o/e=0.77, #CpGs=17)" FT repeat_region 1641991..1642160 FT /rpt_family="MIR" FT repeat_region 1642315..1642434 FT /rpt_family="MaLR" FT repeat_region 1642435..1642570 FT /rpt_family="Alu" FT repeat_region 1642571..1642583 FT /rpt_family="MaLR" FT repeat_region 1642584..1642873 FT /rpt_family="Alu" FT repeat_region 1642874..1643137 FT /rpt_family="MaLR" FT misc_feature 1643624..1643848 FT /note="CpG_island (%GC=68.4, o/e=0.77, #CpGs=20)" FT repeat_region 1644224..1644263 FT /rpt_family="(TTCA)n" FT repeat_region 1644432..1644643 FT /rpt_family="Alu" FT repeat_region 1644652..1644943 FT /rpt_family="L1" FT repeat_region 1644944..1645256 FT /rpt_family="Alu" FT repeat_region 1645257..1645570 FT /rpt_family="L1" FT repeat_region 1645304..1645570 FT /rpt_family="L1" FT repeat_region 1645571..1645673 FT /rpt_family="MIR" FT repeat_region 1645859..1646037 FT /rpt_family="Alu" FT repeat_region 1646108..1646145 FT /rpt_family="(TTCA)n" FT repeat_region 1646247..1646427 FT /rpt_family="C-rich" FT repeat_region 1646400..1646579 FT /rpt_family="CT-rich" FT repeat_region 1646718..1646772 FT /rpt_family="CT-rich" FT repeat_region 1646786..1646896 FT /rpt_family="L1" FT repeat_region 1646922..1646948 FT /rpt_family="(CA)n" FT repeat_region 1647491..1647561 FT /rpt_family="(GGCTG)n" FT repeat_region 1647562..1647684 FT /rpt_family="MIR" FT repeat_region 1648105..1648426 FT /rpt_family="L2" FT repeat_region 1648476..1648578 FT /rpt_family="MaLR" FT repeat_region 1648900..1649062 FT /rpt_family="L2" FT repeat_region 1649063..1649360 FT /rpt_family="Alu" FT repeat_region 1649361..1649458 FT /rpt_family="L2" FT repeat_region 1649474..1649733 FT /rpt_family="L2" FT repeat_region 1650873..1651041 FT /rpt_family="MIR" FT repeat_region 1651057..1651359 FT /rpt_family="Alu" FT repeat_region 1651807..1651952 FT /rpt_family="L2" FT repeat_region 1651953..1652235 FT /rpt_family="Alu" FT repeat_region 1652236..1652391 FT /rpt_family="L2" FT repeat_region 1652392..1652705 FT /rpt_family="Alu" FT repeat_region 1652804..1653086 FT /rpt_family="Alu" FT repeat_region 1653088..1653116 FT /rpt_family="ERV1" FT repeat_region 1653117..1653452 FT /rpt_family="Alu" FT repeat_region 1653453..1653835 FT /rpt_family="ERV1" FT repeat_region 1653836..1654105 FT /rpt_family="Alu" FT repeat_region 1655675..1655969 FT /rpt_family="Alu" FT repeat_region 1656155..1656332 FT /rpt_family="MER1_type" FT repeat_region 1656352..1656513 FT /rpt_family="ERV1" FT repeat_region 1656536..1656629 FT /rpt_family="MIR" FT repeat_region 1656993..1657101 FT /rpt_family="MaLR" FT repeat_region 1657102..1657414 FT /rpt_family="Alu" FT repeat_region 1657415..1657716 FT /rpt_family="MaLR" FT repeat_region 1657860..1658640 FT /rpt_family="(TG)n" FT repeat_region 1658658..1658831 FT /rpt_family="(TG)n" FT repeat_region 1658865..1659039 FT /rpt_family="(TG)n" FT misc_feature 1659041..1659845 FT /note="CpG_island (%GC=69.6, o/e=0.82, #CpGs=65)" FT repeat_region 1659775..1659894 FT /rpt_family="MaLR" FT repeat_region 1659898..1660210 FT /rpt_family="Alu" FT repeat_region 1660221..1660339 FT /rpt_family="L1" FT misc_feature 1660363..1660781 FT /note="CpG_island (%GC=65.9, o/e=0.79, #CpGs=33)" FT repeat_region 1660837..1661009 FT /rpt_family="L1" FT repeat_region 1661409..1661469 FT /rpt_family="Alu" FT repeat_region 1661470..1661680 FT /rpt_family="Alu" FT repeat_region 1661681..1661730 FT /rpt_family="Alu" FT repeat_region 1661731..1662033 FT /rpt_family="Alu" FT repeat_region 1662450..1662589 FT /rpt_family="Alu" FT repeat_region 1662598..1662900 FT /rpt_family="Alu" FT repeat_region 1662920..1663188 FT /rpt_family="Alu" FT repeat_region 1663189..1663345 FT /rpt_family="Alu" FT repeat_region 1663346..1663376 FT /rpt_family="(TA)n" FT repeat_region 1663388..1663531 FT /rpt_family="Alu" FT repeat_region 1663836..1664109 FT /rpt_family="MaLR" FT repeat_region 1664110..1664411 FT /rpt_family="Alu" FT repeat_region 1664412..1664518 FT /rpt_family="MaLR" FT repeat_region 1665639..1665820 FT /rpt_family="Alu" FT repeat_region 1665821..1666115 FT /rpt_family="Alu" FT repeat_region 1666116..1666224 FT /rpt_family="Alu" FT repeat_region 1666248..1666917 FT /rpt_family="L1" FT repeat_region 1666918..1667223 FT /rpt_family="Alu" FT repeat_region 1667224..1667387 FT /rpt_family="L1" FT repeat_region 1667388..1667697 FT /rpt_family="Alu" FT repeat_region 1667698..1667856 FT /rpt_family="L1" FT repeat_region 1667851..1668020 FT /rpt_family="L1" FT repeat_region 1668038..1668203 FT /rpt_family="Alu" FT repeat_region 1668207..1668405 FT /rpt_family="Alu" FT repeat_region 1668409..1668782 FT /rpt_family="L1" FT repeat_region 1668783..1669080 FT /rpt_family="Alu" FT repeat_region 1669081..1669627 FT /rpt_family="L1" FT repeat_region 1669639..1669944 FT /rpt_family="Alu" FT repeat_region 1670332..1670508 FT /rpt_family="(TCCA)n" FT repeat_region 1670537..1670710 FT /rpt_family="(TCCA)n" FT repeat_region 1670734..1670908 FT /rpt_family="(TCCA)n" FT repeat_region 1670944..1671091 FT /rpt_family="MIR" FT repeat_region 1671619..1671921 FT /rpt_family="Alu" FT repeat_region 1674284..1674678 FT /rpt_family="MaLR" FT repeat_region 1675030..1675549 FT /rpt_family="MaLR" FT repeat_region 1676019..1676329 FT /rpt_family="Alu" FT repeat_region 1676333..1676459 FT /rpt_family="L1" FT repeat_region 1676460..1676754 FT /rpt_family="Alu" FT repeat_region 1676755..1677191 FT /rpt_family="L1" FT repeat_region 1677258..1677549 FT /rpt_family="Alu" FT repeat_region 1677550..1677645 FT /rpt_family="Alu" FT repeat_region 1677750..1677866 FT /rpt_family="MIR" FT repeat_region 1678420..1678719 FT /rpt_family="Alu" FT repeat_region 1678748..1678891 FT /rpt_family="MaLR" FT repeat_region 1678951..1679064 FT /rpt_family="MaLR" FT repeat_region 1679743..1680012 FT /rpt_family="Alu" FT repeat_region 1680991..1681347 FT /rpt_family="L2" FT repeat_region 1681506..1681537 FT /rpt_family="MIR" FT repeat_region 1681929..1682010 FT /rpt_family="MIR" FT repeat_region 1682321..1682443 FT /rpt_family="(TCCC)n" FT repeat_region 1682828..1682896 FT /rpt_family="(TTCC)n" FT repeat_region 1682901..1683179 FT /rpt_family="Alu" FT repeat_region 1683469..1683631 FT /rpt_family="Alu" FT repeat_region 1683673..1683727 FT /rpt_family="L2" FT repeat_region 1683785..1684080 FT /rpt_family="Alu" FT repeat_region 1684120..1684214 FT /rpt_family="MIR" FT repeat_region 1685313..1685398 FT /rpt_family="MIR" FT repeat_region 1685667..1685966 FT /rpt_family="Alu" FT repeat_region 1685968..1685990 FT /rpt_family="(T)n" FT repeat_region 1685992..1686149 FT /rpt_family="Alu" FT repeat_region 1686582..1686688 FT /rpt_family="MIR" FT misc_feature 1686717..1687008 FT /note="CpG_island (%GC=61.3, o/e=0.77, #CpGs=24)" FT repeat_region 1687464..1687630 FT /rpt_family="MIR" FT repeat_region 1688261..1688643 FT /rpt_family="MaLR" FT repeat_region 1688854..1689049 FT /rpt_family="MIR" FT repeat_region 1689113..1689390 FT /rpt_family="Alu" FT repeat_region 1689741..1689853 FT /rpt_family="CR1" FT repeat_region 1690656..1690836 FT /rpt_family="L2" FT repeat_region 1691759..1691861 FT /rpt_family="MIR" FT repeat_region 1691871..1692031 FT /rpt_family="MaLR" FT repeat_region 1692032..1692179 FT /rpt_family="Alu" FT repeat_region 1692195..1692495 FT /rpt_family="Alu" FT repeat_region 1692500..1692812 FT /rpt_family="Alu" FT misc_feature 1692529..1692809 FT /note="CpG_island (%GC=61.9, o/e=0.82, #CpGs=23)" FT repeat_region 1692820..1693099 FT /rpt_family="MaLR" FT repeat_region 1693318..1693781 FT /rpt_family="(CA)n" FT repeat_region 1694805..1695138 FT /rpt_family="MER2_type" FT repeat_region 1695172..1695197 FT /rpt_family="(TCCC)n" FT repeat_region 1695208..1695233 FT /rpt_family="AT_rich" FT repeat_region 1695284..1695601 FT /rpt_family="Alu" FT repeat_region 1695763..1695850 FT /rpt_family="MIR" FT repeat_region 1696165..1696278 FT /rpt_family="L1" FT repeat_region 1696279..1696578 FT /rpt_family="Alu" FT repeat_region 1696579..1696687 FT /rpt_family="L1" FT repeat_region 1696952..1697160 FT /rpt_family="MIR" FT repeat_region 1697263..1697323 FT /rpt_family="L1" FT repeat_region 1697324..1697622 FT /rpt_family="Alu" FT repeat_region 1697623..1697912 FT /rpt_family="L1" FT repeat_region 1697913..1698215 FT /rpt_family="Alu" FT repeat_region 1698216..1698699 FT /rpt_family="L1" FT repeat_region 1698700..1698979 FT /rpt_family="Alu" FT repeat_region 1698980..1699034 FT /rpt_family="L1" FT repeat_region 1699035..1699342 FT /rpt_family="Alu" FT repeat_region 1699343..1699780 FT /rpt_family="L1" FT repeat_region 1699781..1700075 FT /rpt_family="Alu" FT repeat_region 1700078..1700214 FT /rpt_family="MIR" FT repeat_region 1700297..1700461 FT /rpt_family="L1" FT repeat_region 1700472..1700492 FT /rpt_family="AT_rich" FT repeat_region 1700501..1700803 FT /rpt_family="Alu" FT repeat_region 1700963..1701533 FT /rpt_family="L1" FT repeat_region 1702213..1702429 FT /rpt_family="Alu" FT repeat_region 1702743..1702907 FT /rpt_family="MIR" FT repeat_region 1703291..1703416 FT /rpt_family="GA-rich" FT misc_feature 1703862..1710517 FT /note="CpG_island (%GC=72.0, o/e=0.83, #CpGs=639)" FT repeat_region 1704283..1704327 FT /rpt_family="(TCCCC)n" FT repeat_region 1705281..1705357 FT /rpt_family="C-rich" FT repeat_region 1705459..1705541 FT /rpt_family="GC_rich" FT repeat_region 1705711..1705730 FT /rpt_family="(CCG)n" FT repeat_region 1706423..1706460 FT /rpt_family="GC_rich" FT repeat_region 1706615..1706639 FT /rpt_family="(GGCTG)n" FT repeat_region 1707321..1707344 FT /rpt_family="GC_rich" FT repeat_region 1708985..1709019 FT /rpt_family="GC_rich" FT repeat_region 1709096..1709261 FT /rpt_family="MIR" FT repeat_region 1709767..1709823 FT /rpt_family="(GGGA)n" FT repeat_region 1709843..1709881 FT /rpt_family="GC_rich" FT repeat_region 1710834..1710943 FT /rpt_family="MIR" FT repeat_region 1712856..1712910 FT /rpt_family="MIR" FT repeat_region 1713379..1713499 FT /rpt_family="MIR" FT repeat_region 1714537..1714666 FT /rpt_family="MIR" FT repeat_region 1715715..1715833 FT /rpt_family="CR1" FT repeat_region 1716053..1716131 FT /rpt_family="MIR" FT repeat_region 1716310..1716711 FT /rpt_family="L2" FT repeat_region 1718055..1718169 FT /rpt_family="MIR" FT repeat_region 1718760..1718833 FT /rpt_family="(CA)n" FT repeat_region 1719695..1719722 FT /rpt_family="(TTCA)n" FT repeat_region 1720215..1720373 FT /rpt_family="L1" FT repeat_region 1720374..1720677 FT /rpt_family="Alu" FT repeat_region 1720678..1721002 FT /rpt_family="L1" FT repeat_region 1721003..1721284 FT /rpt_family="Alu" FT repeat_region 1721285..1722064 FT /rpt_family="L1" FT repeat_region 1722065..1722092 FT /rpt_family="(TTTTA)n" FT repeat_region 1722095..1722338 FT /rpt_family="Alu" FT repeat_region 1722347..1723123 FT /rpt_family="L1" FT repeat_region 1723126..1723502 FT /rpt_family="L1" FT repeat_region 1723503..1723795 FT /rpt_family="Alu" FT repeat_region 1723796..1723966 FT /rpt_family="L1" FT repeat_region 1723961..1724043 FT /rpt_family="L1" FT repeat_region 1724045..1725391 FT /rpt_family="L1" FT repeat_region 1725418..1725440 FT /rpt_family="AT_rich" FT repeat_region 1725487..1725612 FT /rpt_family="(TTATA)n" FT repeat_region 1725617..1725914 FT /rpt_family="L1" FT repeat_region 1725922..1725947 FT /rpt_family="L1" FT repeat_region 1725948..1726112 FT /rpt_family="Alu" FT repeat_region 1726113..1726332 FT /rpt_family="L1" FT repeat_region 1726507..1726721 FT /rpt_family="L1" FT repeat_region 1726832..1726959 FT /rpt_family="L1" FT repeat_region 1727021..1727151 FT /rpt_family="L1" FT repeat_region 1727159..1727218 FT /rpt_family="L1" FT repeat_region 1727220..1727392 FT /rpt_family="L1" FT repeat_region 1727434..1727520 FT /rpt_family="L1" FT repeat_region 1727521..1727808 FT /rpt_family="Alu" FT repeat_region 1727809..1728247 FT /rpt_family="L1" FT repeat_region 1728254..1728563 FT /rpt_family="L1" FT repeat_region 1728564..1728642 FT /rpt_family="MER2_type" FT repeat_region 1728708..1728834 FT /rpt_family="L1" FT repeat_region 1729690..1729961 FT /rpt_family="(TGGA)n" FT repeat_region 1729980..1730153 FT /rpt_family="(TGGA)n" FT repeat_region 1730185..1730360 FT /rpt_family="(TGGA)n" FT repeat_region 1730376..1730536 FT /rpt_family="(TGGA)n" FT repeat_region 1730694..1730842 FT /rpt_family="MIR" FT repeat_region 1731021..1731075 FT /rpt_family="L2" FT repeat_region 1731142..1731232 FT /rpt_family="MIR" FT repeat_region 1731734..1731810 FT /rpt_family="MIR" FT repeat_region 1732370..1732502 FT /rpt_family="MIR" FT repeat_region 1732565..1732709 FT /rpt_family="MIR" FT repeat_region 1735100..1735408 FT /rpt_family="Alu" FT repeat_region 1735437..1735530 FT /rpt_family="L2" FT repeat_region 1735531..1735617 FT /rpt_family="L2" FT repeat_region 1735618..1735811 FT /rpt_family="MaLR" FT repeat_region 1735812..1735842 FT /rpt_family="(TG)n" FT repeat_region 1735843..1735994 FT /rpt_family="(GA)n" FT repeat_region 1736017..1736337 FT /rpt_family="Alu" FT repeat_region 1736345..1736495 FT /rpt_family="MaLR" FT repeat_region 1736660..1736740 FT /rpt_family="MIR" FT repeat_region 1737430..1737544 FT /rpt_family="Alu" FT repeat_region 1738226..1738372 FT /rpt_family="L1" FT repeat_region 1738433..1738955 FT /rpt_family="L1" FT repeat_region 1738992..1739291 FT /rpt_family="Alu" FT repeat_region 1739307..1739347 FT /rpt_family="L1" FT repeat_region 1739348..1739635 FT /rpt_family="Alu" FT repeat_region 1739636..1739786 FT /rpt_family="L1" FT repeat_region 1740027..1740186 FT /rpt_family="L1" FT repeat_region 1740318..1740629 FT /rpt_family="L1" FT repeat_region 1740690..1740830 FT /rpt_family="(TG)n" FT repeat_region 1740835..1741040 FT /rpt_family="Alu" FT repeat_region 1741042..1741163 FT /rpt_family="L1" FT repeat_region 1741164..1741440 FT /rpt_family="Alu" FT repeat_region 1741481..1741778 FT /rpt_family="L1" FT repeat_region 1741779..1742082 FT /rpt_family="Alu" FT repeat_region 1742083..1742578 FT /rpt_family="L1" FT repeat_region 1742580..1742917 FT /rpt_family="L1" FT repeat_region 1742922..1743214 FT /rpt_family="L1" FT repeat_region 1743445..1743540 FT /rpt_family="MIR" FT repeat_region 1743580..1743790 FT /rpt_family="MIR" FT repeat_region 1744029..1744121 FT /rpt_family="(CA)n" FT repeat_region 1745602..1745697 FT /rpt_family="MIR" FT repeat_region 1745779..1746106 FT /rpt_family="Alu" FT repeat_region 1746589..1746693 FT /rpt_family="(CATG)n" FT repeat_region 1747801..1747977 FT /rpt_family="MIR" FT repeat_region 1750172..1750327 FT /rpt_family="MIR" FT repeat_region 1750465..1750642 FT /rpt_family="MIR" FT repeat_region 1751049..1751107 FT /rpt_family="G-rich" FT repeat_region 1751195..1751263 FT /rpt_family="(GA)n" FT repeat_region 1751811..1751879 FT /rpt_family="Alu" FT repeat_region 1751880..1752055 FT /rpt_family="Alu" FT repeat_region 1752056..1752365 FT /rpt_family="Alu" FT repeat_region 1752859..1752910 FT /rpt_family="L2" FT misc_feature 1753447..1753706 FT /note="CpG_island (%GC=65.4, o/e=0.59, #CpGs=19)" FT repeat_region 1754062..1754414 FT /rpt_family="MER1_type" FT repeat_region 1754415..1754658 FT /rpt_family="MaLR" FT repeat_region 1754838..1754884 FT /rpt_family="L2" FT repeat_region 1755626..1755722 FT /rpt_family="MIR" FT repeat_region 1757604..1757950 FT /rpt_family="MaLR" FT repeat_region 1758196..1758287 FT /rpt_family="AcHobo" FT repeat_region 1760542..1760715 FT /rpt_family="MIR" FT repeat_region 1760747..1760811 FT /rpt_family="MIR" FT repeat_region 1760939..1760986 FT /rpt_family="MIR" FT repeat_region 1761071..1761171 FT /rpt_family="L2" FT repeat_region 1761430..1761551 FT /rpt_family="MIR" FT repeat_region 1761769..1761901 FT /rpt_family="MER1_type" FT repeat_region 1761902..1762204 FT /rpt_family="Alu" FT repeat_region 1762219..1762360 FT /rpt_family="CR1" FT repeat_region 1762389..1762422 FT /rpt_family="AT_rich" FT repeat_region 1762549..1762838 FT /rpt_family="Alu" FT repeat_region 1762840..1762957 FT /rpt_family="L1" FT repeat_region 1763089..1763361 FT /rpt_family="L1" FT repeat_region 1763632..1763846 FT /rpt_family="MIR" FT repeat_region 1765418..1765588 FT /rpt_family="(CA)n" FT repeat_region 1765679..1765742 FT /rpt_family="(CA)n" FT repeat_region 1766573..1766709 FT /rpt_family="MIR" FT repeat_region 1767281..1767538 FT /rpt_family="Alu" FT repeat_region 1767684..1767735 FT /rpt_family="MIR" FT repeat_region 1768573..1768726 FT /rpt_family="MIR" FT repeat_region 1769219..1769330 FT /rpt_family="MaLR" FT repeat_region 1769993..1771125 FT /rpt_family="L1" FT repeat_region 1771139..1771263 FT /rpt_family="AcHobo" FT repeat_region 1771280..1771584 FT /rpt_family="Alu" FT repeat_region 1772124..1772267 FT /rpt_family="L1" FT repeat_region 1772531..1772836 FT /rpt_family="Alu" FT repeat_region 1774327..1774627 FT /rpt_family="Alu" FT repeat_region 1774717..1774780 FT /rpt_family="MIR" FT repeat_region 1775419..1775609 FT /rpt_family="MIR" FT repeat_region 1776331..1776405 FT /rpt_family="MIR" FT repeat_region 1777311..1777379 FT /rpt_family="CR1" FT repeat_region 1778091..1778258 FT /rpt_family="Alu" FT repeat_region 1778387..1778543 FT /rpt_family="L2" FT repeat_region 1779631..1779724 FT /rpt_family="MER1_type" FT repeat_region 1780387..1780455 FT /rpt_family="MIR" FT repeat_region 1780484..1780795 FT /rpt_family="Alu" FT repeat_region 1781580..1781715 FT /rpt_family="(CA)n" FT repeat_region 1783656..1783713 FT /rpt_family="MIR" FT misc_feature 1784028..1786934 FT /note="CpG_island (%GC=68.8, o/e=0.70, #CpGs=255)" FT repeat_region 1785045..1785079 FT /rpt_family="GC_rich" FT repeat_region 1786939..1786971 FT /rpt_family="(CA)n" FT repeat_region 1787021..1787101 FT /rpt_family="T-rich" FT repeat_region 1789395..1789501 FT /rpt_family="MIR" FT repeat_region 1789823..1790099 FT /rpt_family="L2" FT repeat_region 1790257..1790367 FT /rpt_family="MIR" FT repeat_region 1791460..1791755 FT /rpt_family="Alu" FT repeat_region 1792077..1792371 FT /rpt_family="Alu" FT repeat_region 1792439..1792552 FT /rpt_family="L1" FT repeat_region 1792671..1792945 FT /rpt_family="L2" FT repeat_region 1792998..1793467 FT /rpt_family="L1" FT repeat_region 1793468..1793766 FT /rpt_family="Alu" FT repeat_region 1793767..1794319 FT /rpt_family="L1" FT repeat_region 1794331..1794438 FT /rpt_family="L1" FT repeat_region 1794444..1794751 FT /rpt_family="Alu" FT repeat_region 1794754..1795072 FT /rpt_family="L1" FT repeat_region 1795302..1795415 FT /rpt_family="MER105" FT repeat_region 1795896..1795973 FT /rpt_family="(CCCTAA)n" FT repeat_region 1796007..1796103 FT /rpt_family="(CCCTAA)n" FT repeat_region 1796182..1796494 FT /rpt_family="Alu" FT repeat_region 1796621..1796924 FT /rpt_family="ERV1" FT repeat_region 1797087..1797203 FT /rpt_family="Alu" FT repeat_region 1797266..1797755 FT /rpt_family="ERVL" FT repeat_region 1797843..1797934 FT /rpt_family="ERVL" FT repeat_region 1798087..1798280 FT /rpt_family="(CTGGGG)n" FT repeat_region 1798288..1798553 FT /rpt_family="ERVL" FT repeat_region 1798785..1799313 FT /rpt_family="ERVL" FT repeat_region 1799413..1799492 FT /rpt_family="ERVL" FT repeat_region 1799501..1799798 FT /rpt_family="Alu" FT repeat_region 1799800..1800017 FT /rpt_family="MaLR" FT repeat_region 1800368..1800679 FT /rpt_family="Alu" FT repeat_region 1800795..1800863 FT /rpt_family="L1" FT repeat_region 1801064..1801378 FT /rpt_family="Alu" FT repeat_region 1801567..1801892 FT /rpt_family="L1" FT repeat_region 1801956..1802243 FT /rpt_family="(TG)n" FT repeat_region 1802521..1802627 FT /rpt_family="MIR" FT repeat_region 1802657..1802951 FT /rpt_family="Alu" FT repeat_region 1803038..1803135 FT /rpt_family="MIR" FT repeat_region 1803776..1803914 FT /rpt_family="Alu" FT repeat_region 1803915..1804212 FT /rpt_family="Alu" FT repeat_region 1804213..1804383 FT /rpt_family="Alu" FT repeat_region 1804413..1804551 FT /rpt_family="MER1_type" FT repeat_region 1804552..1804856 FT /rpt_family="Alu" FT repeat_region 1804857..1805063 FT /rpt_family="MER1_type" FT repeat_region 1805064..1805528 FT /rpt_family="MaLR" FT repeat_region 1805529..1805542 FT /rpt_family="MER1_type" FT repeat_region 1805543..1805862 FT /rpt_family="Alu" FT repeat_region 1805873..1806083 FT /rpt_family="Alu" FT repeat_region 1806084..1806383 FT /rpt_family="Alu" FT repeat_region 1806384..1806479 FT /rpt_family="Alu" FT repeat_region 1806480..1806610 FT /rpt_family="MER1_type" FT repeat_region 1806611..1806650 FT /rpt_family="(TG)n" FT repeat_region 1806651..1806755 FT /rpt_family="MER1_type" FT repeat_region 1806765..1807172 FT /rpt_family="MaLR" FT repeat_region 1807268..1807310 FT /rpt_family="(CA)n" FT repeat_region 1807657..1807955 FT /rpt_family="Alu" FT repeat_region 1807994..1808089 FT /rpt_family="L1" FT repeat_region 1808266..1808458 FT /rpt_family="L1" FT repeat_region 1808462..1808920 FT /rpt_family="ERV1" FT misc_feature 1808924..1809360 FT /note="CpG_island (%GC=59.5, o/e=1.16, #CpGs=36)" FT repeat_region 1809725..1809989 FT /rpt_family="Alu" FT repeat_region 1810338..1810492 FT /rpt_family="L1" FT repeat_region 1810500..1810597 FT /rpt_family="Alu" FT repeat_region 1810598..1810624 FT /rpt_family="L1" FT repeat_region 1810625..1810934 FT /rpt_family="Alu" FT repeat_region 1810935..1811022 FT /rpt_family="L1" FT repeat_region 1811016..1811086 FT /rpt_family="L1" FT repeat_region 1811089..1811132 FT /rpt_family="AT_rich" FT repeat_region 1811138..1811442 FT /rpt_family="Alu" FT repeat_region 1811443..1811566 FT /rpt_family="L1" FT repeat_region 1811571..1811700 FT /rpt_family="L1" FT repeat_region 1811701..1811988 FT /rpt_family="Alu" FT repeat_region 1811989..1812429 FT /rpt_family="L1" FT repeat_region 1812430..1812728 FT /rpt_family="Alu" FT repeat_region 1812729..1813432 FT /rpt_family="L1" FT repeat_region 1813433..1813725 FT /rpt_family="Alu" FT repeat_region 1813726..1813826 FT /rpt_family="L1" FT repeat_region 1813827..1813870 FT /rpt_family="(TG)n" FT repeat_region 1813871..1814254 FT /rpt_family="L1" FT repeat_region 1814269..1814563 FT /rpt_family="Alu" FT repeat_region 1814564..1815837 FT /rpt_family="L1" FT repeat_region 1815864..1815906 FT /rpt_family="CT-rich" FT repeat_region 1815931..1816062 FT /rpt_family="Alu" FT repeat_region 1816255..1816427 FT /rpt_family="L1" FT repeat_region 1816428..1816740 FT /rpt_family="Alu" FT repeat_region 1816741..1817189 FT /rpt_family="L1" FT repeat_region 1817190..1817483 FT /rpt_family="Alu" FT repeat_region 1817484..1817787 FT /rpt_family="L1" FT repeat_region 1817795..1818180 FT /rpt_family="L1" FT repeat_region 1818237..1818314 FT /rpt_family="L1" FT repeat_region 1818315..1818643 FT /rpt_family="Alu" FT repeat_region 1818644..1818781 FT /rpt_family="L1" FT repeat_region 1818855..1819148 FT /rpt_family="Alu" FT repeat_region 1819171..1819478 FT /rpt_family="MER2_type" FT repeat_region 1819479..1819781 FT /rpt_family="Alu" FT repeat_region 1819782..1820016 FT /rpt_family="MER2_type" FT repeat_region 1820017..1820325 FT /rpt_family="Alu" FT repeat_region 1820326..1820637 FT /rpt_family="MER2_type" FT repeat_region 1820638..1820926 FT /rpt_family="Alu" FT repeat_region 1820927..1821309 FT /rpt_family="MER2_type" FT repeat_region 1821431..1821671 FT /rpt_family="ERV1" FT repeat_region 1821672..1821974 FT /rpt_family="Alu" FT repeat_region 1821975..1822200 FT /rpt_family="ERV1" FT repeat_region 1822211..1822622 FT /rpt_family="L1" FT repeat_region 1822623..1822792 FT /rpt_family="Alu" FT repeat_region 1822793..1823108 FT /rpt_family="Alu" FT repeat_region 1823109..1824065 FT /rpt_family="L1" FT repeat_region 1824092..1824403 FT /rpt_family="Alu" FT repeat_region 1824603..1824913 FT /rpt_family="L1" FT repeat_region 1824914..1825212 FT /rpt_family="Alu" FT repeat_region 1825213..1825435 FT /rpt_family="L1" FT repeat_region 1825441..1825720 FT /rpt_family="L1" FT repeat_region 1825770..1825790 FT /rpt_family="L1" FT repeat_region 1825791..1826102 FT /rpt_family="Alu" FT repeat_region 1826103..1826547 FT /rpt_family="L1" FT repeat_region 1826548..1826849 FT /rpt_family="Alu" FT repeat_region 1826850..1827130 FT /rpt_family="L1" FT repeat_region 1827329..1827510 FT /rpt_family="MER1_type" FT repeat_region 1827625..1827680 FT /rpt_family="MER1_type" FT repeat_region 1827685..1827978 FT /rpt_family="Alu" FT repeat_region 1828058..1828297 FT /rpt_family="L1" FT repeat_region 1828545..1828751 FT /rpt_family="L1" FT repeat_region 1828821..1829123 FT /rpt_family="Alu" FT repeat_region 1829134..1829477 FT /rpt_family="L1" FT repeat_region 1829478..1829772 FT /rpt_family="Alu" FT repeat_region 1829773..1829973 FT /rpt_family="L1" FT repeat_region 1829975..1830290 FT /rpt_family="Alu" FT repeat_region 1830295..1830383 FT /rpt_family="L1" FT repeat_region 1830384..1830678 FT /rpt_family="Alu" FT repeat_region 1830679..1830875 FT /rpt_family="L1" FT repeat_region 1830900..1831197 FT /rpt_family="Alu" FT repeat_region 1831220..1831435 FT /rpt_family="L1" FT repeat_region 1831436..1831727 FT /rpt_family="Alu" FT repeat_region 1831728..1831877 FT /rpt_family="L1" FT repeat_region 1831878..1832173 FT /rpt_family="Alu" FT repeat_region 1832174..1832419 FT /rpt_family="L1" FT repeat_region 1832510..1832626 FT /rpt_family="Alu" FT repeat_region 1832694..1832771 FT /rpt_family="L1" FT repeat_region 1832772..1833071 FT /rpt_family="Alu" FT repeat_region 1833072..1834875 FT /rpt_family="L1" FT repeat_region 1834894..1835027 FT /rpt_family="ERVL" FT repeat_region 1835908..1836023 FT /rpt_family="ERVL" FT repeat_region 1836026..1836200 FT /rpt_family="L1" FT repeat_region 1836201..1836225 FT /rpt_family="(GGA)n" FT repeat_region 1836226..1836668 FT /rpt_family="L1" FT repeat_region 1836669..1836966 FT /rpt_family="Alu" FT repeat_region 1836967..1837415 FT /rpt_family="L1" FT repeat_region 1837418..1837600 FT /rpt_family="Alu" FT repeat_region 1837607..1838240 FT /rpt_family="L1" FT repeat_region 1838224..1838252 FT /rpt_family="L1" FT repeat_region 1838253..1838553 FT /rpt_family="Alu" FT repeat_region 1838554..1838836 FT /rpt_family="Alu" FT repeat_region 1838837..1839004 FT /rpt_family="L1" FT repeat_region 1839005..1839296 FT /rpt_family="Alu" FT repeat_region 1839084..1839296 FT /rpt_family="Alu" FT repeat_region 1839297..1839523 FT /rpt_family="L1" FT repeat_region 1839524..1839818 FT /rpt_family="Alu" FT repeat_region 1839819..1839937 FT /rpt_family="L1" FT repeat_region 1840103..1840406 FT /rpt_family="Alu" FT repeat_region 1840614..1841321 FT /rpt_family="L1" FT repeat_region 1841322..1841620 FT /rpt_family="Alu" FT repeat_region 1841621..1841967 FT /rpt_family="L1" FT repeat_region 1841980..1842273 FT /rpt_family="Alu" FT repeat_region 1842776..1842890 FT /rpt_family="ERV1" FT repeat_region 1842891..1843190 FT /rpt_family="Alu" FT misc_feature 1842899..1842908 FT /note="match to EST BG186123 (NID:g13707874)" FT /note="match to EST BG207385 (NID:g13729072)" FT repeat_region 1843191..1843552 FT /rpt_family="ERV1" FT repeat_region 1843558..1844216 FT /rpt_family="ERV1" FT repeat_region 1844513..1844879 FT /rpt_family="MaLR" FT repeat_region 1844930..1845236 FT /rpt_family="Alu" FT repeat_region 1845300..1845611 FT /rpt_family="Alu" FT repeat_region 1845615..1845777 FT /rpt_family="Alu" FT repeat_region 1845779..1846088 FT /rpt_family="Alu" FT repeat_region 1846442..1846611 FT /rpt_family="L1" FT repeat_region 1846627..1846673 FT /rpt_family="(TA)n" FT repeat_region 1846674..1846966 FT /rpt_family="Alu" FT repeat_region 1846967..1846972 FT /rpt_family="(TA)n" FT repeat_region 1846973..1847264 FT /rpt_family="Alu" FT repeat_region 1847265..1847368 FT /rpt_family="(TA)n" FT repeat_region 1847381..1847457 FT /rpt_family="ERV1" FT repeat_region 1848192..1848290 FT /rpt_family="(CA)n" FT repeat_region 1848353..1848636 FT /rpt_family="Alu" FT repeat_region 1849320..1849456 FT /rpt_family="MIR" FT repeat_region 1849840..1850085 FT /rpt_family="MER1_type" FT repeat_region 1850343..1850440 FT /rpt_family="MaLR" FT misc_feature 1850404..1850860 FT /note="match to EST AA223921 (NID:g1844480) zr13d02.s1" FT repeat_region 1851007..1851052 FT /rpt_family="MIR" FT repeat_region 1851191..1851367 FT /rpt_family="(CACG)n" FT repeat_region 1851252..1851430 FT /rpt_family="(CA)n" FT repeat_region 1851707..1851822 FT /rpt_family="MIR" FT misc_feature 1851856..1852352 FT /note="similar to Homo sapiens EST AA224013 (NID:g1844555) FT zr13d02.r1" FT misc_feature 1853470..1853474 FT /note="match to EST T23944 (NID:g520184)" FT misc_feature 1854666..1854669 FT /note="similar to Homo sapiens EST BG497591 FT (NID:g13459119)" FT misc_feature 1855067..1855860 FT /note="similar to EST BM545871 (NID:g18778344)" FT misc_feature 1855244..1855245 FT /note="match to EST AW515920 (NID:g7154002) xy02c12.x1" FT misc_feature 1855429..1855864 FT /note="match to EST BG207385 (NID:g13729072)" FT /note="match to EST BG186123 (NID:g13707874)" FT misc_feature 1855429..1855748 FT /note="similar to EST BM894199 (NID:g19349667) ij64h12.x1" FT misc_feature 1855429..1855866 FT /note="match to EST AW515920 (NID:g7154002) xy02c12.x1" FT misc_feature 1855432..1855607 FT /note="match to EST D52048 (NID:g952284)" FT misc_feature 1855435..1855864 FT /note="similar to Homo sapiens EST BE397141 (NID:g9342506)" FT misc_feature 1855436..1855659 FT /note="match to EST T23944 (NID:g520184)" FT misc_feature 1855491..1855864 FT /note="similar to Homo sapiens EST BG497591 FT (NID:g13459119)" FT misc_feature 1855656..1855864 FT /note="similar to EST BM701009 (NID:g19014267)" FT misc_feature 1855681..1855866 FT /note="similar to Homo sapiens EST BF923237 FT (NID:g12319125)" FT misc_feature 1855784..1855785 FT /note="match to EST T23944 (NID:g520184)" FT misc_feature 1855821..1855866 FT /note="similar to EST BM894199 (NID:g19349667) ij64h12.x1" FT misc_feature 1855913..1855914 FT /note="match to EST BG207385 (NID:g13729072)" FT misc_feature 1856274..1856276 FT /note="match to EST BG186123 (NID:g13707874)" FT repeat_region 1856596..1857160 FT /rpt_family="L1" FT repeat_region 1858029..1858327 FT /rpt_family="Alu" FT misc_feature 1858551..1858877 FT /note="match to EST AA916543 (NID:g3055935) ol51g07.s1" FT misc_feature 1859032..1859350 FT /note="similar to Homo sapiens EST BG497591 FT (NID:g13459119)" FT repeat_region 1859744..1860121 FT /rpt_family="L1" FT repeat_region 1860122..1860383 FT /rpt_family="Alu" FT repeat_region 1860384..1860453 FT /rpt_family="L1" FT repeat_region 1860454..1860729 FT /rpt_family="Alu" FT misc_feature 1860719..1860729 FT /note="match to EST AA916543 (NID:g3055935) ol51g07.s1" FT repeat_region 1860730..1862078 FT /rpt_family="L1" FT repeat_region 1862079..1862359 FT /rpt_family="Alu" FT repeat_region 1862360..1862592 FT /rpt_family="L1" FT repeat_region 1862617..1862758 FT /rpt_family="L1" FT repeat_region 1862767..1863110 FT /rpt_family="L1" FT misc_feature 1863589..1864238 FT /note="match to EST AU120922 (NID:g10936157)" FT misc_feature 1863646..1863960 FT /note="match to EST AL044988 (NID:g5433173)" FT repeat_region 1863922..1863999 FT /rpt_family="MIR" FT repeat_region 1864627..1864757 FT /rpt_family="L1" FT repeat_region 1866061..1866129 FT /rpt_family="(CAGCC)n" FT repeat_region 1866596..1866623 FT /rpt_family="AT_rich" FT repeat_region 1867665..1867776 FT /rpt_family="MIR" FT repeat_region 1867786..1867909 FT /rpt_family="L1" FT repeat_region 1868082..1868339 FT /rpt_family="L1" FT repeat_region 1868340..1868381 FT /rpt_family="(CA)n" FT repeat_region 1868396..1868703 FT /rpt_family="L1" FT repeat_region 1868799..1869204 FT /rpt_family="MaLR" FT repeat_region 1869255..1869751 FT /rpt_family="L1" FT misc_feature 1869355..1869372 FT /note="match to EST AU120922 (NID:g10936157)" FT repeat_region 1869752..1870060 FT /rpt_family="Alu" FT repeat_region 1870061..1870704 FT /rpt_family="L1" FT repeat_region 1870726..1871352 FT /rpt_family="MER2_type" FT repeat_region 1871365..1872285 FT /rpt_family="MER2_type" FT misc_feature 1872270..1872288 FT /note="similar to Homo sapiens EST BE397141 (NID:g9342506)" FT repeat_region 1872286..1872567 FT /rpt_family="Alu" FT repeat_region 1872568..1872919 FT /rpt_family="MER2_type" FT repeat_region 1872938..1873294 FT /rpt_family="L1" FT repeat_region 1873295..1873590 FT /rpt_family="Alu" FT repeat_region 1873591..1875243 FT /rpt_family="L1" FT repeat_region 1875244..1875657 FT /rpt_family="ERV1" FT repeat_region 1875658..1875955 FT /rpt_family="Alu" FT repeat_region 1875956..1876190 FT /rpt_family="ERV1" FT repeat_region 1876191..1876319 FT /rpt_family="L1" FT repeat_region 1876326..1877433 FT /rpt_family="L1" FT repeat_region 1877895..1878400 FT /rpt_family="L1" FT repeat_region 1879164..1879303 FT /rpt_family="CR1" FT repeat_region 1879777..1879976 FT /rpt_family="L2" FT repeat_region 1880084..1880386 FT /rpt_family="Alu" FT misc_feature 1880421..1881479 FT /note="similar to EST BM920392 (NID:g19370771)" FT misc_feature 1880913..1881160 FT /note="match to EST BI769095 (NID:g15760673)" FT misc_feature 1881171..1881233 FT /note="match to EST T17181 (NID:g519343)" FT misc_feature 1881252..1881424 FT /note="similar to EST BM893657 (NID:g19349125) ij28a03.x1" FT misc_feature 1881254..1881424 FT /note="match to EST BI769095 (NID:g15760673)" FT misc_feature 1881352..1881649 FT /note="similar to Homo sapiens EST BI458854 FT (NID:g15249510)" FT repeat_region 1881405..1881438 FT /rpt_family="MIR" FT misc_feature 1881649..1881767 FT /note="similar to EST BM893657 (NID:g19349125) ij28a03.x1" FT misc_feature 1881922..1882052 FT /note="match to EST BI769095 (NID:g15760673)" FT misc_feature 1885034..1885402 FT /note="CpG_island (%GC=62.6, o/e=1.27, #CpGs=42)" FT repeat_region 1888684..1888806 FT /rpt_family="(CA)n" FT misc_feature 1890831..1891088 FT /note="CpG_island (%GC=69.0, o/e=0.83, #CpGs=19)" FT repeat_region 1892721..1892791 FT /rpt_family="L2" FT repeat_region 1892870..1892958 FT /rpt_family="CR1" FT repeat_region 1894035..1894325 FT /rpt_family="MaLR" FT repeat_region 1894443..1895178 FT /rpt_family="MaLR" FT repeat_region 1895179..1895200 FT /rpt_family="(CAGCC)n" FT repeat_region 1895201..1895496 FT /rpt_family="MaLR" FT repeat_region 1895529..1895795 FT /rpt_family="MaLR" FT misc_feature 1896091..1896451 FT /note="CpG_island (%GC=62.9, o/e=0.65, #CpGs=28)" FT repeat_region 1900813..1900903 FT /rpt_family="(CTGGGG)n" FT repeat_region 1901864..1901978 FT /rpt_family="MER1_type" FT repeat_region 1902311..1902470 FT /rpt_family="MER1_type" FT misc_feature 1902763..1903059 FT /note="CpG_island (%GC=68.7, o/e=0.64, #CpGs=23)" FT repeat_region 1903443..1903707 FT /rpt_family="Alu" FT repeat_region 1904262..1904640 FT /rpt_family="MaLR" FT misc_feature 1908540..1908803 FT /note="CpG_island (%GC=69.3, o/e=0.73, #CpGs=24)" FT misc_feature 1910398..1911256 FT /note="CpG_island (%GC=58.2, o/e=0.72, #CpGs=58)" FT misc_feature 1913830..1914077 FT /note="CpG_island (%GC=66.5, o/e=0.90, #CpGs=19)" FT repeat_region 1915405..1915738 FT /rpt_family="MaLR" FT repeat_region 1916113..1916213 FT /rpt_family="L1" FT repeat_region 1916706..1916812 FT /rpt_family="L1" FT repeat_region 1916813..1917014 FT /rpt_family="MER1_type" FT repeat_region 1917015..1917571 FT /rpt_family="L1" FT repeat_region 1917557..1918827 FT /rpt_family="L1" FT repeat_region 1918828..1919112 FT /rpt_family="Alu" FT repeat_region 1919113..1919375 FT /rpt_family="L1" FT repeat_region 1919376..1919665 FT /rpt_family="Alu" FT repeat_region 1919666..1919744 FT /rpt_family="L1" FT repeat_region 1920890..1921016 FT /rpt_family="T2_type" FT repeat_region 1921187..1921343 FT /rpt_family="L1" FT repeat_region 1921764..1921837 FT /rpt_family="CR1" FT repeat_region 1926884..1927059 FT /rpt_family="(TG)n" FT repeat_region 1927130..1927307 FT /rpt_family="(TG)n" FT repeat_region 1927378..1927545 FT /rpt_family="(TG)n" FT repeat_region 1927573..1927685 FT /rpt_family="(TG)n" FT repeat_region 1927697..1927874 FT /rpt_family="(TG)n" FT repeat_region 1927911..1928040 FT /rpt_family="(TG)n" FT repeat_region 1928082..1928270 FT /rpt_family="(CGTG)n" FT repeat_region 1928279..1928497 FT /rpt_family="(TG)n" FT repeat_region 1928700..1928886 FT /rpt_family="MIR" FT repeat_region 1929853..1930250 FT /rpt_family="MaLR" FT repeat_region 1930809..1930879 FT /rpt_family="MER2_type" FT repeat_region 1930880..1931183 FT /rpt_family="Alu" FT repeat_region 1931184..1931212 FT /rpt_family="MER2_type" FT repeat_region 1931213..1931516 FT /rpt_family="Alu" FT repeat_region 1931517..1932001 FT /rpt_family="MER2_type" FT repeat_region 1932034..1932288 FT /rpt_family="MER2_type" FT repeat_region 1933325..1933484 FT /rpt_family="MIR" FT repeat_region 1934158..1934240 FT /rpt_family="MIR" FT repeat_region 1934412..1934448 FT /rpt_family="GA-rich" FT repeat_region 1934631..1934785 FT /rpt_family="L2" FT misc_feature 1937739..1937946 FT /note="CpG_island (%GC=63.9, o/e=0.90, #CpGs=18)" FT gene complement(1937836..1938026) FT /gene="MAD1L1" FT mRNA complement(1937836..1938026) FT /gene="MAD1L1" FT CDS complement(<1937836..>1938026) FT /codon_start=3 FT /gene="MAD1L1" FT /product="unknown" FT /note="Homo sapiens MAD1 mitotic arrest deficient-like 1 FT (yeast) (MAD1L1), mRNA.; H_FH0596B14.1 This gene was based FT on gi(4505064 14602943) Continues from H_NH0416J17.1 FT Continues as H_NH0383A19.1" FT /protein_id="AAP21876.1" FT /translation="LKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQ FT YRLTSLYAEHPGDCLIFK" FT repeat_region 1943238..1943335 FT /rpt_family="L2" FT repeat_region 1943410..1943473 FT /rpt_family="L2" FT repeat_region 1943859..1943956 FT /rpt_family="L2" FT repeat_region 1944031..1944094 FT /rpt_family="L2" FT repeat_region 1945404..1945710 FT /rpt_family="Alu" FT repeat_region 1947234..1947293 FT /rpt_family="MIR" FT repeat_region 1947866..1948020 FT /rpt_family="L1" FT repeat_region 1948021..1948295 FT /rpt_family="Alu" FT repeat_region 1948296..1948455 FT /rpt_family="L1" FT repeat_region 1949034..1949055 FT /rpt_family="AT_rich" FT misc_feature 1950280..1950482 FT /note="CpG_island (%GC=64.5, o/e=0.83, #CpGs=15)" FT repeat_region 1951519..1951583 FT /rpt_family="L2" FT repeat_region 1953914..1954249 FT /rpt_family="MaLR" FT repeat_region 1954250..1954547 FT /rpt_family="Alu" FT repeat_region 1954548..1954608 FT /rpt_family="MaLR" FT repeat_region 1954743..1955143 FT /rpt_family="L2" FT misc_feature 1955042..1955446 FT /note="CpG_island (%GC=61.7, o/e=0.89, #CpGs=34)" FT repeat_region 1955331..1955440 FT /rpt_family="L1" FT repeat_region 1955481..1955607 FT /rpt_family="L1" FT repeat_region 1955733..1956082 FT /rpt_family="L1" FT repeat_region 1958505..1958525 FT /rpt_family="(TCCCC)n" FT repeat_region 1958782..1958925 FT /rpt_family="MIR" FT repeat_region 1959351..1959414 FT /rpt_family="MIR" FT repeat_region 1959784..1959868 FT /rpt_family="ERVL" FT repeat_region 1959872..1959905 FT /rpt_family="(CGTG)n" FT repeat_region 1960187..1960490 FT /rpt_family="L1" FT repeat_region 1960542..1960687 FT /rpt_family="L1" FT repeat_region 1960875..1960949 FT /rpt_family="L1" FT repeat_region 1960950..1961254 FT /rpt_family="Alu" FT repeat_region 1961255..1961363 FT /rpt_family="L1" FT repeat_region 1961375..1961570 FT /rpt_family="L1" FT repeat_region 1961645..1961824 FT /rpt_family="L1" FT repeat_region 1962195..1962592 FT /rpt_family="L1" FT repeat_region 1962631..1962880 FT /rpt_family="L1" FT repeat_region 1963421..1963528 FT /rpt_family="L1" FT repeat_region 1963592..1963785 FT /rpt_family="L1" FT repeat_region 1964056..1964789 FT /rpt_family="L1" FT repeat_region 1964766..1964997 FT /rpt_family="L1" FT repeat_region 1964998..1965333 FT /rpt_family="MaLR" FT repeat_region 1965334..1967607 FT /rpt_family="L1" FT misc_feature 1967665..1967994 FT /note="CpG_island (%GC=66.7, o/e=1.04, #CpGs=26)" FT repeat_region 1968776..1968897 FT /rpt_family="C-rich" FT misc_feature 1969337..1970264 FT /note="CpG_island (%GC=72.8, o/e=1.25, #CpGs=75)" FT unsure 1969341..1970160 FT /note="unresolved tandem repeat" FT repeat_region 1969360..1969553 FT /rpt_family="C-rich" FT repeat_region 1969565..1969752 FT /rpt_family="C-rich" FT repeat_region 1969790..1969961 FT /rpt_family="(CCCCG)n" FT repeat_region 1970003..1970234 FT /rpt_family="(CCCCG)n" FT misc_feature 1970628..1970924 FT /note="CpG_island (%GC=67.3, o/e=1.39, #CpGs=25)" FT repeat_region 1971044..1971505 FT /rpt_family="L1" FT repeat_region 1971997..1973037 FT /rpt_family="L1" FT repeat_region 1973158..1973335 FT /rpt_family="MER1_type" FT repeat_region 1973508..1973728 FT /rpt_family="L1" FT misc_feature 1973956..1974678 FT /note="CpG_island (%GC=58.6, o/e=1.58, #CpGs=49)" FT repeat_region 1974189..1974349 FT /rpt_family="(CAGA)n" FT repeat_region 1974424..1974713 FT /rpt_family="(CAGA)n" FT misc_feature 1976259..1976464 FT /note="CpG_island (%GC=71.4, o/e=0.81, #CpGs=21)" FT gene complement(1976323..2054277) FT /gene="MAD1L1" FT mRNA complement(join(1976323..1976533,1997264..1997354, FT 2020088..2020176,2041700..2041756,2054137..2054277)) FT /gene="MAD1L1" FT CDS complement(join(<1976323..1976533,1997264..1997354, FT 2020088..2020176,2041700..2041756,2054137..>2054277)) FT /codon_start=1 FT /gene="MAD1L1" FT /product="unknown" FT /note="Homo sapiens MAD1 mitotic arrest deficient-like 1 FT (yeast) (MAD1L1), mRNA.; H_NH0416J17.1 This gene was based FT on gi(4505064 14602943) Continues from AC006433.1 Continues FT as H_FH0596B14.1" FT /protein_id="AAS07503.1" FT /translation="ERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSAE FT MEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQSFLFSREEADTLRLKVEELEG FT ERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECE FT RLRGLLRAMERGGTVPADLEAAAASLPSSKEVA" FT unsure 1977263..1977935 FT /note="unresolved tandem repeat" FT misc_feature 1977287..1977912 FT /note="CpG_island (%GC=67.1, o/e=0.80, #CpGs=49)" FT repeat_region 1978096..1978192 FT /rpt_family="L1" FT repeat_region 1978237..1978352 FT /rpt_family="L1" FT misc_feature 1978375..1978635 FT /note="CpG_island (%GC=66.3, o/e=0.78, #CpGs=18)" FT repeat_region 1978379..1978416 FT /rpt_family="(CA)n" FT repeat_region 1978477..1978514 FT /rpt_family="(CA)n" FT repeat_region 1978540..1978569 FT /rpt_family="(CA)n" FT repeat_region 1978626..1978659 FT /rpt_family="(CA)n" FT misc_feature 1978699..1978941 FT /note="CpG_island (%GC=73.3, o/e=0.66, #CpGs=21)" FT repeat_region 1978831..1978851 FT /rpt_family="(CA)n" FT repeat_region 1978938..1978975 FT /rpt_family="(CA)n" FT repeat_region 1980371..1980476 FT /rpt_family="MER1_type" FT repeat_region 1980562..1980652 FT /rpt_family="CT-rich" FT repeat_region 1982251..1983539 FT /rpt_family="L1" FT repeat_region 1983543..1983692 FT /rpt_family="L1" FT repeat_region 1983767..1984025 FT /rpt_family="L1" FT misc_feature 1984617..1984899 FT /note="CpG_island (%GC=68.2, o/e=0.62, #CpGs=20)" FT repeat_region 1984891..1984994 FT /rpt_family="L2" FT repeat_region 1986635..1986740 FT /rpt_family="MIR" FT repeat_region 1987194..1987337 FT /rpt_family="(CCTTG)n" FT repeat_region 1987398..1987444 FT /rpt_family="MIR" FT repeat_region 1988836..1988973 FT /rpt_family="MIR" FT repeat_region 1989791..1989915 FT /rpt_family="MIR" FT repeat_region 1991056..1991616 FT /rpt_family="L1" FT misc_feature 1991915..1992122 FT /note="CpG_island (%GC=67.3, o/e=1.06, #CpGs=18)" FT repeat_region 1992323..1992388 FT /rpt_family="MIR" FT repeat_region 1994949..1995225 FT /rpt_family="Alu" FT repeat_region 1995227..1995780 FT /rpt_family="ERV1" FT repeat_region 1998101..1998604 FT /rpt_family="L1" FT repeat_region 1998605..1998908 FT /rpt_family="Alu" FT repeat_region 1998909..2000095 FT /rpt_family="L1" FT repeat_region 2000076..2000629 FT /rpt_family="L1" FT repeat_region 2000627..2001303 FT /rpt_family="L1" FT repeat_region 2001305..2001435 FT /rpt_family="MaLR" FT repeat_region 2001419..2001501 FT /rpt_family="MaLR" FT repeat_region 2001485..2001567 FT /rpt_family="MaLR" FT repeat_region 2001551..2001633 FT /rpt_family="MaLR" FT repeat_region 2001617..2001696 FT /rpt_family="MaLR" FT repeat_region 2001683..2001764 FT /rpt_family="MaLR" FT repeat_region 2001743..2002055 FT /rpt_family="MaLR" FT repeat_region 2002071..2002421 FT /rpt_family="L1" FT repeat_region 2002428..2002609 FT /rpt_family="Alu" FT repeat_region 2002661..2003224 FT /rpt_family="L1" FT repeat_region 2003610..2003744 FT /rpt_family="MIR" FT repeat_region 2005334..2005976 FT /rpt_family="L1" FT repeat_region 2006154..2007169 FT /rpt_family="L1" FT repeat_region 2007171..2007365 FT /rpt_family="L1" FT repeat_region 2007597..2007743 FT /rpt_family="L1" FT misc_feature 2007803..2008268 FT /note="CpG_island (%GC=63.5, o/e=1.13, #CpGs=35)" FT repeat_region 2008285..2008692 FT /rpt_family="L1" FT repeat_region 2008737..2009046 FT /rpt_family="Alu" FT repeat_region 2009047..2009547 FT /rpt_family="L1" FT repeat_region 2009655..2009759 FT /rpt_family="L1" FT repeat_region 2009937..2009959 FT /rpt_family="AT_rich" FT repeat_region 2009960..2010268 FT /rpt_family="Alu" FT repeat_region 2010269..2010300 FT /rpt_family="AT_rich" FT repeat_region 2010406..2010556 FT /rpt_family="MER1_type" FT repeat_region 2011175..2011195 FT /rpt_family="AT_rich" FT repeat_region 2011212..2011484 FT /rpt_family="L1" FT repeat_region 2011577..2011870 FT /rpt_family="L1" FT repeat_region 2011890..2012943 FT /rpt_family="L1" FT repeat_region 2013935..2014436 FT /rpt_family="L1" FT repeat_region 2015841..2017227 FT /rpt_family="ERV1" FT repeat_region 2020603..2020901 FT /rpt_family="Alu" FT repeat_region 2021464..2021568 FT /rpt_family="L1" FT repeat_region 2021599..2021864 FT /rpt_family="L1" FT repeat_region 2021865..2022143 FT /rpt_family="Alu" FT repeat_region 2022144..2022162 FT /rpt_family="L1" FT repeat_region 2022243..2022570 FT /rpt_family="L1" FT repeat_region 2022728..2022823 FT /rpt_family="(CA)n" FT repeat_region 2022826..2023237 FT /rpt_family="L1" FT repeat_region 2023239..2023408 FT /rpt_family="L1" FT repeat_region 2023426..2024070 FT /rpt_family="L1" FT repeat_region 2024302..2024621 FT /rpt_family="L1" FT repeat_region 2024700..2025102 FT /rpt_family="ERVL" FT misc_feature 2026954..2027368 FT /note="CpG_island (%GC=66.7, o/e=0.74, #CpGs=35)" FT repeat_region 2028632..2028857 FT /rpt_family="L1" FT repeat_region 2028970..2029026 FT /rpt_family="L1" FT misc_feature 2029117..2029326 FT /note="CpG_island (%GC=71.4, o/e=0.59, #CpGs=17)" FT repeat_region 2030262..2031204 FT /rpt_family="L1" FT unsure 2030338..2031859 FT /note="unresolved tandem repeat" FT repeat_region 2031229..2031789 FT /rpt_family="L1" FT repeat_region 2033619..2033794 FT /rpt_family="MIR" FT repeat_region 2034246..2034477 FT /rpt_family="MaLR" FT repeat_region 2034478..2034614 FT /rpt_family="Alu" FT repeat_region 2034615..2034674 FT /rpt_family="MaLR" FT repeat_region 2039037..2039184 FT /rpt_family="L2" FT repeat_region 2040324..2040407 FT /rpt_family="L2" FT repeat_region 2044443..2044544 FT /rpt_family="CR1" FT misc_feature 2044584..2044788 FT /note="CpG_island (%GC=66.3, o/e=0.67, #CpGs=16)" FT repeat_region 2044920..2045076 FT /rpt_family="L1" FT repeat_region 2045157..2045474 FT /rpt_family="Alu" FT repeat_region 2046172..2046347 FT /rpt_family="(CACAG)n" FT repeat_region 2046467..2046778 FT /rpt_family="L1" FT repeat_region 2046989..2047034 FT /rpt_family="L1" FT repeat_region 2047035..2047308 FT /rpt_family="Alu" FT repeat_region 2047309..2047705 FT /rpt_family="L1" FT repeat_region 2049706..2049728 FT /rpt_family="(T)n" FT repeat_region 2052649..2052753 FT /rpt_family="L2" FT repeat_region 2053062..2053229 FT /rpt_family="MIR" FT misc_feature 2054061..2054386 FT /note="CpG_island (%GC=69.3, o/e=0.80, #CpGs=28)" FT repeat_region 2055459..2055525 FT /rpt_family="MER1_type" FT repeat_region 2055587..2055712 FT /rpt_family="MIR" FT repeat_region 2057822..2057878 FT /rpt_family="MIR" FT repeat_region 2059046..2059227 FT /rpt_family="MIR" FT repeat_region 2059311..2059388 FT /rpt_family="(CACGT)n" FT misc_feature 2059908..2060131 FT /note="CpG_island (%GC=68.8, o/e=0.63, #CpGs=17)" FT repeat_region 2060398..2060460 FT /rpt_family="Alu" FT repeat_region 2060474..2060616 FT /rpt_family="L1" FT repeat_region 2060619..2061115 FT /rpt_family="L1" FT repeat_region 2061116..2061423 FT /rpt_family="Alu" FT repeat_region 2061424..2061587 FT /rpt_family="L1" FT repeat_region 2061589..2061754 FT /rpt_family="Alu" FT repeat_region 2061838..2061986 FT /rpt_family="L1" FT repeat_region 2061996..2062202 FT /rpt_family="Alu" FT repeat_region 2062221..2063301 FT /rpt_family="L1" FT repeat_region 2063302..2063613 FT /rpt_family="Alu" FT repeat_region 2063614..2063958 FT /rpt_family="L1" FT repeat_region 2063982..2064407 FT /rpt_family="ERVL" FT repeat_region 2064414..2064560 FT /rpt_family="L1" FT repeat_region 2064562..2064851 FT /rpt_family="L1" FT repeat_region 2064896..2065297 FT /rpt_family="L1" FT repeat_region 2065322..2065589 FT /rpt_family="L1" FT repeat_region 2065598..2067673 FT /rpt_family="L1" FT repeat_region 2067779..2068079 FT /rpt_family="Alu" FT repeat_region 2068084..2068802 FT /rpt_family="L1" FT repeat_region 2068822..2068986 FT /rpt_family="L1" FT repeat_region 2069066..2069201 FT /rpt_family="L1" FT repeat_region 2071469..2071649 FT /rpt_family="MIR" FT repeat_region 2071789..2071854 FT /rpt_family="L2" FT repeat_region 2073140..2073465 FT /rpt_family="L1" FT repeat_region 2073466..2073753 FT /rpt_family="Alu" FT repeat_region 2073754..2073856 FT /rpt_family="L1" FT repeat_region 2073857..2074150 FT /rpt_family="Alu" FT repeat_region 2074151..2074283 FT /rpt_family="L1" FT unsure 2074898..2075992 FT /note="unresolved tandem repeat" FT repeat_region 2076851..2076989 FT /rpt_family="L1" FT repeat_region 2076998..2077228 FT /rpt_family="MER2_type" FT repeat_region 2077249..2078133 FT /rpt_family="MER2_type" FT repeat_region 2078134..2078448 FT /rpt_family="Alu" FT repeat_region 2078458..2079513 FT /rpt_family="L1" FT repeat_region 2079525..2079898 FT /rpt_family="L1" FT repeat_region 2080043..2080214 FT /rpt_family="L1" FT repeat_region 2080277..2080505 FT /rpt_family="L1" FT repeat_region 2080635..2081290 FT /rpt_family="ERV1" FT repeat_region 2081658..2081986 FT /rpt_family="(CA)n" FT repeat_region 2082147..2082491 FT /rpt_family="MaLR" FT repeat_region 2083855..2084032 FT /rpt_family="MIR" FT repeat_region 2087294..2087454 FT /rpt_family="(CA)n" FT repeat_region 2087586..2087749 FT /rpt_family="(CA)n" FT repeat_region 2088790..2088921 FT /rpt_family="MIR" FT misc_feature 2089594..2089881 FT /note="CpG_island (%GC=67.7, o/e=0.96, #CpGs=24)" FT repeat_region complement(2093034..2093121) FT /rpt_family="L2" FT repeat_region 2095039..2095117 FT /rpt_family="MER5A" FT repeat_region 2095135..2095326 FT /rpt_family="AluJb" FT repeat_region 2095332..2095615 FT /rpt_family="AluSx" FT repeat_region 2095616..2095638 FT /rpt_family="(TAAA)n" FT repeat_region 2096030..2096058 FT /rpt_family="(CTCTG)n" FT repeat_region 2096751..2096878 FT /rpt_family="L2" FT repeat_region 2096879..2097145 FT /rpt_family="AluY" FT repeat_region 2097310..2097573 FT /rpt_family="L1M4" FT repeat_region 2097658..2097677 FT /rpt_family="(GGAGA)n" FT repeat_region 2097904..2098214 FT /rpt_family="GA-rich" FT repeat_region 2098187..2098371 FT /rpt_family="G-rich" FT repeat_region 2098758..2098943 FT /rpt_family="GA-rich" FT repeat_region 2099085..2099267 FT /rpt_family="G-rich" FT repeat_region 2100416..2100691 FT /rpt_family="L1M4" FT repeat_region 2100692..2100973 FT /rpt_family="AluSg" FT repeat_region 2100974..2101015 FT /rpt_family="(TAAAA)n" FT repeat_region 2101016..2101108 FT /rpt_family="L1M4" FT repeat_region 2101420..2101590 FT /rpt_family="L1ME1" FT repeat_region 2101594..2101910 FT /rpt_family="AluSx" FT repeat_region 2101924..2102223 FT /rpt_family="AluSg" FT repeat_region 2102508..2102839 FT /rpt_family="L1ME3A" FT repeat_region 2109514..2109816 FT /rpt_family="L2" FT repeat_region 2111062..2111361 FT /rpt_family="MER21B" FT repeat_region 2111528..2111966 FT /rpt_family="MER21B" FT repeat_region 2112935..2113263 FT /rpt_family="MER87" FT repeat_region complement(2113772..2113877) FT /rpt_family="L2" FT repeat_region complement(2113937..2114179) FT /rpt_family="LTR50" FT repeat_region 2115852..2116166 FT /rpt_family="MLT1A1" FT repeat_region complement(2116966..2117045) FT /rpt_family="MIR" FT repeat_region 2119790..2119947 FT /rpt_family="MER58A" FT repeat_region 2121898..2122066 FT /rpt_family="GA-rich" FT repeat_region complement(2124550..2124742) FT /rpt_family="MIR" FT repeat_region complement(2124819..2124873) FT /rpt_family="L2" FT repeat_region complement(2125175..2125488) FT /rpt_family="L1MB7" FT repeat_region complement(2126182..2126488) FT /rpt_family="AluSq" FT repeat_region 2126755..2126883 FT /rpt_family="L1ME1" FT repeat_region 2126893..2127182 FT /rpt_family="AluSx" FT repeat_region 2128843..2129192 FT /rpt_family="THE1A" FT repeat_region complement(2130031..2130104) FT /rpt_family="L1MC3" FT repeat_region complement(2130218..2130303) FT /rpt_family="L1MC3" FT repeat_region complement(2130523..2130981) FT /rpt_family="L1MD3" FT repeat_region complement(2131088..2131128) FT /rpt_family="L1MC4" FT repeat_region 2131129..2131427 FT /rpt_family="AluYb8" FT repeat_region complement(2131428..2131889) FT /rpt_family="L1MC4" FT repeat_region complement(2131891..2132054) FT /rpt_family="FRAM" FT repeat_region complement(2132193..2132535) FT /rpt_family="L1MC4" FT repeat_region 2132591..2132900 FT /rpt_family="AluSg" FT repeat_region complement(2134039..2134344) FT /rpt_family="L2" FT repeat_region 2134650..2134677 FT /rpt_family="AT_rich" FT repeat_region complement(2134687..2134978) FT /rpt_family="AluY" FT repeat_region 2135012..2135039 FT /rpt_family="(GAAAA)n" FT repeat_region 2136752..2136897 FT /rpt_family="(CACCC)n" FT repeat_region 2139621..2139730 FT /rpt_family="L2" FT repeat_region 2141418..2141506 FT /rpt_family="L2" FT repeat_region 2141777..2142031 FT /rpt_family="(CCA)n" FT repeat_region 2142050..2142306 FT /rpt_family="(CCA)n" FT repeat_region 2142685..2142887 FT /rpt_family="L2" FT repeat_region complement(2144801..2144894) FT /rpt_family="L2" FT repeat_region 2145599..2145665 FT /rpt_family="C-rich" FT repeat_region 2148034..2148094 FT /rpt_family="AT_rich" FT repeat_region 2151491..2151840 FT /rpt_family="L1MD3" FT repeat_region 2151883..2152589 FT /rpt_family="L1MD3" FT repeat_region 2152856..2152932 FT /rpt_family="L1MC4" FT repeat_region 2152933..2153235 FT /rpt_family="AluSx" FT repeat_region 2153236..2153834 FT /rpt_family="L1MC4" FT repeat_region 2154243..2154477 FT /rpt_family="MER58A" FT repeat_region 2157067..2157427 FT /rpt_family="THE1C" FT repeat_region 2161421..2161516 FT /rpt_family="L2" FT repeat_region 2161981..2162247 FT /rpt_family="AluSx" FT repeat_region 2162657..2162955 FT /rpt_family="AluYb8" FT repeat_region complement(2164697..2164816) FT /rpt_family="MIR" FT repeat_region 2170222..2170752 FT /rpt_family="LTR24B" FT repeat_region complement(2171786..2171994) FT /rpt_family="L1MC2" FT repeat_region complement(2172118..2172435) FT /rpt_family="L1MC1" FT repeat_region 2172457..2172647 FT /rpt_family="MSTB" FT repeat_region complement(2172687..2172767) FT /rpt_family="L1MC/D" FT repeat_region complement(2172770..2172850) FT /rpt_family="L1MC/D" FT repeat_region complement(2172853..2172933) FT /rpt_family="L1MC/D" FT repeat_region complement(2172936..2174213) FT /rpt_family="L1M4" FT repeat_region 2174853..2175234 FT /rpt_family="Charlie1" FT repeat_region 2175445..2175549 FT /rpt_family="MER5A" FT repeat_region complement(2280949..2281178) FT /rpt_family="Alu" FT repeat_region complement(2280632..2280936) FT /rpt_family="Alu" FT repeat_region complement(2280341..2280628) FT /rpt_family="Alu" FT repeat_region complement(2280031..2280151) FT /rpt_family="Alu" FT repeat_region complement(2279866..2279902) FT /rpt_family="MaLR" FT repeat_region complement(2279584..2279865) FT /rpt_family="Alu" FT repeat_region complement(2279502..2279583) FT /rpt_family="MaLR" FT repeat_region complement(2278613..2278682) FT /rpt_family="(TA)n" FT repeat_region complement(2278288..2278574) FT /rpt_family="Alu" FT repeat_region complement(2277334..2277550) FT /rpt_family="Alu" FT repeat_region complement(2276677..2276932) FT /rpt_family="Alu" FT repeat_region complement(2276042..2276204) FT /rpt_family="Alu" FT repeat_region complement(2275583..2275894) FT /rpt_family="Alu" FT repeat_region complement(2274605..2274631) FT /rpt_family="(GA)n" FT repeat_region complement(2274145..2274288) FT /rpt_family="Alu" FT STS 2273926..2274283 FT repeat_region complement(2273852..2273872) FT /rpt_family="AT_rich" FT repeat_region complement(2273320..2273631) FT /rpt_family="Alu" FT misc_feature complement(2272011..2272856) FT /note="CpG_island (%GC=73.0, o/e=0.90, #CpGs=95)" FT repeat_region complement(2272459..2272502) FT /rpt_family="GC_rich" FT repeat_region complement(2271441..2271509) FT /rpt_family="MIR" FT repeat_region complement(2270973..2271272) FT /rpt_family="Alu" FT repeat_region complement(2270934..2270968) FT /rpt_family="(TAAA)n" FT repeat_region complement(2270668..2270933) FT /rpt_family="Alu" FT repeat_region complement(2270105..2270636) FT /rpt_family="Retroviral" FT repeat_region complement(2268378..2268667) FT /rpt_family="Alu" FT repeat_region complement(2268263..2268311) FT /rpt_family="(TA)n" FT repeat_region complement(2267929..2268187) FT /rpt_family="Alu" FT repeat_region complement(2267017..2267236) FT /rpt_family="MER1_type" FT repeat_region complement(2266948..2267004) FT /rpt_family="MER1_type" FT repeat_region complement(2266647..2266947) FT /rpt_family="Alu" FT repeat_region complement(2266343..2266642) FT /rpt_family="Alu" FT repeat_region complement(2266246..2266342) FT /rpt_family="MER1_type" FT repeat_region complement(2265802..2265921) FT /rpt_family="Retroviral" FT repeat_region complement(2265629..2265881) FT /rpt_family="MaLR" FT repeat_region complement(2265430..2265571) FT /rpt_family="MaLR" FT repeat_region complement(2261711..2262014) FT /rpt_family="Alu" FT repeat_region complement(2259233..2259347) FT /rpt_family="G-rich" FT repeat_region complement(2258547..2258710) FT /rpt_family="Alu" FT repeat_region complement(2258261..2258546) FT /rpt_family="Alu" FT repeat_region complement(2257323..2257474) FT /rpt_family="L2" FT repeat_region complement(2257214..2257316) FT /rpt_family="MIR" FT repeat_region complement(2255934..2256416) FT /rpt_family="L1" FT repeat_region complement(2255323..2255400) FT /rpt_family="MaLR" FT repeat_region complement(2255034..2255226) FT /rpt_family="MaLR" FT repeat_region complement(2254732..2255030) FT /rpt_family="Alu" FT repeat_region complement(2254590..2254712) FT /rpt_family="Alu" FT repeat_region complement(2254518..2254584) FT /rpt_family="MaLR" FT repeat_region complement(2254296..2254381) FT /rpt_family="MIR" FT repeat_region complement(2253683..2253912) FT /rpt_family="MIR" FT repeat_region complement(2253515..2253598) FT /rpt_family="L2" FT repeat_region complement(2252020..2252440) FT /rpt_family="MaLR" FT repeat_region complement(2249727..2250005) FT /rpt_family="Alu" FT repeat_region complement(2247700..2248281) FT /rpt_family="L1" FT repeat_region complement(2246879..2247662) FT /rpt_family="MER21_g" FT repeat_region complement(2246735..2246856) FT /rpt_family="L1" FT repeat_region complement(2246435..2246734) FT /rpt_family="Alu" FT repeat_region complement(2245790..2246434) FT /rpt_family="L1" FT repeat_region complement(2245487..2245789) FT /rpt_family="Alu" FT repeat_region complement(2245385..2245486) FT /rpt_family="L1" FT repeat_region complement(2244950..2245384) FT /rpt_family="Retroviral" FT repeat_region complement(2244665..2244831) FT /rpt_family="MER4-group" FT repeat_region complement(2244635..2244796) FT /rpt_family="Retroviral" FT repeat_region complement(2243971..2244634) FT /rpt_family="L1" FT repeat_region complement(2243187..2243224) FT /rpt_family="L1" FT repeat_region complement(2239974..2240044) FT /rpt_family="L2" FT repeat_region complement(2237757..2237890) FT /rpt_family="Alu" FT repeat_region complement(2236975..2237035) FT /rpt_family="L2" FT repeat_region complement(2236159..2236269) FT /rpt_family="L2" FT repeat_region complement(2234427..2234737) FT /rpt_family="Alu" FT repeat_region complement(2234186..2234305) FT /rpt_family="MER1_type" FT repeat_region complement(2234085..2234185) FT /rpt_family="MER81" FT repeat_region complement(2233948..2234075) FT /rpt_family="MER1_type" FT repeat_region complement(2233572..2233894) FT /rpt_family="Alu" FT repeat_region complement(2233075..2233169) FT /rpt_family="L2" FT repeat_region complement(2232606..2232626) FT /rpt_family="AT_rich" FT repeat_region complement(2231758..2232066) FT /rpt_family="Alu" FT repeat_region complement(2231386..2231693) FT /rpt_family="Alu" FT repeat_region complement(2231092..2231382) FT /rpt_family="Alu" FT repeat_region complement(2229685..2230865) FT /rpt_family="L1" FT repeat_region complement(2229453..2229682) FT /rpt_family="L1" FT repeat_region complement(2227879..2229459) FT /rpt_family="L1" FT repeat_region complement(2227268..2227870) FT /rpt_family="MER1_type" FT repeat_region complement(2227116..2227247) FT /rpt_family="Alu" FT repeat_region complement(2227011..2227112) FT /rpt_family="MER1_type" FT repeat_region complement(2226756..2227010) FT /rpt_family="Alu" FT repeat_region complement(2226728..2226755) FT /rpt_family="MER1_type" FT repeat_region complement(2226417..2226727) FT /rpt_family="Alu" FT repeat_region complement(2226355..2226416) FT /rpt_family="MER1_type" FT repeat_region complement(2225685..2225995) FT /rpt_family="L1" FT STS 2225283..2225594 FT repeat_region complement(2224864..2225142) FT /rpt_family="L1" FT repeat_region complement(2224730..2224836) FT /rpt_family="MER1_type?" FT repeat_region complement(2224666..2224720) FT /rpt_family="L1" FT repeat_region complement(2224355..2224665) FT /rpt_family="Alu" FT repeat_region complement(2223919..2224354) FT /rpt_family="L1" FT repeat_region complement(2223604..2223918) FT /rpt_family="Alu" FT repeat_region complement(2223542..2223603) FT /rpt_family="L1" FT repeat_region complement(2223076..2223541) FT /rpt_family="L1" FT repeat_region complement(2222907..2223075) FT /rpt_family="L1" FT repeat_region complement(2222576..2222867) FT /rpt_family="Alu" FT repeat_region complement(2221892..2222566) FT /rpt_family="L1" FT repeat_region complement(2221827..2221916) FT /rpt_family="L1" FT repeat_region complement(2221035..2221764) FT /rpt_family="L1" FT repeat_region complement(2220595..2221030) FT /rpt_family="L1" FT repeat_region complement(2220297..2220601) FT /rpt_family="L1" FT repeat_region complement(2219636..2220017) FT /rpt_family="L1" FT repeat_region complement(2219609..2219631) FT /rpt_family="(GAAAA)n" FT repeat_region complement(2219323..2219608) FT /rpt_family="Alu" FT repeat_region complement(2219186..2219322) FT /rpt_family="L1" FT repeat_region complement(2218883..2219185) FT /rpt_family="Alu" FT repeat_region complement(2218633..2218882) FT /rpt_family="L1" FT repeat_region complement(2218554..2218633) FT /rpt_family="L1" FT repeat_region complement(2218250..2218553) FT /rpt_family="Alu" FT repeat_region complement(2218190..2218249) FT /rpt_family="L1" FT repeat_region complement(2218096..2218189) FT /rpt_family="MER4-group" FT repeat_region complement(2217567..2217919) FT /rpt_family="MER4-group" FT repeat_region complement(2216367..2216525) FT /rpt_family="L1" FT repeat_region complement(2216008..2216316) FT /rpt_family="L1" FT repeat_region complement(2215703..2216007) FT /rpt_family="Alu" FT repeat_region complement(2215458..2215643) FT /rpt_family="L1" FT repeat_region complement(2215129..2215152) FT /rpt_family="POLY_A" FT repeat_region complement(2213755..2214377) FT /rpt_family="Other" FT repeat_region complement(2213443..2213754) FT /rpt_family="Alu" FT repeat_region complement(2212670..2213442) FT /rpt_family="Other" FT repeat_region complement(2211862..2211989) FT /rpt_family="MIR" FT repeat_region complement(2211612..2211834) FT /rpt_family="MIR" FT repeat_region complement(2210086..2210537) FT /rpt_family="L2" FT repeat_region complement(2207638..2207936) FT /rpt_family="Alu" FT repeat_region complement(2207389..2207515) FT /rpt_family="Alu" FT repeat_region complement(2207217..2207376) FT /rpt_family="Alu" FT repeat_region complement(2207188..2207211) FT /rpt_family="(TAA)n" FT repeat_region complement(2206901..2207187) FT /rpt_family="Alu" FT repeat_region complement(2204918..2205053) FT /rpt_family="L1" FT repeat_region complement(2204681..2204864) FT /rpt_family="Alu" FT repeat_region complement(2204370..2204662) FT /rpt_family="L2" FT repeat_region complement(2203007..2203296) FT /rpt_family="Alu" FT repeat_region complement(2200739..2202241) FT /rpt_family="Retroviral" FT misc_feature complement(2200886..2201672) FT /note="CpG_island (%GC=70.4, o/e=0.70, #CpGs=61)" FT repeat_region complement(2200534..2200562) FT /rpt_family="AT_rich" FT repeat_region complement(2200270..2200415) FT /rpt_family="Alu" FT repeat_region complement(2199965..2200267) FT /rpt_family="Alu" FT repeat_region complement(2199581..2199900) FT /rpt_family="Alu" FT repeat_region complement(2198952..2199278) FT /rpt_family="L2" FT repeat_region complement(2196171..2196484) FT /rpt_family="Alu" FT repeat_region complement(2195996..2196145) FT /rpt_family="MER1_type" FT repeat_region complement(2194931..2195545) FT /rpt_family="L1" FT repeat_region complement(2194261..2194290) FT /rpt_family="(TAAA)n" FT repeat_region complement(2193806..2194260) FT /rpt_family="L1" FT repeat_region complement(2193511..2193805) FT /rpt_family="Alu" FT repeat_region complement(2192654..2193510) FT /rpt_family="L1" FT repeat_region complement(2183735..2183911) FT /rpt_family="MIR" FT CDS join(2394557..2395055,2400345..2400537,2402280..2402399, FT 2402705..2402762,2403267..2403395,2404007..>2404164) FT /codon_start=1 FT /gene="EIF3S9" FT /product="unknown" FT /note="Homo sapiens eukaryotic translation initiation FT factor 3, subunit 9 eta, 116kDa (EIF3S9), mRNA.; FT H_DJ1125K23.1 Continues as H_DJ0607J02.2" FT /protein_id="AAP21880.1" FT /translation="MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEA FT AGTEASSEEVGIAEAGPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQ FT GEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDV FT SEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFY FT PEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDI FT PEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYV FT RWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCE" FT repeat_region complement(2403615..2403907) FT /rpt_family="Alu" FT repeat_region complement(2402807..2403119) FT /rpt_family="Alu" FT repeat_region complement(2401901..2402038) FT /rpt_family="L1" FT repeat_region complement(2401588..2401894) FT /rpt_family="Alu" FT repeat_region complement(2401439..2401576) FT /rpt_family="Alu" FT repeat_region complement(2401411..2401434) FT /rpt_family="(CAAA)n" FT repeat_region complement(2401050..2401353) FT /rpt_family="Alu" FT repeat_region complement(2400748..2400915) FT /rpt_family="Alu" FT variation complement(2400306) FT /allele="T" FT /allele="C" FT repeat_region complement(2398791..2399480) FT /rpt_family="ERV1" FT repeat_region complement(2398576..2398706) FT /rpt_family="Alu" FT repeat_region complement(2398165..2398463) FT /rpt_family="Alu" FT repeat_region complement(2398042..2398078) FT /rpt_family="Alu" FT repeat_region complement(2397732..2398012) FT /rpt_family="Alu" FT repeat_region complement(2396545..2396685) FT /rpt_family="MIR" FT repeat_region complement(2396271..2396453) FT /rpt_family="Alu" FT repeat_region complement(2395966..2396267) FT /rpt_family="Alu" FT misc_feature complement(2393629..2395174) FT /note="CpG_island (%GC=66.6, o/e=0.99, #CpGs=168)" FT repeat_region complement(2394625..2394697) FT /rpt_family="GC_rich" FT variation complement(2394316) FT /allele="C" FT /allele="G" FT variation complement(2394296) FT /allele="T" FT /allele="C" FT variation complement(2393632) FT /allele="C" FT /allele="A" FT repeat_region complement(2393442..2393535) FT /rpt_family="Alu" FT repeat_region complement(2393217..2393411) FT /rpt_family="L1" FT repeat_region complement(2393084..2393216) FT /rpt_family="Alu" FT repeat_region complement(2393050..2393083) FT /rpt_family="L1" FT repeat_region complement(2392857..2393043) FT /rpt_family="Alu" FT repeat_region complement(2392820..2392852) FT /rpt_family="L1" FT repeat_region complement(2392651..2392818) FT /rpt_family="Alu" FT repeat_region complement(2392488..2392560) FT /rpt_family="MIR" FT repeat_region complement(2392188..2392487) FT /rpt_family="Alu" FT repeat_region complement(2391950..2392184) FT /rpt_family="MER2_type" FT repeat_region complement(2391849..2391949) FT /rpt_family="MaLR" FT repeat_region complement(2391541..2391846) FT /rpt_family="Alu" FT repeat_region complement(2391186..2391512) FT /rpt_family="Alu" FT repeat_region complement(2390911..2391183) FT /rpt_family="Alu" FT repeat_region complement(2390577..2390771) FT /rpt_family="Alu" FT repeat_region complement(2390288..2390576) FT /rpt_family="Alu" FT repeat_region complement(2390157..2390287) FT /rpt_family="Alu" FT repeat_region complement(2389833..2389891) FT /rpt_family="MIR" FT repeat_region complement(2389379..2389493) FT /rpt_family="Alu" FT repeat_region complement(2389082..2389370) FT /rpt_family="Alu" FT repeat_region complement(2389013..2389052) FT /rpt_family="AT_rich" FT repeat_region complement(2388876..2389005) FT /rpt_family="L1" FT repeat_region complement(2388671..2388867) FT /rpt_family="Alu" FT repeat_region complement(2388306..2388608) FT /rpt_family="Alu" FT repeat_region complement(2387964..2388275) FT /rpt_family="Alu" FT repeat_region complement(2387272..2387576) FT /rpt_family="Alu" FT repeat_region complement(2386835..2387145) FT /rpt_family="Alu" FT repeat_region complement(2386692..2386791) FT /rpt_family="Alu" FT repeat_region complement(2386403..2386583) FT /rpt_family="Alu" FT repeat_region complement(2386101..2386402) FT /rpt_family="Alu" FT repeat_region complement(2385867..2386092) FT /rpt_family="Alu" FT repeat_region complement(2385742..2385785) FT /rpt_family="L1" FT repeat_region complement(2385433..2385741) FT /rpt_family="Alu" FT repeat_region complement(2385338..2385432) FT /rpt_family="L1" FT repeat_region complement(2385029..2385337) FT /rpt_family="Alu" FT repeat_region complement(2385007..2385028) FT /rpt_family="L1" FT repeat_region complement(2384572..2384967) FT /rpt_family="L1" FT repeat_region complement(2384272..2384479) FT /rpt_family="Alu" FT repeat_region complement(2383974..2384262) FT /rpt_family="Alu" FT repeat_region complement(2383863..2383966) FT /rpt_family="Alu" FT repeat_region complement(2383690..2383862) FT /rpt_family="Alu" FT repeat_region complement(2383372..2383689) FT /rpt_family="Alu" FT variation complement(2383436) FT /allele="T" FT /allele="C" FT repeat_region complement(2383029..2383333) FT /rpt_family="Alu" FT repeat_region complement(2382919..2383028) FT /rpt_family="L1" FT repeat_region complement(2382730..2382865) FT /rpt_family="Alu" FT repeat_region complement(2382433..2382729) FT /rpt_family="Alu" FT repeat_region complement(2382007..2382303) FT /rpt_family="Alu" FT repeat_region complement(2381720..2381856) FT /rpt_family="Alu" FT repeat_region complement(2381614..2381692) FT /rpt_family="Alu" FT repeat_region complement(2381341..2381598) FT /rpt_family="Alu" FT repeat_region complement(2381161..2381325) FT /rpt_family="Alu" FT repeat_region complement(2380894..2381149) FT /rpt_family="Alu" FT repeat_region complement(2380540..2380831) FT /rpt_family="Alu" FT repeat_region complement(2380210..2380519) FT /rpt_family="Alu" FT repeat_region complement(2380055..2380203) FT /rpt_family="L1" FT repeat_region complement(2380007..2380034) FT /rpt_family="L1" FT repeat_region complement(2379701..2380006) FT /rpt_family="Alu" FT repeat_region complement(2379135..2379700) FT /rpt_family="L1" FT repeat_region complement(2379116..2379131) FT /rpt_family="Alu" FT repeat_region complement(2378839..2379115) FT /rpt_family="Alu" FT repeat_region complement(2378548..2378838) FT /rpt_family="Alu" FT repeat_region complement(2378417..2378547) FT /rpt_family="Alu" FT repeat_region complement(2378281..2378414) FT /rpt_family="L1" FT repeat_region complement(2378122..2378280) FT /rpt_family="Alu" FT repeat_region complement(2377816..2378121) FT /rpt_family="Alu" FT repeat_region complement(2377679..2377815) FT /rpt_family="Alu" FT repeat_region complement(2377430..2377678) FT /rpt_family="L1" FT repeat_region complement(2377118..2377389) FT /rpt_family="L1" FT variation complement(2377332) FT /allele="G" FT /allele="A" FT repeat_region complement(2377098..2377138) FT /rpt_family="L1" FT repeat_region complement(2376808..2377097) FT /rpt_family="Alu" FT repeat_region complement(2376664..2376807) FT /rpt_family="L1" FT repeat_region complement(2376362..2376663) FT /rpt_family="Alu" FT repeat_region complement(2376063..2376359) FT /rpt_family="Alu" FT repeat_region complement(2375755..2376061) FT /rpt_family="Alu" FT repeat_region complement(2375539..2375753) FT /rpt_family="Alu" FT repeat_region complement(2375464..2375538) FT /rpt_family="L1" FT repeat_region complement(2375156..2375463) FT /rpt_family="Alu" FT misc_feature complement(2375163..2375425) FT /note="CpG_island (%GC=61.6, o/e=0.78, #CpGs=21)" FT repeat_region complement(2375137..2375155) FT /rpt_family="L1" FT repeat_region complement(2375003..2375136) FT /rpt_family="Alu" FT repeat_region complement(2374853..2375002) FT /rpt_family="L1" FT repeat_region complement(2374583..2374852) FT /rpt_family="Alu" FT repeat_region complement(2374533..2374582) FT /rpt_family="L1" FT repeat_region complement(2374356..2374532) FT /rpt_family="Alu" FT repeat_region complement(2374052..2374355) FT /rpt_family="Alu" FT repeat_region complement(2373769..2374049) FT /rpt_family="Alu" FT repeat_region complement(2373636..2373768) FT /rpt_family="Alu" FT repeat_region complement(2373503..2373629) FT /rpt_family="Alu" FT repeat_region complement(2373212..2373483) FT /rpt_family="L1" FT repeat_region complement(2372916..2373204) FT /rpt_family="Alu" FT repeat_region complement(2372850..2372914) FT /rpt_family="Alu" FT repeat_region complement(2372699..2372848) FT /rpt_family="Alu" FT repeat_region complement(2372623..2372698) FT /rpt_family="Alu" FT repeat_region complement(2372558..2372622) FT /rpt_family="L1" FT repeat_region complement(2372382..2372542) FT /rpt_family="L1" FT repeat_region complement(2372108..2372373) FT /rpt_family="Alu" FT repeat_region complement(2371850..2371887) FT /rpt_family="(TA)n" FT repeat_region complement(2371559..2371849) FT /rpt_family="Alu" FT repeat_region complement(2371399..2371526) FT /rpt_family="Alu" FT repeat_region complement(2371060..2371373) FT /rpt_family="Alu" FT repeat_region complement(2370882..2371038) FT /rpt_family="L1" FT repeat_region complement(2370540..2370849) FT /rpt_family="Alu" FT repeat_region complement(2370072..2370448) FT /rpt_family="ERV1" FT repeat_region complement(2369767..2370071) FT /rpt_family="Alu" FT repeat_region complement(2369467..2369765) FT /rpt_family="Alu" FT repeat_region complement(2369059..2369466) FT /rpt_family="ERV1" FT repeat_region complement(2368934..2368967) FT /rpt_family="AT_rich" FT repeat_region complement(2368748..2368933) FT /rpt_family="Alu" FT repeat_region complement(2368440..2368747) FT /rpt_family="Alu" FT repeat_region complement(2368306..2368439) FT /rpt_family="Alu" FT repeat_region complement(2368166..2368298) FT /rpt_family="Alu" FT repeat_region complement(2367992..2368126) FT /rpt_family="Alu" FT repeat_region complement(2367671..2367991) FT /rpt_family="Alu" FT repeat_region complement(2367487..2367670) FT /rpt_family="Alu" FT repeat_region complement(2367342..2367477) FT /rpt_family="Alu" FT repeat_region complement(2367042..2367341) FT /rpt_family="Alu" FT repeat_region complement(2366865..2367041) FT /rpt_family="Alu" FT repeat_region complement(2366606..2366849) FT /rpt_family="MaLR" FT repeat_region complement(2366459..2366597) FT /rpt_family="Alu" FT repeat_region complement(2366331..2366417) FT /rpt_family="L1" FT repeat_region complement(2366019..2366318) FT /rpt_family="Alu" FT repeat_region complement(2365725..2366016) FT /rpt_family="Alu" FT repeat_region complement(2365504..2365723) FT /rpt_family="MaLR" FT repeat_region complement(2365181..2365503) FT /rpt_family="Alu" FT repeat_region complement(2364944..2365180) FT /rpt_family="MaLR" FT repeat_region complement(2364786..2364935) FT /rpt_family="Alu" FT repeat_region complement(2364438..2364766) FT /rpt_family="Alu" FT repeat_region complement(2364226..2364256) FT /rpt_family="Alu" FT repeat_region complement(2363916..2364225) FT /rpt_family="Alu" FT repeat_region complement(2363798..2363915) FT /rpt_family="Alu" FT repeat_region complement(2363525..2363784) FT /rpt_family="Alu" FT repeat_region complement(2363433..2363524) FT /rpt_family="Alu" FT repeat_region complement(2363068..2363378) FT /rpt_family="MaLR" FT repeat_region complement(2362683..2362996) FT /rpt_family="Alu" FT repeat_region complement(2362370..2362676) FT /rpt_family="Alu" FT repeat_region complement(2362048..2362362) FT /rpt_family="Alu" FT repeat_region complement(2361879..2362043) FT /rpt_family="Alu" FT repeat_region complement(2361349..2361657) FT /rpt_family="Alu" FT repeat_region complement(2361059..2361348) FT /rpt_family="Alu" FT variation complement(2360895) FT /allele="G" FT /allele="C" FT repeat_region complement(2360374..2360684) FT /rpt_family="Alu" FT repeat_region complement(2360074..2360373) FT /rpt_family="Alu" FT repeat_region complement(2359942..2359995) FT /rpt_family="MER1_type" FT repeat_region complement(2359710..2359932) FT /rpt_family="Alu" FT repeat_region complement(2359466..2359638) FT /rpt_family="Alu" FT repeat_region complement(2359169..2359465) FT /rpt_family="Alu" FT repeat_region complement(2359013..2359168) FT /rpt_family="Alu" FT repeat_region complement(2358692..2359001) FT /rpt_family="Alu" FT repeat_region complement(2358365..2358666) FT /rpt_family="Alu" FT repeat_region complement(2358182..2358345) FT /rpt_family="Alu" FT repeat_region complement(2357904..2358181) FT /rpt_family="Alu" FT repeat_region complement(2357690..2357864) FT /rpt_family="Alu" FT repeat_region complement(2357450..2357485) FT /rpt_family="Alu" FT repeat_region complement(2356902..2357211) FT /rpt_family="Alu" FT repeat_region complement(2356256..2356444) FT /rpt_family="(TGAG)n" FT repeat_region complement(2355908..2356244) FT /rpt_family="(TGAG)n" FT repeat_region complement(2355699..2355895) FT /rpt_family="(TGAG)n" FT repeat_region complement(2355643..2355674) FT /rpt_family="(TGAG)n" FT repeat_region complement(2355405..2355601) FT /rpt_family="(TGAG)n" FT repeat_region complement(2355262..2355393) FT /rpt_family="(TGAG)n" FT repeat_region complement(2355096..2355271) FT /rpt_family="(TGAA)n" FT repeat_region complement(2354519..2355047) FT /rpt_family="(TGAG)n" FT repeat_region complement(2354458..2354499) FT /rpt_family="(TGAG)n" FT misc_feature complement(2353630..2354427) FT /note="CpG_island (%GC=75.1, o/e=0.91, #CpGs=96)" FT repeat_region complement(2354085..2354268) FT /rpt_family="(CGGGG)n" FT variation complement(2353600) FT /allele="G" FT /allele="A" FT repeat_region complement(2353450..2353563) FT /rpt_family="MIR" FT repeat_region complement(2353216..2353416) FT /rpt_family="Alu" FT repeat_region complement(2352879..2353188) FT /rpt_family="Alu" FT repeat_region complement(2352524..2352833) FT /rpt_family="Alu" FT repeat_region complement(2351291..2351589) FT /rpt_family="Alu" FT repeat_region complement(2351232..2351283) FT /rpt_family="MIR" FT repeat_region complement(2351018..2351157) FT /rpt_family="Alu" FT repeat_region complement(2350121..2350435) FT /rpt_family="Alu" FT repeat_region complement(2349977..2350120) FT /rpt_family="Alu" FT repeat_region complement(2349085..2349378) FT /rpt_family="Alu" FT repeat_region complement(2348875..2349084) FT /rpt_family="Alu" FT repeat_region complement(2348729..2348858) FT /rpt_family="Alu" FT repeat_region complement(2348416..2348721) FT /rpt_family="Alu" FT repeat_region complement(2348021..2348322) FT /rpt_family="Alu" FT repeat_region complement(2347698..2347722) FT /rpt_family="(TC)n" FT repeat_region complement(2347671..2347698) FT /rpt_family="(CA)n" FT repeat_region complement(2346986..2347293) FT /rpt_family="Alu" FT repeat_region complement(2346240..2346432) FT /rpt_family="L1" FT repeat_region complement(2345773..2346044) FT /rpt_family="Alu" FT repeat_region complement(2345713..2345760) FT /rpt_family="Alu" FT repeat_region complement(2345439..2345569) FT /rpt_family="Alu" FT repeat_region complement(2345311..2345434) FT /rpt_family="L1" FT repeat_region complement(2344987..2345298) FT /rpt_family="Alu" FT repeat_region complement(2343898..2344192) FT /rpt_family="Alu" FT repeat_region complement(2343638..2343821) FT /rpt_family="Alu" FT repeat_region complement(2343604..2343637) FT /rpt_family="AT_rich" FT repeat_region complement(2341725..2343603) FT /rpt_family="SVA" FT repeat_region complement(2341596..2341718) FT /rpt_family="Alu" FT repeat_region complement(2341457..2341590) FT /rpt_family="MIR" FT repeat_region complement(2340980..2341456) FT /rpt_family="ERV1" FT repeat_region complement(2340912..2340979) FT /rpt_family="MIR" FT repeat_region complement(2340267..2340577) FT /rpt_family="Alu" FT repeat_region complement(2340046..2340266) FT /rpt_family="Alu" FT repeat_region complement(2338315..2338627) FT /rpt_family="Alu" FT repeat_region complement(2337991..2338304) FT /rpt_family="Alu" FT repeat_region complement(2337743..2337967) FT /rpt_family="Alu" FT repeat_region complement(2337213..2337669) FT /rpt_family="L1" FT repeat_region complement(2336904..2337212) FT /rpt_family="Alu" FT repeat_region complement(2336581..2336903) FT /rpt_family="L1" FT repeat_region complement(2336284..2336579) FT /rpt_family="Alu" FT repeat_region complement(2335261..2336222) FT /rpt_family="L1" FT repeat_region complement(2335228..2335258) FT /rpt_family="(T)n" FT repeat_region complement(2335058..2335227) FT /rpt_family="Alu" FT repeat_region complement(2334756..2335057) FT /rpt_family="Alu" FT repeat_region complement(2334396..2334693) FT /rpt_family="Alu" FT repeat_region complement(2334327..2334386) FT /rpt_family="MIR" FT repeat_region complement(2334077..2334255) FT /rpt_family="MIR" FT repeat_region complement(2333938..2334054) FT /rpt_family="L1" FT repeat_region complement(2333617..2333937) FT /rpt_family="Alu" FT repeat_region complement(2333318..2333612) FT /rpt_family="Alu" FT repeat_region complement(2333009..2333312) FT /rpt_family="Alu" FT repeat_region complement(2332907..2333008) FT /rpt_family="L1" FT repeat_region complement(2332826..2332905) FT /rpt_family="Alu" FT repeat_region complement(2332756..2332830) FT /rpt_family="Alu" FT repeat_region complement(2332686..2332751) FT /rpt_family="L1" FT repeat_region complement(2332402..2332683) FT /rpt_family="Alu" FT repeat_region complement(2332346..2332400) FT /rpt_family="L1" FT repeat_region complement(2332047..2332345) FT /rpt_family="Alu" FT repeat_region complement(2331907..2332046) FT /rpt_family="L1" FT repeat_region complement(2331617..2331906) FT /rpt_family="Alu" FT repeat_region complement(2331580..2331616) FT /rpt_family="L1" FT repeat_region complement(2330951..2331262) FT /rpt_family="Alu" FT repeat_region complement(2330649..2330947) FT /rpt_family="Alu" FT repeat_region complement(2330168..2330218) FT /rpt_family="L2" FT repeat_region complement(2329860..2330167) FT /rpt_family="Alu" FT repeat_region complement(2329552..2329855) FT /rpt_family="Alu" FT repeat_region complement(2329412..2329546) FT /rpt_family="Alu" FT repeat_region complement(2328672..2329108) FT /rpt_family="L1" FT repeat_region complement(2328376..2328671) FT /rpt_family="Alu" FT repeat_region complement(2328212..2328375) FT /rpt_family="L1" FT repeat_region complement(2327696..2328005) FT /rpt_family="Alu" FT repeat_region complement(2327436..2327546) FT /rpt_family="Alu" FT repeat_region complement(2327237..2327415) FT /rpt_family="Alu" FT repeat_region complement(2326935..2327236) FT /rpt_family="Alu" FT repeat_region complement(2326861..2326915) FT /rpt_family="Alu" FT repeat_region complement(2326793..2326860) FT /rpt_family="Alu" FT repeat_region complement(2326494..2326792) FT /rpt_family="Alu" FT repeat_region complement(2326451..2326484) FT /rpt_family="AT_rich" FT repeat_region complement(2326158..2326450) FT /rpt_family="Alu" FT repeat_region complement(2325643..2325946) FT /rpt_family="Alu" FT repeat_region complement(2325296..2325617) FT /rpt_family="Alu" FT repeat_region complement(2324875..2325035) FT /rpt_family="Alu" FT repeat_region complement(2324565..2324874) FT /rpt_family="Alu" FT repeat_region complement(2324530..2324558) FT /rpt_family="AT_rich" FT repeat_region complement(2324027..2324338) FT /rpt_family="Alu" FT repeat_region complement(2323867..2323933) FT /rpt_family="MER1_type" FT repeat_region complement(2323730..2323864) FT /rpt_family="Alu" FT repeat_region complement(2323435..2323729) FT /rpt_family="Alu" FT repeat_region complement(2323319..2323434) FT /rpt_family="MER1_type" FT repeat_region complement(2322475..2322780) FT /rpt_family="Alu" FT repeat_region complement(2322330..2322474) FT /rpt_family="Alu" FT repeat_region complement(2321336..2321444) FT /rpt_family="MER1_type" FT repeat_region complement(2320778..2321080) FT /rpt_family="Alu" FT repeat_region complement(2320428..2320727) FT /rpt_family="Alu" FT repeat_region complement(2319974..2320126) FT /rpt_family="Alu" FT repeat_region complement(2319105..2319415) FT /rpt_family="Alu" FT misc_feature complement(2318239..2319079) FT /note="CpG_island (%GC=60.9, o/e=3.12, #CpGs=103)" FT repeat_region complement(2317997..2318132) FT /rpt_family="Alu" FT repeat_region complement(2317154..2317461) FT /rpt_family="Alu" FT repeat_region complement(2316298..2316603) FT /rpt_family="Alu" FT repeat_region complement(2316156..2316293) FT /rpt_family="Alu" FT repeat_region complement(2315352..2315657) FT /rpt_family="Alu" FT repeat_region complement(2315053..2315351) FT /rpt_family="Alu" FT variation complement(2315008) FT /allele="G" FT /allele="C" FT variation complement(2314652) FT /allele="A" FT /allele="G" FT repeat_region complement(2313257..2313572) FT /rpt_family="Alu" FT repeat_region complement(2312938..2313244) FT /rpt_family="Alu" FT repeat_region complement(2312803..2312933) FT /rpt_family="Alu" FT repeat_region complement(2312479..2312769) FT /rpt_family="Alu" FT repeat_region complement(2312003..2312310) FT /rpt_family="Alu" FT repeat_region complement(2310680..2310973) FT /rpt_family="Alu" FT repeat_region complement(2309993..2310120) FT /rpt_family="Alu" FT repeat_region complement(2309950..2309976) FT /rpt_family="(T)n" FT repeat_region complement(2308196..2309171) FT /rpt_family="SVA" FT repeat_region complement(2306935..2308182) FT /rpt_family="SVA" FT variation complement(2308018) FT /allele="G" FT /allele="A" FT repeat_region complement(2306680..2306849) FT /rpt_family="MIR" FT repeat_region complement(2306280..2306450) FT /rpt_family="Alu" FT repeat_region complement(2305987..2306279) FT /rpt_family="Alu" FT repeat_region complement(2305810..2305986) FT /rpt_family="Alu" FT repeat_region complement(2305465..2305767) FT /rpt_family="Alu" FT repeat_region complement(2304998..2305297) FT /rpt_family="Alu" FT repeat_region complement(2304709..2304979) FT /rpt_family="Alu" FT repeat_region complement(2304389..2304690) FT /rpt_family="Alu" FT variation complement(2304191) FT /allele="C" FT /allele="A" FT variation complement(2303986) FT /allele="C" FT /allele="T" FT repeat_region complement(2303353..2303648) FT /rpt_family="Alu" FT variation complement(2303109) FT /allele="G" FT /allele="A" FT variation complement(2303074) FT /allele="C" FT /allele="T" FT repeat_region complement(2302471..2302770) FT /rpt_family="Alu" FT repeat_region complement(2301677..2301974) FT /rpt_family="Alu" FT repeat_region complement(2301101..2301180) FT /rpt_family="MIR" FT repeat_region complement(2300786..2301089) FT /rpt_family="Alu" FT repeat_region complement(2300033..2300109) FT /rpt_family="MER1_type" FT repeat_region complement(2299740..2300032) FT /rpt_family="Alu" FT repeat_region complement(2299702..2299739) FT /rpt_family="MER1_type" FT repeat_region complement(2299641..2299671) FT /rpt_family="(TC)n" FT repeat_region complement(2299516..2299640) FT /rpt_family="MER1_type" FT variation complement(2298227) FT /allele="T" FT /allele="C" FT variation complement(2298071) FT /allele="G" FT /allele="A" FT misc_feature complement(2297618..2298062) FT /note="CpG_island (%GC=59.8, o/e=0.68, #CpGs=32)" FT repeat_region complement(2297642..2297949) FT /rpt_family="Alu" FT misc_feature complement(2296354..2297249) FT /note="CpG_island (%GC=68.3, o/e=0.67, #CpGs=72)" FT variation complement(2296696) FT /allele="C" FT /allele="A" FT variation complement(2296493) FT /allele="G" FT /allele="A" FT repeat_region complement(2295264..2295370) FT /rpt_family="Alu" FT repeat_region complement(2295159..2295263) FT /rpt_family="Alu" FT variation complement(2294756) FT /allele="C" FT /allele="G" FT misc_feature complement(2293277..2293576) FT /note="CpG_island (%GC=70.3, o/e=0.77, #CpGs=23)" FT repeat_region complement(2292520..2292698) FT /rpt_family="G-rich" FT repeat_region complement(2292333..2292511) FT /rpt_family="GA-rich" FT repeat_region complement(2292270..2292455) FT /rpt_family="G-rich" FT mRNA complement(2291405..2292284) FT variation complement(2291943) FT /allele="G" FT /allele="A" FT variation complement(2291399) FT /allele="G" FT /allele="A" FT repeat_region complement(2290782..2291082) FT /rpt_family="Alu" FT variation complement(2290685) FT /allele="C" FT /allele="T" FT variation complement(2290522) FT /allele="T" FT /allele="C" FT repeat_region complement(2290086..2290392) FT /rpt_family="Alu" FT repeat_region complement(2289947..2290078) FT /rpt_family="Alu" FT variation complement(2289865) FT /allele="C" FT /allele="A" FT variation complement(2289586) FT /allele="G" FT /allele="A" FT repeat_region complement(2289080..2289218) FT /rpt_family="MIR" FT repeat_region complement(2288178..2288492) FT /rpt_family="Alu" FT repeat_region complement(2287707..2287863) FT /rpt_family="Alu" FT repeat_region complement(2286433..2286551) FT /rpt_family="Alu" FT repeat_region complement(2285488..2285551) FT /rpt_family="MER1_type" FT repeat_region complement(2285251..2285463) FT /rpt_family="Alu" FT repeat_region complement(2285064..2285229) FT /rpt_family="MER1_type" FT repeat_region complement(2284825..2284883) FT /rpt_family="MIR" FT repeat_region complement(2284402..2284625) FT /rpt_family="MIR" FT repeat_region complement(2283126..2283424) FT /rpt_family="Alu" FT repeat_region complement(2282274..2283028) FT /rpt_family="ERV1" FT misc_feature complement(2281363..2282105) FT /note="CpG_island (%GC=73.8, o/e=0.84, #CpGs=78)" FT repeat_region complement(2281558..2281596) FT /rpt_family="GC_rich" FT repeat_region complement(2280980..2281236) FT /rpt_family="Alu" FT repeat_region complement(2550918..2550994) FT /rpt_family="MIR" FT repeat_region complement(2549938..2550006) FT /rpt_family="MIR" FT repeat_region complement(2548760..2548847) FT /rpt_family="MER1_type" FT repeat_region complement(2547582..2547649) FT /rpt_family="MIR" FT repeat_region complement(2546150..2546463) FT /rpt_family="MaLR" FT repeat_region complement(2545838..2546149) FT /rpt_family="Alu" FT repeat_region complement(2545749..2545837) FT /rpt_family="MaLR" FT repeat_region complement(2544549..2544569) FT /rpt_family="GC_rich" FT repeat_region complement(2544070..2544122) FT /rpt_family="MIR" FT repeat_region complement(2543894..2544051) FT /rpt_family="MIR" FT repeat_region complement(2543009..2543077) FT /rpt_family="MIR" FT repeat_region complement(2541432..2541474) FT /rpt_family="CR1" FT misc_feature complement(2541203..2541315) FT /note="match to EST AW882247 (NID:g8044257)" FT repeat_region complement(2540854..2541138) FT /rpt_family="Alu" FT misc_feature complement(2541117..2541131) FT /note="match to EST BF511578 (NID:g11594876)" FT misc_feature complement(2541061..2541112) FT /note="match to EST BG149317 (NID:g12661347)" FT repeat_region complement(2540518..2540852) FT /rpt_family="Alu" FT misc_feature complement(2540209..2540682) FT /note="match to EST AA211096 (NID:g1809818) zq89g01.s1" FT misc_feature complement(2539512..2539940) FT /note="match to EST AA210922 (NID:g1809594) zq89g01.r1" FT repeat_region complement(2536778..2536793) FT /rpt_family="L2" FT repeat_region complement(2536463..2536777) FT /rpt_family="Alu" FT repeat_region complement(2536407..2536462) FT /rpt_family="L2" FT repeat_region complement(2534765..2535067) FT /rpt_family="Alu" FT misc_feature complement(2534336..2534624) FT /note="match to EST AA774302 (NID:g2826111) ac37b12.s1" FT repeat_region complement(2533591..2533740) FT /rpt_family="(ACCTG)n" FT repeat_region complement(2533246..2533358) FT /rpt_family="(CAGAGA)n" FT repeat_region complement(2532262..2532419) FT /rpt_family="(TGGA)n" FT repeat_region complement(2532079..2532261) FT /rpt_family="Alu" FT repeat_region complement(2531992..2532034) FT /rpt_family="(GCTG)n" FT repeat_region complement(2531792..2531970) FT /rpt_family="(TGGA)n" FT repeat_region complement(2531675..2531776) FT /rpt_family="(TGGG)n" FT repeat_region complement(2531107..2531648) FT /rpt_family="(TGGA)n" FT repeat_region complement(2530712..2531070) FT /rpt_family="(TGGA)n" FT repeat_region complement(2530023..2530114) FT /rpt_family="MIR" FT repeat_region complement(2529119..2529422) FT /rpt_family="Alu" FT repeat_region complement(2527824..2528017) FT /rpt_family="MIR" FT repeat_region complement(2526564..2526870) FT /rpt_family="Alu" FT repeat_region complement(2526246..2526547) FT /rpt_family="Alu" FT repeat_region complement(2526183..2526244) FT /rpt_family="MER1_type" FT repeat_region complement(2525881..2526182) FT /rpt_family="Alu" FT repeat_region complement(2525862..2525880) FT /rpt_family="MER1_type" FT repeat_region complement(2525574..2525861) FT /rpt_family="Alu" FT repeat_region complement(2525547..2525573) FT /rpt_family="MER1_type" FT repeat_region complement(2525247..2525546) FT /rpt_family="Alu" FT repeat_region complement(2525178..2525246) FT /rpt_family="MER1_type" FT repeat_region complement(2524886..2525177) FT /rpt_family="Alu" FT repeat_region complement(2524815..2524885) FT /rpt_family="MER1_type" FT repeat_region complement(2524689..2524814) FT /rpt_family="(TG)n" FT repeat_region complement(2524405..2524688) FT /rpt_family="Alu" FT repeat_region complement(2524121..2524292) FT /rpt_family="L2" FT repeat_region complement(2523789..2524041) FT /rpt_family="Alu" FT repeat_region complement(2523649..2523786) FT /rpt_family="MER1_type" FT misc_feature complement(2523374..2523773) FT /note="match to EST BF511578 (NID:g11594876)" FT repeat_region complement(2522931..2523229) FT /rpt_family="Alu" FT repeat_region complement(2522518..2522550) FT /rpt_family="MIR" FT repeat_region complement(2522212..2522360) FT /rpt_family="MIR" FT repeat_region complement(2521866..2521928) FT /rpt_family="MIR" FT repeat_region complement(2521558..2521862) FT /rpt_family="Alu" FT repeat_region complement(2520701..2521107) FT /rpt_family="L2" FT misc_feature complement(2520366..2520862) FT /note="match to EST BF899779 (NID:g12291238)" FT misc_feature complement(2520662..2520664) FT /note="match to EST AA683193 (NID:g2669084) ag94f07.s1" FT repeat_region complement(2519967..2520062) FT /rpt_family="MIR" FT misc_feature complement(2519304..2519618) FT /note="match to EST AA683193 (NID:g2669084) ag94f07.s1" FT repeat_region complement(2519415..2519542) FT /rpt_family="MIR" FT repeat_region complement(2519065..2519211) FT /rpt_family="L2" FT repeat_region complement(2518925..2519053) FT /rpt_family="MIR" FT misc_feature complement(2518198..2518851) FT /note="match to EST BF850938 (NID:g12238100)" FT misc_feature complement(2516842..2516845) FT /note="match to EST BF511578 (NID:g11594876)" FT repeat_region complement(2516091..2516160) FT /rpt_family="(CCCCCA)n" FT misc_feature complement(2515304..2515466) FT /note="similar to Rattus norvegicus EST AI113004 FT (NID:g3512953)" FT misc_feature complement(2514776..2514942) FT /note="similar to Rattus norvegicus EST AI113004 FT (NID:g3512953)" FT misc_feature complement(2514369..2514520) FT /note="similar to Rattus norvegicus EST AI113004 FT (NID:g3512953)" FT repeat_region complement(2513635..2513731) FT /rpt_family="MIR" FT repeat_region complement(2513365..2513509) FT /rpt_family="(TCTA)n" FT repeat_region complement(2513153..2513272) FT /rpt_family="Alu" FT repeat_region complement(2512861..2513152) FT /rpt_family="Alu" FT repeat_region complement(2512714..2512860) FT /rpt_family="Alu" FT repeat_region complement(2512683..2512713) FT /rpt_family="(TGAA)n" FT repeat_region complement(2512464..2512658) FT /rpt_family="MIR" FT repeat_region complement(2512162..2512459) FT /rpt_family="Alu" FT repeat_region complement(2511863..2512161) FT /rpt_family="Alu" FT repeat_region complement(2511547..2511856) FT /rpt_family="Alu" FT repeat_region complement(2510696..2510826) FT /rpt_family="MIR" FT repeat_region complement(2510600..2510652) FT /rpt_family="MIR" FT repeat_region complement(2510347..2510481) FT /rpt_family="L2" FT repeat_region complement(2510229..2510298) FT /rpt_family="CR1" FT repeat_region complement(2509033..2509498) FT /rpt_family="Alu" FT repeat_region complement(2508900..2509032) FT /rpt_family="Alu" FT repeat_region complement(2507607..2507917) FT /rpt_family="Alu" FT repeat_region complement(2507062..2507345) FT /rpt_family="Alu" FT repeat_region complement(2506652..2506955) FT /rpt_family="Alu" FT repeat_region complement(2506418..2506551) FT /rpt_family="L1" FT repeat_region complement(2506242..2506417) FT /rpt_family="Alu" FT repeat_region complement(2506084..2506217) FT /rpt_family="Alu" FT repeat_region complement(2505995..2506069) FT /rpt_family="L1" FT repeat_region complement(2505482..2505922) FT /rpt_family="L1" FT repeat_region complement(2505298..2505409) FT /rpt_family="MER1_type" FT repeat_region complement(2504973..2505286) FT /rpt_family="Alu" FT misc_feature complement(2505120) FT /note="match to EST BG111945 (NID:g12605451)" FT misc_feature complement(2505024..2505107) FT /note="match to EST BG111945 (NID:g12605451)" FT repeat_region complement(2504692..2504965) FT /rpt_family="Alu" FT repeat_region complement(2504501..2504677) FT /rpt_family="L1" FT repeat_region complement(2504195..2504496) FT /rpt_family="Alu" FT repeat_region complement(2503905..2504182) FT /rpt_family="Alu" FT repeat_region complement(2503791..2503810) FT /rpt_family="Alu" FT repeat_region complement(2503480..2503790) FT /rpt_family="Alu" FT repeat_region complement(2503314..2503479) FT /rpt_family="Alu" FT repeat_region complement(2503013..2503313) FT /rpt_family="Alu" FT repeat_region complement(2502874..2503012) FT /rpt_family="Alu" FT repeat_region complement(2502508..2502873) FT /rpt_family="L1" FT repeat_region complement(2502339..2502484) FT /rpt_family="L1" FT repeat_region complement(2501961..2502253) FT /rpt_family="Alu" FT repeat_region complement(2501646..2501955) FT /rpt_family="Alu" FT repeat_region complement(2501452..2501509) FT /rpt_family="MIR" FT misc_feature complement(2501230..2501504) FT /note="match to EST BF588957 (NID:g11681281)" FT repeat_region complement(2499528..2499660) FT /rpt_family="L2" FT repeat_region complement(2498773..2499083) FT /rpt_family="Alu" FT repeat_region complement(2498470..2498756) FT /rpt_family="Alu" FT repeat_region complement(2498111..2498414) FT /rpt_family="Alu" FT misc_feature complement(2497988..2498396) FT /note="match to EST AA865658 (NID:g2957934) og89c04.s1" FT misc_feature complement(2497820..2498377) FT /note="match to EST BG433723 (NID:g13340229)" FT repeat_region complement(2497785..2497950) FT /rpt_family="L2" FT repeat_region complement(2497502..2497784) FT /rpt_family="Alu" FT repeat_region complement(2497467..2497501) FT /rpt_family="L2" FT repeat_region complement(2497308..2497404) FT /rpt_family="MER53" FT repeat_region complement(2497136..2497302) FT /rpt_family="Alu" FT repeat_region complement(2496819..2497125) FT /rpt_family="Alu" FT repeat_region complement(2496225..2496809) FT /rpt_family="L1" FT repeat_region complement(2495940..2496224) FT /rpt_family="Alu" FT repeat_region complement(2495688..2495939) FT /rpt_family="L1" FT repeat_region complement(2495410..2495662) FT /rpt_family="L1" FT repeat_region complement(2495116..2495409) FT /rpt_family="Alu" FT repeat_region complement(2494850..2495115) FT /rpt_family="L1" FT repeat_region complement(2494554..2494849) FT /rpt_family="Alu" FT repeat_region complement(2494487..2494553) FT /rpt_family="L1" FT repeat_region complement(2494171..2494486) FT /rpt_family="Alu" FT misc_feature complement(2494195..2494221) FT /note="match to EST BG111945 (NID:g12605451)" FT repeat_region complement(2493978..2494170) FT /rpt_family="L1" FT repeat_region complement(2493885..2493976) FT /rpt_family="(TA)n" FT repeat_region complement(2493594..2493884) FT /rpt_family="Alu" FT repeat_region complement(2493279..2493593) FT /rpt_family="L1" FT repeat_region complement(2492959..2493278) FT /rpt_family="Alu" FT repeat_region complement(2492703..2492958) FT /rpt_family="L1" FT repeat_region complement(2492422..2492702) FT /rpt_family="Alu" FT repeat_region complement(2492238..2492410) FT /rpt_family="GA-rich" FT repeat_region complement(2492131..2492259) FT /rpt_family="(GGGGA)n" FT misc_feature complement(2491845..2492196) FT /note="match to EST AW675202 (NID:g7540437) bb41c01.y1" FT repeat_region complement(2490610..2490902) FT /rpt_family="Alu" FT misc_feature complement(2490423..2490655) FT /note="match to EST BG149317 (NID:g12661347)" FT misc_feature complement(2490083..2490321) FT /note="match to EST BF359283 (NID:g11318459)" FT repeat_region complement(2489650..2489946) FT /rpt_family="Alu" FT misc_feature complement(2489916..2489931) FT /note="match to EST AA700315 (NID:g2703278) zj73h10.s1" FT repeat_region complement(2488869..2489154) FT /rpt_family="Alu" FT repeat_region complement(2488548..2488851) FT /rpt_family="Alu" FT repeat_region complement(2488440..2488547) FT /rpt_family="Alu" FT repeat_region complement(2488381..2488435) FT /rpt_family="(GGGAA)n" FT repeat_region complement(2487885..2488147) FT /rpt_family="CR1" FT repeat_region complement(2487509..2487802) FT /rpt_family="Alu" FT repeat_region complement(2487432..2487497) FT /rpt_family="ERV1" FT repeat_region complement(2487108..2487407) FT /rpt_family="Alu" FT misc_feature complement(2486894..2487231) FT /note="match to EST BG111945 (NID:g12605451)" FT misc_feature complement(2486675..2487135) FT /note="similar to EST BM704584 (NID:g19017835)" FT misc_feature complement(2486706..2487133) FT /note="match to EST AA700315 (NID:g2703278) zj73h10.s1" FT misc_feature complement(2486389..2486786) FT /note="match to EST AA485611 (NID:g2214830) zx90g08.r1" FT misc_feature complement(2485577..2486288) FT /note="match to EST BG743239 (NID:g14053892)" FT misc_feature complement(2485181..2485559) FT /note="match to EST BF918454 (NID:g12314342)" FT repeat_region complement(2485091..2485363) FT /rpt_family="Alu" FT repeat_region complement(2483952..2484116) FT /rpt_family="Alu" FT misc_feature complement(2484005..2484106) FT /note="match to EST AA449104 (NID:g2163124) zx08a02.s1" FT repeat_region complement(2483638..2483951) FT /rpt_family="Alu" FT repeat_region complement(2483502..2483637) FT /rpt_family="Alu" FT repeat_region complement(2483141..2483212) FT /rpt_family="L1" FT repeat_region complement(2483035..2483138) FT /rpt_family="MER1_type" FT repeat_region complement(2482727..2483034) FT /rpt_family="Alu" FT repeat_region complement(2482558..2482726) FT /rpt_family="Alu" FT repeat_region complement(2482326..2482556) FT /rpt_family="MER1_type" FT repeat_region complement(2482298..2482325) FT /rpt_family="L1" FT repeat_region complement(2482008..2482297) FT /rpt_family="Alu" FT repeat_region complement(2481494..2482007) FT /rpt_family="L1" FT repeat_region complement(2481056..2481348) FT /rpt_family="Alu" FT misc_feature complement(2481177..2481231) FT /note="match to EST AA449104 (NID:g2163124) zx08a02.s1" FT misc_feature complement(2480695..2480906) FT /note="match to EST BF378256 (NID:g11367433)" FT misc_feature complement(2480039..2480399) FT /note="similar to EST BM423201 (NID:g18392695)" FT repeat_region complement(2479966..2480060) FT /rpt_family="(CA)n" FT misc_feature complement(2479580..2480005) FT /note="similar to EST BM423201 (NID:g18392695)" FT repeat_region complement(2479524..2479653) FT /rpt_family="Alu" FT repeat_region complement(2479233..2479523) FT /rpt_family="Alu" FT repeat_region complement(2479048..2479232) FT /rpt_family="Alu" FT misc_feature complement(2478571..2479054) FT /note="match to EST BI090583 (NID:g14508913)" FT misc_feature complement(2478306..2478809) FT /note="match to EST AW503729 (NID:g7141396)" FT misc_feature complement(2477398..2477555) FT /note="match to EST BG743239 (NID:g14053892)" FT repeat_region complement(2477349..2477407) FT /rpt_family="(TG)n" FT repeat_region complement(2475757..2476260) FT /rpt_family="L1" FT repeat_region complement(2475438..2475748) FT /rpt_family="Alu" FT misc_feature complement(2475431..2475435) FT /note="match to EST BI046442 (NID:g14453051)" FT repeat_region complement(2474851..2474894) FT /rpt_family="(TCTA)n" FT repeat_region complement(2474573..2474850) FT /rpt_family="Alu" FT repeat_region complement(2474441..2474572) FT /rpt_family="Alu" FT repeat_region complement(2474100..2474417) FT /rpt_family="Alu" FT misc_feature complement(2473938..2474227) FT /note="match to EST AA449104 (NID:g2163124) zx08a02.s1" FT misc_feature complement(2473692..2474218) FT /note="match to EST BE220322 (NID:g8907640) hv70g09.x1" FT misc_feature complement(2473681..2474143) FT /note="match to EST AA242851 (NID:g1873661) zr64b01.r1" FT misc_feature complement(2473869..2474000) FT /note="match to EST AA583629 (NID:g2368238) ni43f07.s1" FT misc_feature complement(2473650..2473876) FT /note="match to EST D80941 (NID:g1178818)" FT misc_feature complement(2472246..2473807) FT /note="CpG_island (%GC=63.4, o/e=0.80, #CpGs=146)" FT repeat_region complement(2473737..2473776) FT /rpt_family="(CGGG)n" FT misc_feature complement(2473235..2473696) FT /note="match to EST AI961321 (NID:g5754034) wt16g11.x1" FT misc_feature complement(2472995..2473696) FT /note="match to EST BG743938 (NID:g14054591)" FT misc_feature complement(2473472..2473692) FT /note="match to EST AI687192 (NID:g4898486) tp85a12.x1" FT misc_feature complement(2472994..2473630) FT /note="match to EST BG744620 (NID:g14055273)" FT misc_feature complement(2472743..2473627) FT /note="match to EST AL576957 (NID:g12939614)" FT misc_feature complement(2473162..2473615) FT /note="similar to Homo sapiens EST BE621538 (NID:g9892478)" FT misc_feature complement(2472852..2473615) FT /note="match to EST BI523253 (NID:g15348045)" FT misc_feature complement(2473197..2473519) FT /note="similar to Rattus norvegicus EST BI275885 FT (NID:g14920254)" FT misc_feature complement(2473179..2473519) FT /note="similar to Mus musculus EST BF577747 FT (NID:g11651459)" FT misc_feature complement(2473135..2473449) FT /note="match to EST BI043000 (NID:g14449626)" FT misc_feature complement(2472635..2473405) FT /note="match to EST BF314482 (NID:g11262602)" FT misc_feature complement(2472857..2473296) FT /note="similar to Mus musculus EST W11016 (NID:g1285321) FT ma47c09.r1" FT misc_feature complement(2472653..2473180) FT /note="match to EST BE261749 (NID:g9134174)" FT misc_feature complement(2472400..2473165) FT /note="match to EST BG824396 (NID:g14171983)" FT misc_feature complement(2472198..2473149) FT /note="match to EST AL551242 (NID:g12889000)" FT misc_feature complement(2472210..2473068) FT /note="similar to Mus musculus EST BE371777 (NID:g9317244)" FT misc_feature complement(2472897..2473055) FT /note="similar to Mus musculus EST AA823596 (NID:g2893464) FT vw38a03.r1" FT misc_feature complement(2472198..2473014) FT /note="match to EST BE728420 (NID:g10142412)" FT misc_feature complement(2472562..2472940) FT /note="similar to Rattus norvegicus EST BI288174 FT (NID:g14944499)" FT misc_feature complement(2472515..2472922) FT /note="similar to EST BM721669 (NID:g19041739)" FT misc_feature complement(2472198..2472913) FT /note="match to EST BG704827 (NID:g13978555)" FT misc_feature complement(2472198..2472804) FT /note="match to EST BE729783 (NID:g10143775)" FT misc_feature complement(2472198..2472705) FT /note="match to EST BG477905 (NID:g13410184)" FT misc_feature complement(2472198..2472603) FT /note="similar to Homo sapiens EST BE727929 FT (NID:g10141921)" FT misc_feature complement(2472198..2472461) FT /note="match to EST AA852700 (NID:g2941293)" FT misc_feature complement(2472198..2472405) FT /note="similar to Homo sapiens EST BG282276 FT (NID:g13031203)" FT misc_feature complement(2472314..2472315) FT /note="match to EST BG743938 (NID:g14054591)" FT repeat_region complement(2471809..2472102) FT /rpt_family="ERVL" FT repeat_region complement(2471680..2471806) FT /rpt_family="Alu" FT repeat_region complement(2471547..2471676) FT /rpt_family="ERVL" FT repeat_region complement(2471169..2471484) FT /rpt_family="L1" FT misc_feature complement(2471279..2471281) FT /note="match to EST BF314482 (NID:g11262602)" FT repeat_region complement(2470523..2470987) FT /rpt_family="L1" FT misc_feature complement(2470935..2470939) FT /note="match to EST AL576957 (NID:g12939614)" FT repeat_region complement(2470304..2470518) FT /rpt_family="Alu" FT repeat_region complement(2470253..2470303) FT /rpt_family="Alu" FT repeat_region complement(2469940..2470252) FT /rpt_family="Alu" FT repeat_region complement(2469719..2469938) FT /rpt_family="L1" FT repeat_region complement(2469409..2469717) FT /rpt_family="Alu" FT repeat_region complement(2469055..2469402) FT /rpt_family="L1" FT repeat_region complement(2468895..2469010) FT /rpt_family="Alu" FT repeat_region complement(2468023..2468894) FT /rpt_family="ERVK" FT repeat_region complement(2467821..2468022) FT /rpt_family="Alu" FT repeat_region complement(2467732..2467819) FT /rpt_family="L1" FT repeat_region complement(2467450..2467731) FT /rpt_family="Alu" FT repeat_region complement(2467244..2467449) FT /rpt_family="L1" FT repeat_region complement(2466884..2467152) FT /rpt_family="Alu" FT repeat_region complement(2466716..2466846) FT /rpt_family="Alu" FT misc_feature complement(2466834..2466844) FT /note="match to EST D80941 (NID:g1178818)" FT repeat_region complement(2466347..2466653) FT /rpt_family="Alu" FT repeat_region complement(2466191..2466273) FT /rpt_family="L1" FT repeat_region complement(2465309..2465514) FT /rpt_family="L1" FT misc_feature complement(2464929..2465153) FT /note="match to EST H97308 (NID:g1118193)" FT repeat_region complement(2464559..2464868) FT /rpt_family="Alu" FT misc_feature complement(2464537..2464542) FT /note="match to EST D80941 (NID:g1178818)" FT repeat_region complement(2464180..2464443) FT /rpt_family="CR1" FT repeat_region complement(2463707..2463988) FT /rpt_family="Alu" FT repeat_region complement(2463438..2463690) FT /rpt_family="Alu" FT repeat_region complement(2462637..2462933) FT /rpt_family="Alu" FT repeat_region complement(2462180..2462468) FT /rpt_family="Alu" FT repeat_region complement(2461871..2462179) FT /rpt_family="Alu" FT repeat_region complement(2461501..2461546) FT /rpt_family="L1" FT repeat_region complement(2461372..2461500) FT /rpt_family="Alu" FT repeat_region complement(2461061..2461371) FT /rpt_family="Alu" FT repeat_region complement(2461046..2461060) FT /rpt_family="Alu" FT repeat_region complement(2460700..2461045) FT /rpt_family="Alu" FT repeat_region complement(2460498..2460699) FT /rpt_family="Alu" FT repeat_region complement(2459569..2460497) FT /rpt_family="L1" FT repeat_region complement(2460161..2460435) FT /rpt_family="Alu" FT repeat_region complement(2459907..2460160) FT /rpt_family="L1" FT repeat_region complement(2459598..2459906) FT /rpt_family="Alu" FT repeat_region complement(2459361..2459597) FT /rpt_family="L1" FT repeat_region complement(2459060..2459360) FT /rpt_family="Alu" FT repeat_region complement(2458762..2459058) FT /rpt_family="Alu" FT repeat_region complement(2458413..2458732) FT /rpt_family="Alu" FT repeat_region complement(2457325..2457524) FT /rpt_family="ERVL" FT repeat_region complement(2457023..2457324) FT /rpt_family="Alu" FT repeat_region complement(2456862..2457022) FT /rpt_family="Alu" FT repeat_region complement(2456688..2456785) FT /rpt_family="ERVL" FT repeat_region complement(2456239..2456684) FT /rpt_family="ERV1" FT misc_feature complement(2456562..2456565) FT /note="similar to Homo sapiens EST AL522771 FT (NID:g12786264)" FT repeat_region complement(2455549..2456238) FT /rpt_family="MER2_type" FT repeat_region complement(2455238..2455548) FT /rpt_family="Alu" FT repeat_region complement(2455015..2455237) FT /rpt_family="MER2_type" FT repeat_region complement(2454719..2455014) FT /rpt_family="Alu" FT repeat_region complement(2454601..2454718) FT /rpt_family="MER2_type" FT repeat_region complement(2454220..2454600) FT /rpt_family="L1" FT repeat_region complement(2453906..2454219) FT /rpt_family="Alu" FT repeat_region complement(2453667..2453905) FT /rpt_family="L1" FT repeat_region complement(2453359..2453663) FT /rpt_family="Alu" FT repeat_region complement(2453026..2453314) FT /rpt_family="L1" FT repeat_region complement(2452760..2452889) FT /rpt_family="MIR" FT repeat_region complement(2452297..2452470) FT /rpt_family="MIR" FT misc_feature complement(2451877..2452140) FT /note="match to EST AI917830 (NID:g5637685) wb66e02.x1" FT repeat_region complement(2451124..2451416) FT /rpt_family="Alu" FT repeat_region complement(2450692..2451016) FT /rpt_family="Alu" FT repeat_region complement(2450171..2450689) FT /rpt_family="L2" FT repeat_region complement(2450002..2450159) FT /rpt_family="Alu" FT repeat_region complement(2449855..2449923) FT /rpt_family="L2" FT repeat_region complement(2449583..2449715) FT /rpt_family="Alu" FT repeat_region complement(2449279..2449396) FT /rpt_family="L1" FT repeat_region complement(2448972..2449278) FT /rpt_family="Alu" FT repeat_region complement(2448180..2448971) FT /rpt_family="L1" FT repeat_region complement(2447723..2448027) FT /rpt_family="Alu" FT repeat_region complement(2447290..2447587) FT /rpt_family="Alu" FT repeat_region complement(2447100..2447226) FT /rpt_family="L1" FT repeat_region complement(2446842..2447099) FT /rpt_family="Alu" FT repeat_region complement(2446213..2446841) FT /rpt_family="L1" FT repeat_region complement(2446000..2446170) FT /rpt_family="C-rich" FT repeat_region complement(2444798..2445069) FT /rpt_family="Alu" FT misc_feature complement(2443260..2444072) FT /note="match to EST BM006278 (NID:g16520632)" FT misc_feature complement(2442793..2444011) FT /note="CpG_island (%GC=72.6, o/e=0.90, #CpGs=142)" FT repeat_region complement(2443378..2443405) FT /rpt_family="GC_rich" FT repeat_region complement(2443313..2443344) FT /rpt_family="GC_rich" FT misc_feature complement(2443245..2443280) FT /note="match to EST AA852700 (NID:g2941293)" FT misc_feature complement(2443246..2443280) FT /note="match to EST BE729783 (NID:g10143775)" FT misc_feature complement(2443243..2443280) FT /note="similar to Homo sapiens EST BE727929 FT (NID:g10141921)" FT /note="match to EST BE728420 (NID:g10142412)" FT misc_feature complement(2443224..2443280) FT /note="match to EST BG477905 (NID:g13410184)" FT /note="similar to Homo sapiens EST BG282276 FT (NID:g13031203)" FT misc_feature complement(2443221..2443280) FT /note="match to EST AL551242 (NID:g12889000)" FT misc_feature complement(2443209..2443280) FT /note="match to EST BG704827 (NID:g13978555)" FT repeat_region complement(2443249..2443278) FT /rpt_family="GC_rich" FT repeat_region complement(2443201..2443221) FT /rpt_family="GC_rich" FT misc_feature complement(2443193) FT /note="match to EST BG477905 (NID:g13410184)" FT /note="similar to Homo sapiens EST BG282276 FT (NID:g13031203)" FT repeat_region complement(2443081..2443163) FT /rpt_family="GC_rich" FT repeat_region complement(2442944..2442972) FT /rpt_family="GC_rich" FT repeat_region complement(2442608..2442779) FT /rpt_family="MIR" FT repeat_region complement(2442281..2442591) FT /rpt_family="Alu" FT repeat_region complement(2442219..2442270) FT /rpt_family="L1" FT repeat_region complement(2442174..2442218) FT /rpt_family="(TTG)n" FT repeat_region complement(2441893..2442173) FT /rpt_family="Alu" FT repeat_region complement(2441812..2441892) FT /rpt_family="L1" FT repeat_region complement(2441582..2441692) FT /rpt_family="L2" FT repeat_region complement(2441410..2441562) FT /rpt_family="(TATG)n" FT repeat_region complement(2441124..2441341) FT /rpt_family="Alu" FT repeat_region complement(2440825..2441121) FT /rpt_family="Alu" FT repeat_region complement(2440718..2440824) FT /rpt_family="Alu" FT repeat_region complement(2440618..2440675) FT /rpt_family="L1" FT repeat_region complement(2440309..2440617) FT /rpt_family="Alu" FT repeat_region complement(2440271..2440308) FT /rpt_family="L1" FT repeat_region complement(2440184..2440261) FT /rpt_family="L1" FT repeat_region complement(2440010..2440128) FT /rpt_family="MIR" FT misc_feature complement(2439779..2439783) FT /note="match to EST BE733424 (NID:g10147416)" FT repeat_region complement(2439371..2439584) FT /rpt_family="Alu" FT repeat_region complement(2438932..2439235) FT /rpt_family="Alu" FT repeat_region complement(2438792..2438923) FT /rpt_family="Alu" FT repeat_region complement(2438394..2438705) FT /rpt_family="Alu" FT misc_feature complement(2438672..2438693) FT /note="similar to Homo sapiens EST AA682372 (NID:g2669653) FT zj86a05.s1" FT repeat_region complement(2437818..2438140) FT /rpt_family="L2" FT repeat_region complement(2437509..2437817) FT /rpt_family="Alu" FT repeat_region complement(2437236..2437506) FT /rpt_family="Alu" FT repeat_region complement(2437041..2437235) FT /rpt_family="Alu" FT repeat_region complement(2436726..2437030) FT /rpt_family="Alu" FT repeat_region complement(2436387..2436725) FT /rpt_family="Alu" FT repeat_region complement(2436297..2436382) FT /rpt_family="Alu" FT misc_feature complement(2436040..2436044) FT /note="similar to Homo sapiens EST BG951854 FT (NID:g14370025)" FT repeat_region complement(2435926..2435966) FT /rpt_family="MIR" FT misc_feature complement(2435926..2435930) FT /note="similar to Homo sapiens EST T31849 (NID:g613947)" FT repeat_region complement(2435851..2435925) FT /rpt_family="MaLR" FT repeat_region complement(2435520..2435826) FT /rpt_family="Alu" FT repeat_region complement(2435280..2435461) FT /rpt_family="(TCTA)n" FT repeat_region complement(2435183..2435243) FT /rpt_family="ERVL" FT repeat_region complement(2435016..2435182) FT /rpt_family="MaLR" FT repeat_region complement(2434587..2434891) FT /rpt_family="Alu" FT misc_feature complement(2434823..2434824) FT /note="similar to Homo sapiens EST BG333075 FT (NID:g13139513)" FT misc_feature complement(2434585..2434586) FT /note="similar to Homo sapiens EST BI194505 FT (NID:g14649525)" FT misc_feature complement(2434585) FT /note="similar to Homo sapiens EST BG821141 FT (NID:g14168728)" FT misc_feature complement(2434082..2434584) FT /note="similar to Homo sapiens EST BF973831 FT (NID:g12341046)" FT /note="similar to Homo sapiens EST BI601720 FT (NID:g15494659)" FT misc_feature complement(2434490..2434584) FT /note="similar to Homo sapiens EST BI548589 FT (NID:g15435901)" FT misc_feature complement(2434082..2434582) FT /note="similar to Homo sapiens EST BI603255 FT (NID:g15496194)" FT misc_feature complement(2434337..2434581) FT /note="similar to Homo sapiens EST AW249343 (NID:g6592336)" FT misc_feature complement(2434395..2434580) FT /note="similar to Homo sapiens EST BG333075 FT (NID:g13139513)" FT misc_feature complement(2434345..2434567) FT /note="similar to Homo sapiens EST BG821141 FT (NID:g14168728)" FT misc_feature complement(2434185..2434559) FT /note="similar to Homo sapiens EST BM046621 FT (NID:g16775888)" FT misc_feature complement(2434082..2434538) FT /note="similar to Homo sapiens EST BE251727 (NID:g9121858)" FT misc_feature complement(2434395..2434483) FT /note="similar to Homo sapiens EST BI258642 FT (NID:g14815196)" FT misc_feature complement(2434199..2434429) FT /note="similar to Homo sapiens EST AV753106 FT (NID:g10910954)" FT misc_feature complement(2434395..2434396) FT /note="similar to Homo sapiens EST BE900380 FT (NID:g10388310)" FT misc_feature complement(2434082..2434301) FT /note="similar to Homo sapiens EST BE264565 (NID:g9138122)" FT /note="similar to Homo sapiens EST BE672568 FT (NID:g10033109)" FT misc_feature complement(2434082..2434277) FT /note="similar to Homo sapiens EST BI194505 FT (NID:g14649525)" FT misc_feature complement(2434082..2434255) FT /note="similar to Homo sapiens EST BE900380 FT (NID:g10388310)" FT misc_feature complement(2434086..2434183) FT /note="similar to Homo sapiens EST AL522771 FT (NID:g12786264)" FT repeat_region complement(2433777..2434084) FT /rpt_family="Alu" FT misc_feature complement(2433197..2433781) FT /note="similar to Homo sapiens EST BG775294 FT (NID:g14045611)" FT misc_feature complement(2433294..2433781) FT /note="similar to Homo sapiens EST AL522770 FT (NID:g12786263)" FT misc_feature complement(2433223..2433781) FT /note="similar to Homo sapiens EST BE787259 FT (NID:g10208457)" FT misc_feature complement(2433559..2433781) FT /note="similar to Homo sapiens EST AV708186 FT (NID:g10725451)" FT misc_feature complement(2433401..2433781) FT /note="similar to Homo sapiens EST AV658328 (NID:g9879342)" FT misc_feature complement(2433182..2433781) FT /note="similar to EST BM558932 (NID:g18802089)" FT misc_feature complement(2433673..2433781) FT /note="match to EST AV707808 (NID:g10725073)" FT misc_feature complement(2433252..2433781) FT /note="similar to EST BM463026 (NID:g18512066)" FT misc_feature complement(2433648..2433776) FT /note="similar to Homo sapiens EST BG333075 FT (NID:g13139513)" FT misc_feature complement(2433562..2433776) FT /note="similar to Homo sapiens EST M86158 (NID:g274814)" FT misc_feature complement(2433484..2433767) FT /note="similar to Homo sapiens EST AL522771 FT (NID:g12786264)" FT misc_feature complement(2433407..2433767) FT /note="similar to Homo sapiens EST AA682372 (NID:g2669653) FT zj86a05.s1" FT misc_feature complement(2433730..2433767) FT /note="similar to Homo sapiens EST BE900380 FT (NID:g10388310)" FT misc_feature complement(2433415..2433767) FT /note="similar to Homo sapiens EST BI548589 FT (NID:g15435901)" FT misc_feature complement(2433418..2433767) FT /note="similar to Homo sapiens EST BI258642 FT (NID:g14815196)" FT misc_feature complement(2433662..2433755) FT /note="similar to Homo sapiens EST BI194505 FT (NID:g14649525)" FT misc_feature complement(2433637..2433686) FT /note="similar to Homo sapiens EST BE857477 FT (NID:g10371542)" FT misc_feature complement(2433197..2433608) FT /note="similar to Homo sapiens EST BE857477 FT (NID:g10371542)" FT misc_feature complement(2433257..2433576) FT /note="similar to Homo sapiens EST BE762696 FT (NID:g10192620)" FT misc_feature complement(2433197..2433575) FT /note="similar to Homo sapiens EST AW249458 (NID:g6592451)" FT misc_feature complement(2433197..2433572) FT /note="similar to Homo sapiens EST BE543381 (NID:g9772026)" FT misc_feature complement(2433413..2433570) FT /note="similar to Homo sapiens EST AI277370 (NID:g3899638) FT qm54c04.x1" FT misc_feature complement(2433403..2433560) FT /note="similar to Homo sapiens EST W28002 (NID:g1308013)" FT misc_feature complement(2433280..2433522) FT /note="similar to Homo sapiens EST AV753106 FT (NID:g10910954)" FT misc_feature complement(2433219..2433482) FT /note="similar to Homo sapiens EST T34796 (NID:g616894)" FT misc_feature complement(2433197..2433392) FT /note="similar to Homo sapiens EST AI277370 (NID:g3899638) FT qm54c04.x1" FT misc_feature complement(2433197..2433388) FT /note="similar to Homo sapiens EST F21021 (NID:g2060197)" FT misc_feature complement(2433197..2433368) FT /note="similar to Homo sapiens EST T31849 (NID:g613947)" FT misc_feature complement(2433197..2433365) FT /note="similar to Homo sapiens EST AA662167 (NID:g2616258) FT ns66c10.s1" FT misc_feature complement(2433182..2433364) FT /note="similar to Homo sapiens EST AW381027 (NID:g6885686)" FT misc_feature complement(2433216..2433346) FT /note="match to EST AV707808 (NID:g10725073)" FT misc_feature complement(2433260..2433339) FT /note="similar to Homo sapiens EST AV658328 (NID:g9879342)" FT misc_feature complement(2433203..2433284) FT /note="similar to Homo sapiens EST AV708186 FT (NID:g10725451)" FT repeat_region complement(2432877..2433183) FT /rpt_family="Alu" FT misc_feature complement(2432714..2432879) FT /note="similar to Homo sapiens EST AV708186 FT (NID:g10725451)" FT misc_feature complement(2432717..2432873) FT /note="similar to Homo sapiens EST AW615611 (NID:g7316309) FT ba12g05.x1" FT misc_feature complement(2432730..2432871) FT /note="similar to Homo sapiens EST AA662167 (NID:g2616258) FT ns66c10.s1" FT misc_feature complement(2432717..2432871) FT /note="similar to Homo sapiens EST AI277370 (NID:g3899638) FT qm54c04.x1" FT misc_feature complement(2432771..2432871) FT /note="similar to Homo sapiens EST BG775294 FT (NID:g14045611)" FT misc_feature complement(2432737..2432871) FT /note="similar to Homo sapiens EST BE857477 FT (NID:g10371542)" FT /note="similar to Homo sapiens EST T31849 (NID:g613947)" FT misc_feature complement(2432734..2432871) FT /note="similar to Homo sapiens EST F21021 (NID:g2060197)" FT misc_feature complement(2432721..2432871) FT /note="similar to Homo sapiens EST AW249458 (NID:g6592451)" FT /note="similar to Homo sapiens EST BE543381 (NID:g9772026)" FT misc_feature complement(2432722..2432853) FT /note="similar to EST BM558932 (NID:g18802089)" FT repeat_region complement(2432709..2432731) FT /rpt_family="(TAAA)n" FT repeat_region complement(2432266..2432551) FT /rpt_family="Alu" FT repeat_region complement(2431911..2432202) FT /rpt_family="Alu" FT repeat_region complement(2431201..2431647) FT /rpt_family="MaLR" FT repeat_region complement(2430830..2431132) FT /rpt_family="Alu" FT misc_feature complement(2430834..2430847) FT /note="similar to Homo sapiens EST AA662167 (NID:g2616258) FT ns66c10.s1" FT repeat_region complement(2429042..2430007) FT /rpt_family="ERVK" FT repeat_region complement(2427330..2427635) FT /rpt_family="Alu" FT repeat_region complement(2427195..2427327) FT /rpt_family="Alu" FT repeat_region complement(2426745..2426862) FT /rpt_family="MIR" FT misc_feature complement(2426595..2426612) FT /note="similar to Homo sapiens EST BE794862 FT (NID:g10216060)" FT repeat_region complement(2426270..2426545) FT /rpt_family="Alu" FT repeat_region complement(2426222..2426250) FT /rpt_family="(TCCC)n" FT repeat_region complement(2425943..2426221) FT /rpt_family="Alu" FT repeat_region complement(2425639..2425799) FT /rpt_family="L1" FT repeat_region complement(2425324..2425634) FT /rpt_family="Alu" FT repeat_region complement(2424998..2425307) FT /rpt_family="Alu" FT misc_feature complement(2425124..2425128) FT /note="match to EST AW138934 (NID:g6143252)" FT misc_feature complement(2423542..2423543) FT /note="match to EST BE150857 (NID:g8613578)" FT misc_feature complement(2423147..2423149) FT /note="match to EST AW390660 (NID:g6895319)" FT repeat_region complement(2422557..2422832) FT /rpt_family="Alu" FT repeat_region complement(2422141..2422306) FT /rpt_family="Alu" FT misc_feature complement(2421901) FT /note="match to EST BE045478 (NID:g8362455) hk76c02.x1" FT misc_feature complement(2421264..2421584) FT /note="match to EST BE045478 (NID:g8362455) hk76c02.x1" FT misc_feature complement(2420973..2421518) FT /note="match to EST AW138934 (NID:g6143252)" FT repeat_region complement(2420677..2420964) FT /rpt_family="Alu" FT misc_feature complement(2419839..2420382) FT /note="match to EST BG481207 (NID:g13413486)" FT misc_feature complement(2419914..2420382) FT /note="match to EST AI888128 (NID:g5593292) wm52d03.x1" FT misc_feature complement(2419839..2420381) FT /note="match to EST BI159903 (NID:g14619904)" FT misc_feature complement(2419919..2420380) FT /note="match to EST BI859192 (NID:g15999939)" FT misc_feature complement(2419839..2420380) FT /note="match to EST BE900418 (NID:g10388561)" FT misc_feature complement(2419838..2420380) FT /note="similar to Homo sapiens EST BE562563 (NID:g9806283)" FT misc_feature complement(2420160..2420380) FT /note="similar to EST BM449485 (NID:g18498525)" FT misc_feature complement(2419913..2420377) FT /note="match to EST BE894884 (NID:g10357720)" FT misc_feature complement(2419839..2420377) FT /note="match to EST AW516174 (NID:g7154256) xt62a10.x1" FT misc_feature complement(2420141..2420376) FT /note="match to EST AW006622 (NID:g5855400) wt06a10.x1" FT misc_feature complement(2419955..2420375) FT /note="similar to Homo sapiens EST AI873696 (NID:g5547745) FT wm28e09.x1" FT misc_feature complement(2419984..2420375) FT /note="match to EST AI420704 (NID:g4266635) tf18g06.x1" FT misc_feature complement(2419838..2420375) FT /note="match to EST BG232076 (NID:g12727231)" FT misc_feature complement(2420043..2420375) FT /note="match to EST AA665859 (NID:g2620472) ac44d05.s1" FT misc_feature complement(2420019..2420374) FT /note="match to EST AI336324 (NID:g4073251) qt43e09.x1" FT misc_feature complement(2419839..2420341) FT /note="match to EST AL555876 (NID:g12898024)" FT misc_feature complement(2420050..2420336) FT /note="match to EST BG468160 (NID:g13400430)" FT misc_feature complement(2419919..2420327) FT /note="similar to Homo sapiens EST BI085798 FT (NID:g14504128)" FT misc_feature complement(2419509..2420326) FT /note="match to EST BM042900 (NID:g16772167)" FT misc_feature complement(2420321) FT /note="match to EST BM042292 (NID:g16771559)" FT misc_feature complement(2419914..2420321) FT /note="match to EST BE293405 (NID:g9176576)" FT misc_feature complement(2419914..2420319) FT /note="match to EST BG253176 (NID:g12762992)" FT misc_feature complement(2419919..2420316) FT /note="match to EST AL581202 (NID:g12947967)" FT misc_feature complement(2419496..2420314) FT /note="match to EST BM042292 (NID:g16771559)" FT misc_feature complement(2419839..2420313) FT /note="match to EST BF316431 (NID:g11264788)" FT misc_feature complement(2420050..2420302) FT /note="match to EST BG116314 (NID:g12609820)" FT misc_feature complement(2419919..2420288) FT /note="match to EST BG767676 (NID:g14078329)" FT misc_feature complement(2419952..2420287) FT /note="similar to Mus musculus EST BI408959 FT (NID:g15169882)" FT misc_feature complement(2419914..2420287) FT /note="similar to Mus musculus EST BI653326 FT (NID:g15567562)" FT /note="similar to EST BM232572 (NID:g17867842)" FT misc_feature complement(2419839..2420219) FT /note="match to EST BF971955 (NID:g12339170)" FT misc_feature complement(2419954..2420174) FT /note="match to EST F35747 (NID:g4821373)" FT misc_feature complement(2419839..2420170) FT /note="match to EST AW390660 (NID:g6895319)" FT misc_feature complement(2419839..2420160) FT /note="similar to EST BM715334 (NID:g19028592)" FT misc_feature complement(2419839..2420142) FT /note="similar to Homo sapiens EST BE791506 FT (NID:g10212704)" FT misc_feature complement(2419914..2420132) FT /note="match to EST BF733778 (NID:g12059014)" FT misc_feature complement(2419839..2420129) FT /note="match to EST AW377443 (NID:g6882106)" FT misc_feature complement(2420107..2420108) FT /note="match to EST BI227087 (NID:g14680531)" FT misc_feature complement(2419839..2420101) FT /note="match to EST BE733424 (NID:g10147416)" FT misc_feature complement(2419512..2420092) FT /note="match to EST BF852855 (NID:g12240599)" FT misc_feature complement(2419839..2420089) FT /note="match to EST BG679127 (NID:g13910524)" FT misc_feature complement(2419839..2420076) FT /note="match to EST BG682007 (NID:g13913404)" FT misc_feature complement(2419839..2420072) FT /note="match to EST BE797023 (NID:g10218221)" FT misc_feature complement(2419839..2420070) FT /note="match to EST BE786131 (NID:g10207329)" FT misc_feature complement(2419839..2420055) FT /note="match to EST BI227087 (NID:g14680531)" FT misc_feature complement(2419765..2420038) FT /note="similar to Homo sapiens EST AW379920 (NID:g6884579)" FT misc_feature complement(2420033..2420034) FT /note="match to EST BE150868 (NID:g8613589)" FT misc_feature complement(2419919..2420012) FT /note="match to EST BE150857 (NID:g8613578)" FT misc_feature complement(2419839..2419977) FT /note="match to EST BG682350 (NID:g13913747)" FT misc_feature complement(2419926..2419971) FT /note="match to EST BE150868 (NID:g8613589)" FT misc_feature complement(2419839..2419960) FT /note="similar to EST BM556498 (NID:g18797788)" FT misc_feature complement(2419914..2419960) FT /note="match to EST AI420704 (NID:g4266635) tf18g06.x1" FT misc_feature complement(2419839..2419951) FT /note="match to EST BE018042 (NID:g8277986) bb73d03.y1" FT misc_feature complement(2419914..2419950) FT /note="match to EST BE698773 (NID:g10085933)" FT misc_feature complement(2419839..2419886) FT /note="match to EST AW247372 (NID:g6590365)" FT /note="match to EST BF813415 (NID:g12144362)" FT misc_feature complement(2419328..2419881) FT /note="match to EST AW178115 (NID:g6444152)" FT misc_feature complement(2419839..2419875) FT /note="match to EST BF802902 (NID:g12131891)" FT misc_feature complement(2419839..2419872) FT /note="match to EST BE077404 (NID:g8428185)" FT misc_feature complement(2419839..2419856) FT /note="match to EST BE514703 (NID:g9721917)" FT misc_feature complement(2419127..2419841) FT /note="match to EST BG822871 (NID:g14170458)" FT misc_feature complement(2419802..2419809) FT /note="match to EST BI768671 (NID:g15760249)" FT misc_feature complement(2418867..2419644) FT /note="match to EST BI768671 (NID:g15760249)" FT misc_feature complement(2419206..2419618) FT /note="match to EST AA078727 (NID:g1617636) zm21a03.r1" FT misc_feature complement(2419384..2419618) FT /note="match to EST BF770708 (NID:g12118608)" FT misc_feature complement(2419542) FT /note="match to EST BF335978 (NID:g11306726)" FT misc_feature complement(2419140..2419433) FT /note="match to EST BF335978 (NID:g11306726)" FT misc_feature complement(2419133..2419390) FT /note="match to EST AL134320 (NID:g6602507)" FT misc_feature complement(2419029..2419154) FT /note="match to EST BG281034 (NID:g13029958)" FT misc_feature complement(2419029..2419153) FT /note="match to EST BG112358 (NID:g12605864)" FT misc_feature complement(2419029..2419152) FT /note="match to EST BE150868 (NID:g8613589)" FT misc_feature complement(2419027..2419146) FT /note="match to EST AW516174 (NID:g7154256) xt62a10.x1" FT /note="match to EST BE077404 (NID:g8428185)" FT misc_feature complement(2419043..2419146) FT /note="match to EST AI420704 (NID:g4266635) tf18g06.x1" FT misc_feature complement(2419076..2419146) FT /note="match to EST BG481207 (NID:g13413486)" FT misc_feature complement(2419060..2419146) FT /note="match to EST BF813415 (NID:g12144362)" FT misc_feature complement(2419050..2419146) FT /note="match to EST AW377443 (NID:g6882106)" FT /note="match to EST AW390660 (NID:g6895319)" FT misc_feature complement(2419029..2419146) FT /note="similar to EST BM556498 (NID:g18797788)" FT /note="match to EST BG682350 (NID:g13913747)" FT /note="match to EST BG679127 (NID:g13910524)" FT /note="match to EST BG682007 (NID:g13913404)" FT /note="match to EST BI227087 (NID:g14680531)" FT /note="match to EST BG468160 (NID:g13400430)" FT /note="match to EST BE797023 (NID:g10218221)" FT /note="match to EST BE514703 (NID:g9721917)" FT /note="similar to Homo sapiens EST BE791506 FT (NID:g10212704)" FT /note="match to EST BG767676 (NID:g14078329)" FT /note="similar to EST BM715334 (NID:g19028592)" FT /note="match to EST BF971955 (NID:g12339170)" FT /note="match to EST BE018042 (NID:g8277986) bb73d03.y1" FT /note="match to EST BI859192 (NID:g15999939)" FT /note="match to EST H30172 (NID:g901082) yo58g12.r1" FT /note="match to EST BI159903 (NID:g14619904)" FT /note="match to EST BE786131 (NID:g10207329)" FT /note="match to EST BG116314 (NID:g12609820)" FT /note="match to EST BF316431 (NID:g11264788)" FT /note="similar to Mus musculus EST BI653326 FT (NID:g15567562)" FT /note="match to EST BE733424 (NID:g10147416)" FT /note="match to EST BE900418 (NID:g10388561)" FT /note="match to EST AW247372 (NID:g6590365)" FT /note="match to EST BF802902 (NID:g12131891)" FT /note="match to EST BG253176 (NID:g12762992)" FT /note="match to EST BE698773 (NID:g10085933)" FT /note="match to EST BE150857 (NID:g8613578)" FT /note="similar to EST BM232572 (NID:g17867842)" FT /note="match to EST BF733778 (NID:g12059014)" FT /note="match to EST AL581202 (NID:g12947967)" FT /note="match to EST BE293405 (NID:g9176576)" FT /note="similar to Homo sapiens EST BI085798 FT (NID:g14504128)" FT /note="match to EST AL555876 (NID:g12898024)" FT /note="match to EST AI888128 (NID:g5593292) wm52d03.x1" FT misc_feature complement(2419029..2419145) FT /note="similar to Rattus sp. EST H34186 (NID:g979603)" FT misc_feature complement(2419029..2419142) FT /note="similar to EST BM480181 (NID:g18529223)" FT misc_feature complement(2419029..2419141) FT /note="similar to Ictalurus punctatus EST BM027846 FT (NID:g16740702)" FT misc_feature complement(2419029..2419122) FT /note="match to EST BI061009 (NID:g14468536)" FT misc_feature complement(2419029..2419116) FT /note="similar to Gallus gallus EST AJ398525 FT (NID:g7132568)" FT misc_feature complement(2419029..2419114) FT /note="match to EST BE908155 (NID:g10402447)" FT misc_feature complement(2419029..2419111) FT /note="match to EST AA385526 (NID:g2037909)" FT misc_feature complement(2419029..2419081) FT /note="similar to Xenopus laevis EST BF614864 FT (NID:g11787902) df97c03.y1" FT misc_feature complement(2419029..2419062) FT /note="match to EST BF154681 (NID:g11049864)" FT misc_feature complement(2419029..2419057) FT /note="match to EST AW006622 (NID:g5855400) wt06a10.x1" FT misc_feature complement(2419029..2419055) FT /note="match to EST BF813436 (NID:g12144433)" FT misc_feature complement(2419029..2419030) FT /note="match to EST BG822871 (NID:g14170458)" FT misc_feature complement(2419001) FT /note="match to EST AA069854 (NID:g1577214) zm15f10.r1" FT misc_feature complement(2418769..2418882) FT /note="similar to Homo sapiens EST BE794862 FT (NID:g10216060)" FT /note="match to EST BF734424 (NID:g12059661)" FT misc_feature complement(2418796..2418877) FT /note="similar to Homo sapiens EST BE791506 FT (NID:g10212704)" FT misc_feature complement(2418764..2418877) FT /note="similar to Mus musculus EST BI653326 FT (NID:g15567562)" FT misc_feature complement(2418800..2418877) FT /note="match to EST BE733424 (NID:g10147416)" FT /note="match to EST BE900418 (NID:g10388561)" FT misc_feature complement(2418798..2418877) FT /note="match to EST AW247372 (NID:g6590365)" FT misc_feature complement(2418776..2418877) FT /note="match to EST BI061009 (NID:g14468536)" FT misc_feature complement(2418767..2418877) FT /note="match to EST BF733778 (NID:g12059014)" FT misc_feature complement(2418757..2418877) FT /note="match to EST BE293405 (NID:g9176576)" FT misc_feature complement(2418769..2418877) FT /note="similar to EST BM480181 (NID:g18529223)" FT /note="match to EST BG281034 (NID:g13029958)" FT /note="match to EST BI160391 (NID:g14620405)" FT /note="similar to Ictalurus punctatus EST BM027846 FT (NID:g16740702)" FT /note="similar to EST BM556498 (NID:g18797788)" FT /note="match to EST BE908155 (NID:g10402447)" FT /note="match to EST BG682350 (NID:g13913747)" FT /note="match to EST BG679127 (NID:g13910524)" FT /note="match to EST BG112358 (NID:g12605864)" FT /note="similar to Xenopus laevis EST BF614864 FT (NID:g11787902) df97c03.y1" FT /note="match to EST BG682007 (NID:g13913404)" FT /note="match to EST BI227087 (NID:g14680531)" FT /note="match to EST BG468160 (NID:g13400430)" FT /note="similar to Gallus gallus EST AJ398525 FT (NID:g7132568)" FT /note="match to EST BE797023 (NID:g10218221)" FT /note="match to EST BE514703 (NID:g9721917)" FT /note="match to EST BG767676 (NID:g14078329)" FT /note="similar to Rattus sp. EST H34186 (NID:g979603)" FT /note="similar to EST BM715334 (NID:g19028592)" FT /note="match to EST BF971955 (NID:g12339170)" FT /note="match to EST BE018042 (NID:g8277986) bb73d03.y1" FT /note="match to EST H30172 (NID:g901082) yo58g12.r1" FT /note="match to EST BI159903 (NID:g14619904)" FT /note="match to EST BE786131 (NID:g10207329)" FT /note="match to EST BF316431 (NID:g11264788)" FT /note="match to EST BF154681 (NID:g11049864)" FT /note="match to EST BE698773 (NID:g10085933)" FT /note="match to EST BE150868 (NID:g8613589)" FT /note="match to EST BE150857 (NID:g8613578)" FT /note="match to EST AW006622 (NID:g5855400) wt06a10.x1" FT /note="similar to EST BM232572 (NID:g17867842)" FT /note="match to EST AL581202 (NID:g12947967)" FT /note="similar to Homo sapiens EST BI085798 FT (NID:g14504128)" FT /note="match to EST AL555876 (NID:g12898024)" FT /note="match to EST BG253176 (NID:g12762992)" FT /note="match to EST BI859192 (NID:g15999939)" FT /note="match to EST BF813436 (NID:g12144433)" FT /note="match to EST BF802902 (NID:g12131891)" FT /note="match to EST AA385526 (NID:g2037909)" FT /note="match to EST BG116314 (NID:g12609820)" FT misc_feature complement(2418811..2418877) FT /note="match to EST AI888128 (NID:g5593292) wm52d03.x1" FT misc_feature complement(2418769..2418871) FT /note="similar to Homo sapiens EST BF350309 FT (NID:g11309383)" FT misc_feature complement(2418769..2418844) FT /note="match to EST D59393 (NID:g960499)" FT /note="match to EST BF088399 (NID:g10894109)" FT misc_feature complement(2418769..2418834) FT /note="match to EST AA297061 (NID:g1949394)" FT misc_feature complement(2418769..2418827) FT /note="match to EST BE719551 (NID:g10107816)" FT misc_feature complement(2418769..2418812) FT /note="match to EST AA069854 (NID:g1577214) zm15f10.r1" FT misc_feature complement(2418324..2418402) FT /note="similar to Mus musculus EST BI456584 FT (NID:g15247240)" FT /note="match to EST AA053598 (NID:g1544525) zl73d03.r1" FT misc_feature complement(2418374..2418401) FT /note="match to EST BF316431 (NID:g11264788)" FT misc_feature complement(2418362..2418401) FT /note="match to EST BE786131 (NID:g10207329)" FT misc_feature complement(2418334..2418401) FT /note="match to EST H30172 (NID:g901082) yo58g12.r1" FT misc_feature complement(2418357..2418401) FT /note="match to EST BI159903 (NID:g14619904)" FT misc_feature complement(2418345..2418401) FT /note="similar to Ictalurus punctatus EST BM027846 FT (NID:g16740702)" FT misc_feature complement(2418381..2418401) FT /note="match to EST AA385526 (NID:g2037909)" FT misc_feature complement(2418317..2418401) FT /note="match to EST BF154681 (NID:g11049864)" FT misc_feature complement(2418369..2418401) FT /note="match to EST BG116314 (NID:g12609820)" FT /note="match to EST BG253176 (NID:g12762992)" FT misc_feature complement(2418320..2418401) FT /note="match to EST BE698773 (NID:g10085933)" FT misc_feature complement(2418359..2418401) FT /note="similar to EST BM232572 (NID:g17867842)" FT misc_feature complement(2418324..2418401) FT /note="similar to EST BM480181 (NID:g18529223)" FT /note="match to EST BG281034 (NID:g13029958)" FT /note="match to EST BI160391 (NID:g14620405)" FT /note="similar to EST BM556498 (NID:g18797788)" FT /note="match to EST BE908155 (NID:g10402447)" FT /note="match to EST BE719551 (NID:g10107816)" FT /note="match to EST BG682350 (NID:g13913747)" FT /note="match to EST BG679127 (NID:g13910524)" FT /note="similar to Homo sapiens EST BE719496 FT (NID:g10107761)" FT /note="match to EST AA069854 (NID:g1577214) zm15f10.r1" FT /note="match to EST BG112358 (NID:g12605864)" FT /note="similar to Xenopus laevis EST BF614864 FT (NID:g11787902) df97c03.y1" FT /note="match to EST BG682007 (NID:g13913404)" FT /note="match to EST BI227087 (NID:g14680531)" FT /note="match to EST BG468160 (NID:g13400430)" FT /note="similar to Homo sapiens EST BE794862 FT (NID:g10216060)" FT /note="match to EST AA297061 (NID:g1949394)" FT /note="similar to Homo sapiens EST BG255404 FT (NID:g12765310)" FT /note="similar to Gallus gallus EST AJ398525 FT (NID:g7132568)" FT /note="match to EST BE797023 (NID:g10218221)" FT /note="match to EST BE514703 (NID:g9721917)" FT /note="match to EST BG767676 (NID:g14078329)" FT /note="match to EST D59393 (NID:g960499)" FT /note="similar to Rattus sp. EST H34186 (NID:g979603)" FT /note="similar to EST BM715334 (NID:g19028592)" FT /note="match to EST BF971955 (NID:g12339170)" FT /note="match to EST BE018042 (NID:g8277986) bb73d03.y1" FT /note="match to EST BI859192 (NID:g15999939)" FT /note="match to EST BF088399 (NID:g10894109)" FT /note="similar to Homo sapiens EST BF350309 FT (NID:g11309383)" FT /note="match to EST BF734424 (NID:g12059661)" FT /note="match to EST BF813436 (NID:g12144433)" FT /note="match to EST BF802902 (NID:g12131891)" FT /note="match to EST BE150868 (NID:g8613589)" FT /note="match to EST BE150857 (NID:g8613578)" FT /note="match to EST AL581202 (NID:g12947967)" FT /note="similar to Homo sapiens EST BI085798 FT (NID:g14504128)" FT /note="match to EST AL555876 (NID:g12898024)" FT misc_feature complement(2418375..2418401) FT /note="match to EST AW006622 (NID:g5855400) wt06a10.x1" FT misc_feature complement(2418324..2418399) FT /note="match to EST BE743505 (NID:g10157497)" FT misc_feature complement(2418324..2418394) FT /note="match to EST BE293405 (NID:g9176576)" FT misc_feature complement(2418324..2418391) FT /note="similar to EST BM550181 (NID:g18786168)" FT misc_feature complement(2418324..2418384) FT /note="match to EST BE719494 (NID:g10107759)" FT misc_feature complement(2418324..2418376) FT /note="similar to Homo sapiens EST BE791506 FT (NID:g10212704)" FT misc_feature complement(2418336) FT /note="match to EST BI159903 (NID:g14619904)" FT misc_feature complement(2417386..2417686) FT /note="match to EST AA078276 (NID:g1837750)" FT misc_feature complement(2417204..2417431) FT /note="match to EST AA077993 (NID:g1837467)" FT misc_feature complement(2416808..2417231) FT /note="match to EST BF927196 (NID:g12325245)" FT misc_feature complement(2417102..2417140) FT /note="match to EST AA077993 (NID:g1837467)" FT misc_feature complement(2416972..2416973) FT /note="match to EST BF962361 (NID:g12379636)" FT misc_feature complement(2416185..2416786) FT /note="match to EST BI915674 (NID:g16199340)" FT misc_feature complement(2416585..2416732) FT /note="similar to Ictalurus punctatus EST BM027846 FT (NID:g16740702)" FT misc_feature complement(2416528..2416726) FT /note="match to EST BE715160 (NID:g10103425)" FT misc_feature complement(2416589..2416710) FT /note="match to EST D59393 (NID:g960499)" FT misc_feature complement(2416600..2416710) FT /note="similar to Rattus sp. EST H34186 (NID:g979603)" FT misc_feature complement(2416634..2416710) FT /note="similar to EST BM715334 (NID:g19028592)" FT misc_feature complement(2416661..2416710) FT /note="match to EST BF971955 (NID:g12339170)" FT misc_feature complement(2416668..2416710) FT /note="match to EST BE018042 (NID:g8277986) bb73d03.y1" FT misc_feature complement(2416674..2416710) FT /note="match to EST BI859192 (NID:g15999939)" FT misc_feature complement(2416672..2416710) FT /note="match to EST BF813436 (NID:g12144433)" FT misc_feature complement(2416639..2416710) FT /note="match to EST BF802902 (NID:g12131891)" FT misc_feature complement(2416579..2416710) FT /note="similar to Homo sapiens EST BF350309 FT (NID:g11309383)" FT /note="match to EST BE150857 (NID:g8613578)" FT misc_feature complement(2416669..2416710) FT /note="similar to Homo sapiens EST BI085798 FT (NID:g14504128)" FT misc_feature complement(2416585..2416710) FT /note="similar to EST BM550181 (NID:g18786168)" FT /note="similar to EST BM480181 (NID:g18529223)" FT /note="match to EST BE743505 (NID:g10157497)" FT /note="match to EST BG281034 (NID:g13029958)" FT /note="match to EST BI160391 (NID:g14620405)" FT /note="similar to Mus musculus EST BI456584 FT (NID:g15247240)" FT /note="similar to EST BM556498 (NID:g18797788)" FT /note="match to EST BE908155 (NID:g10402447)" FT /note="match to EST BE719551 (NID:g10107816)" FT /note="match to EST BG682350 (NID:g13913747)" FT /note="match to EST BE719494 (NID:g10107759)" FT /note="match to EST AA133729 (NID:g1690896) zo40e12.r1" FT /note="match to EST BG679127 (NID:g13910524)" FT /note="similar to Homo sapiens EST BE719496 FT (NID:g10107761)" FT /note="match to EST AA069854 (NID:g1577214) zm15f10.r1" FT /note="match to EST BG112358 (NID:g12605864)" FT /note="similar to Xenopus laevis EST BF614864 FT (NID:g11787902) df97c03.y1" FT /note="match to EST BG682007 (NID:g13913404)" FT /note="match to EST BI227087 (NID:g14680531)" FT /note="match to EST BG468160 (NID:g13400430)" FT /note="similar to Homo sapiens EST BE794862 FT (NID:g10216060)" FT /note="match to EST AA053598 (NID:g1544525) zl73d03.r1" FT /note="match to EST AA297061 (NID:g1949394)" FT /note="similar to Homo sapiens EST BG255404 FT (NID:g12765310)" FT /note="similar to Gallus gallus EST AJ398525 FT (NID:g7132568)" FT /note="match to EST BE797023 (NID:g10218221)" FT /note="match to EST BE514703 (NID:g9721917)" FT /note="similar to Homo sapiens EST BE791506 FT (NID:g10212704)" FT /note="match to EST BG767676 (NID:g14078329)" FT /note="similar to Homo sapiens EST BI061473 FT (NID:g14469000)" FT /note="match to EST BF088399 (NID:g10894109)" FT /note="match to EST BF734424 (NID:g12059661)" FT /note="match to EST BE150868 (NID:g8613589)" FT /note="match to EST AL581202 (NID:g12947967)" FT /note="match to EST AL555876 (NID:g12898024)" FT misc_feature complement(2416585..2416708) FT /note="match to EST BG034607 (NID:g12428096)" FT misc_feature complement(2416585..2416692) FT /note="match to EST AU138091 (NID:g10999612)" FT misc_feature complement(2416585..2416687) FT /note="similar to Mus musculus EST BI408959 FT (NID:g15169882)" FT misc_feature complement(2416585..2416677) FT /note="match to EST AA488488 (NID:g2215919) ab39a11.r1" FT misc_feature complement(2416585..2416647) FT /note="match to EST BG036475 (NID:g12431678)" FT misc_feature complement(2416585..2416616) FT /note="match to EST AU124308 (NID:g10949024)" FT misc_feature complement(2415922..2416331) FT /note="match to EST AA126089 (NID:g1685763) zl85c02.r1" FT misc_feature complement(2416246..2416251) FT /note="match to EST C02897 (NID:g1466148)" FT repeat_region complement(2415848..2415983) FT /rpt_family="Alu" FT misc_feature complement(2415389..2415970) FT /note="match to EST AA628539 (NID:g2540926) af27h06.s1" FT misc_feature complement(2415689..2415967) FT /note="match to EST AI735064 (NID:g5056663) as88c02.x1" FT misc_feature complement(2415721..2415925) FT /note="match to EST BF798259 (NID:g12127248)" FT misc_feature complement(2415252..2415876) FT /note="similar to EST BM701972 (NID:g19015230)" FT misc_feature complement(2415385..2415387) FT /note="similar to Homo sapiens EST BF375300 FT (NID:g11337325)" FT misc_feature complement(2415080..2415255) FT /note="match to EST AA078210 (NID:g1837684)" FT misc_feature complement(2415024..2415172) FT /note="match to EST AA852936 (NID:g2939675)" FT misc_feature complement(2415024..2415170) FT /note="match to EST BG327541 (NID:g13133979)" FT misc_feature complement(2415024..2415169) FT /note="match to EST BG167893 (NID:g12674596)" FT misc_feature complement(2415024..2415167) FT /note="match to EST BE397388 (NID:g9342753)" FT misc_feature complement(2415024..2415166) FT /note="similar to EST BM455055 (NID:g18504095)" FT misc_feature complement(2415024..2415165) FT /note="similar to Mus musculus EST BI415697 FT (NID:g15176620)" FT /note="similar to EST AL657773 (NID:g17670686)" FT misc_feature complement(2415024..2415163) FT /note="similar to EST BM556261 (NID:g18797379)" FT misc_feature complement(2415016..2415162) FT /note="match to EST AA053598 (NID:g1544525) zl73d03.r1" FT /note="match to EST AA297061 (NID:g1949394)" FT misc_feature complement(2415022..2415162) FT /note="similar to Mus musculus EST BI408959 FT (NID:g15169882)" FT misc_feature complement(2415041..2415162) FT /note="similar to Homo sapiens EST BG255404 FT (NID:g12765310)" FT misc_feature complement(2415109..2415162) FT /note="similar to Gallus gallus EST AJ398525 FT (NID:g7132568)" FT misc_feature complement(2415117..2415162) FT /note="match to EST BE797023 (NID:g10218221)" FT misc_feature complement(2415118..2415162) FT /note="match to EST BE514703 (NID:g9721917)" FT misc_feature complement(2415119..2415162) FT /note="similar to Homo sapiens EST BE791506 FT (NID:g10212704)" FT misc_feature complement(2415122..2415162) FT /note="match to EST BG767676 (NID:g14078329)" FT misc_feature complement(2415067..2415162) FT /note="match to EST BF088399 (NID:g10894109)" FT misc_feature complement(2415024..2415162) FT /note="match to EST AU124308 (NID:g10949024)" FT /note="similar to EST BM550181 (NID:g18786168)" FT /note="match to EST AU138091 (NID:g10999612)" FT /note="match to EST BG036475 (NID:g12431678)" FT /note="similar to EST BM480181 (NID:g18529223)" FT /note="match to EST BG034607 (NID:g12428096)" FT /note="match to EST BE743505 (NID:g10157497)" FT /note="match to EST BG281034 (NID:g13029958)" FT /note="match to EST AA488488 (NID:g2215919) ab39a11.r1" FT /note="match to EST BI160391 (NID:g14620405)" FT /note="similar to Homo sapiens EST BF375300 FT (NID:g11337325)" FT /note="similar to Ictalurus punctatus EST BM027846 FT (NID:g16740702)" FT /note="similar to Mus musculus EST BI456584 FT (NID:g15247240)" FT /note="similar to EST BM556498 (NID:g18797788)" FT /note="match to EST BE908155 (NID:g10402447)" FT /note="match to EST BE719551 (NID:g10107816)" FT /note="match to EST BG682350 (NID:g13913747)" FT /note="match to EST BE719494 (NID:g10107759)" FT /note="match to EST AA133729 (NID:g1690896) zo40e12.r1" FT /note="match to EST BG679127 (NID:g13910524)" FT /note="similar to Homo sapiens EST BE719496 FT (NID:g10107761)" FT /note="match to EST AA069854 (NID:g1577214) zm15f10.r1" FT /note="match to EST BG112358 (NID:g12605864)" FT /note="similar to Xenopus laevis EST BF614864 FT (NID:g11787902) df97c03.y1" FT /note="match to EST BG682007 (NID:g13913404)" FT /note="match to EST BI227087 (NID:g14680531)" FT /note="match to EST BG468160 (NID:g13400430)" FT /note="similar to Homo sapiens EST BE794862 FT (NID:g10216060)" FT /note="similar to Homo sapiens EST BI061473 FT (NID:g14469000)" FT /note="match to EST BF734424 (NID:g12059661)" FT misc_feature complement(2415129..2415162) FT /note="match to EST BE150868 (NID:g8613589)" FT misc_feature complement(2415037..2415162) FT /note="match to EST AL581202 (NID:g12947967)" FT misc_feature complement(2415124..2415162) FT /note="match to EST AL555876 (NID:g12898024)" FT misc_feature complement(2415024..2415156) FT /note="similar to Xenopus laevis EST BE506003 FT (NID:g9709534) dc18b02.y1" FT misc_feature complement(2415024..2415137) FT /note="similar to EST BM696975 (NID:g19010233)" FT misc_feature complement(2415024..2415115) FT /note="match to EST AI336324 (NID:g4073251) qt43e09.x1" FT misc_feature complement(2415024..2415109) FT /note="similar to Xenopus laevis EST BE508819 FT (NID:g9728594) dc13e04.y1" FT misc_feature complement(2415024..2415106) FT /note="match to EST BI046881 (NID:g14453503)" FT misc_feature complement(2415024..2415094) FT /note="match to EST BI046442 (NID:g14453051)" FT misc_feature complement(2415024..2415053) FT /note="match to EST BE002602 (NID:g8262835)" FT misc_feature complement(2415024..2415052) FT /note="match to EST AW368037 (NID:g6872791)" FT misc_feature complement(2414745..2415040) FT /note="match to EST BF770240 (NID:g12118140)" FT misc_feature complement(2415024..2415035) FT /note="match to EST BF804972 (NID:g12133961)" FT misc_feature complement(2413797..2414277) FT /note="match to EST BF962361 (NID:g12379636)" FT misc_feature complement(2414159..2414241) FT /note="match to EST BG112358 (NID:g12605864)" FT misc_feature complement(2414165..2414241) FT /note="similar to Xenopus laevis EST BF614864 FT (NID:g11787902) df97c03.y1" FT misc_feature complement(2414167..2414241) FT /note="match to EST BG682007 (NID:g13913404)" FT misc_feature complement(2414177..2414241) FT /note="similar to Homo sapiens EST BE719496 FT (NID:g10107761)" FT /note="match to EST BI227087 (NID:g14680531)" FT misc_feature complement(2414182..2414241) FT /note="match to EST BG468160 (NID:g13400430)" FT misc_feature complement(2414186..2414241) FT /note="similar to Homo sapiens EST BE794862 FT (NID:g10216060)" FT misc_feature complement(2414163..2414241) FT /note="similar to EST BM455055 (NID:g18504095)" FT /note="match to EST BG677679 (NID:g13909076)" FT /note="match to EST AU124308 (NID:g10949024)" FT /note="match to EST BG327541 (NID:g13133979)" FT /note="similar to EST BM550181 (NID:g18786168)" FT /note="match to EST BE397388 (NID:g9342753)" FT /note="similar to Mus musculus EST BI415697 FT (NID:g15176620)" FT /note="match to EST AU138091 (NID:g10999612)" FT /note="match to EST BG036475 (NID:g12431678)" FT /note="match to EST BG167893 (NID:g12674596)" FT /note="similar to EST BM556261 (NID:g18797379)" FT /note="similar to EST BM480181 (NID:g18529223)" FT /note="similar to EST BM696975 (NID:g19010233)" FT /note="match to EST BG034607 (NID:g12428096)" FT /note="similar to EST AL657773 (NID:g17670686)" FT /note="similar to Xenopus laevis EST BE508819 FT (NID:g9728594) dc13e04.y1" FT /note="similar to Xenopus laevis EST BE506003 FT (NID:g9709534) dc18b02.y1" FT /note="match to EST BE743505 (NID:g10157497)" FT /note="match to EST AW368037 (NID:g6872791)" FT /note="match to EST BG281034 (NID:g13029958)" FT /note="similar to Mus musculus EST AA939924 (NID:g3099468) FT vq64c06.s1" FT /note="match to EST AA488488 (NID:g2215919) ab39a11.r1" FT /note="match to EST BI160391 (NID:g14620405)" FT /note="similar to Homo sapiens EST BF375300 FT (NID:g11337325)" FT /note="similar to Ictalurus punctatus EST BM027846 FT (NID:g16740702)" FT /note="similar to Mus musculus EST BI456584 FT (NID:g15247240)" FT /note="similar to EST BM556498 (NID:g18797788)" FT /note="match to EST BE908155 (NID:g10402447)" FT /note="match to EST BF804972 (NID:g12133961)" FT /note="match to EST BE002602 (NID:g8262835)" FT /note="match to EST BE719551 (NID:g10107816)" FT /note="match to EST BG682350 (NID:g13913747)" FT /note="match to EST BE719494 (NID:g10107759)" FT /note="match to EST AA133729 (NID:g1690896) zo40e12.r1" FT /note="match to EST BG679127 (NID:g13910524)" FT /note="match to EST AA069854 (NID:g1577214) zm15f10.r1" FT /note="match to EST BE763471 (NID:g10193395)" FT /note="match to EST BI046442 (NID:g14453051)" FT /note="match to EST BI046881 (NID:g14453503)" FT /note="match to EST AA852936 (NID:g2939675)" FT misc_feature complement(2414218..2414241) FT /note="similar to Homo sapiens EST BI061473 FT (NID:g14469000)" FT misc_feature complement(2414211..2414241) FT /note="match to EST BF734424 (NID:g12059661)" FT misc_feature complement(2414195..2414241) FT /note="match to EST AI336324 (NID:g4073251) qt43e09.x1" FT misc_feature complement(2414163..2414240) FT /note="match to EST BG104253 (NID:g12598095)" FT misc_feature complement(2414163..2414218) FT /note="match to EST AU134271 (NID:g10994810)" FT misc_feature complement(2414163..2414198) FT /note="match to EST AI907183 (NID:g6497510)" FT misc_feature complement(2414048..2414049) FT /note="match to EST AA069854 (NID:g1577214) zm15f10.r1" FT misc_feature complement(2414001) FT /note="match to EST BI227087 (NID:g14680531)" FT misc_feature complement(2413438..2413439) FT /note="match to EST AW382612 (NID:g6887271)" FT misc_feature complement(2412308..2412437) FT /note="similar to Silurana tropicalis EST AL595405 FT (NID:g15007480)" FT /note="similar to Xenopus laevis EST BE025557 FT (NID:g8318976) db25h05.y1" FT misc_feature complement(2412308..2412431) FT /note="match to EST BE410262 (NID:g9346712)" FT misc_feature complement(2412392..2412430) FT /note="match to EST AU134271 (NID:g10994810)" FT misc_feature complement(2412314..2412430) FT /note="match to EST BE002602 (NID:g8262835)" FT misc_feature complement(2412333..2412430) FT /note="match to EST BE719551 (NID:g10107816)" FT misc_feature complement(2412338..2412430) FT /note="match to EST BG682350 (NID:g13913747)" FT misc_feature complement(2412368..2412430) FT /note="match to EST BE719494 (NID:g10107759)" FT misc_feature complement(2412375..2412430) FT /note="match to EST AA133729 (NID:g1690896) zo40e12.r1" FT misc_feature complement(2412387..2412430) FT /note="match to EST BG679127 (NID:g13910524)" FT misc_feature complement(2412308..2412430) FT /note="similar to EST BM455055 (NID:g18504095)" FT /note="match to EST BG677679 (NID:g13909076)" FT /note="match to EST BG104253 (NID:g12598095)" FT /note="match to EST AU124308 (NID:g10949024)" FT /note="match to EST BG327541 (NID:g13133979)" FT /note="similar to EST BM550181 (NID:g18786168)" FT /note="match to EST BE397388 (NID:g9342753)" FT /note="similar to Mus musculus EST BI415697 FT (NID:g15176620)" FT /note="match to EST AU138091 (NID:g10999612)" FT /note="match to EST BG036475 (NID:g12431678)" FT /note="match to EST BG167893 (NID:g12674596)" FT /note="similar to EST BM556261 (NID:g18797379)" FT /note="similar to EST BM480181 (NID:g18529223)" FT /note="similar to EST BM696975 (NID:g19010233)" FT /note="match to EST BG034607 (NID:g12428096)" FT /note="similar to EST AL657773 (NID:g17670686)" FT /note="similar to Xenopus laevis EST BE508819 FT (NID:g9728594) dc13e04.y1" FT /note="similar to Xenopus laevis EST BE506003 FT (NID:g9709534) dc18b02.y1" FT /note="match to EST BE743505 (NID:g10157497)" FT /note="match to EST AI907183 (NID:g6497510)" FT /note="match to EST AW368037 (NID:g6872791)" FT /note="match to EST BG281034 (NID:g13029958)" FT /note="similar to Mus musculus EST AA939924 (NID:g3099468) FT vq64c06.s1" FT /note="match to EST AA488488 (NID:g2215919) ab39a11.r1" FT /note="match to EST BI160391 (NID:g14620405)" FT /note="similar to Homo sapiens EST BF375300 FT (NID:g11337325)" FT /note="similar to Ictalurus punctatus EST BM027846 FT (NID:g16740702)" FT /note="similar to Mus musculus EST BI456584 FT (NID:g15247240)" FT /note="similar to EST BM556498 (NID:g18797788)" FT /note="match to EST BE908155 (NID:g10402447)" FT /note="match to EST BF804972 (NID:g12133961)" FT /note="match to EST BE763471 (NID:g10193395)" FT /note="match to EST BI046442 (NID:g14453051)" FT /note="match to EST BI046881 (NID:g14453503)" FT misc_feature complement(2412366..2412430) FT /note="match to EST AA852936 (NID:g2939675)" FT misc_feature complement(2412320..2412428) FT /note="similar to Danio rerio EST AI496690 (NID:g4397693) FT fb48f04.y1" FT misc_feature complement(2412308..2412428) FT /note="match to EST BE706544 (NID:g10094809)" FT /note="similar to Homo sapiens EST BE153305 (NID:g8616026)" FT misc_feature complement(2412320..2412425) FT /note="similar to Danio rerio EST BI533157 (NID:g15373724) FT fq97c09.y3" FT misc_feature complement(2412308..2412423) FT /note="match to EST AW382612 (NID:g6887271)" FT misc_feature complement(2412308..2412422) FT /note="match to EST BG576318 (NID:g13583971)" FT misc_feature complement(2412308..2412404) FT /note="match to EST BE514079 (NID:g9721291)" FT misc_feature complement(2412308..2412399) FT /note="match to EST C02897 (NID:g1466148)" FT misc_feature complement(2412308..2412397) FT /note="match to EST BI046201 (NID:g14452823)" FT misc_feature complement(2412308..2412359) FT /note="match to EST AA602235 (NID:g2436213) np05d04.s1" FT misc_feature complement(2412308..2412331) FT /note="match to EST AA382480 (NID:g2035041)" FT misc_feature complement(2411809..2412208) FT /note="match to EST AW936364 (NID:g8111770)" FT repeat_region complement(2411641..2411858) FT /rpt_family="Alu" FT misc_feature complement(2411410..2411847) FT /note="match to EST AI699772 (NID:g4987672) tz12e01.x1" FT misc_feature complement(2411451..2411833) FT /note="match to EST T86402 (NID:g714754) yd77d05.r1" FT misc_feature complement(2411412..2411691) FT /note="match to EST BG950711 (NID:g14368882)" FT misc_feature complement(2411471..2411598) FT /note="similar to Homo sapiens EST BG951854 FT (NID:g14370025)" FT misc_feature complement(2411412..2411499) FT /note="similar to Danio rerio EST BI533157 (NID:g15373724) FT fq97c09.y3" FT /note="similar to Danio rerio EST AI496690 (NID:g4397693) FT fb48f04.y1" FT misc_feature complement(2411412..2411488) FT /note="match to EST BG327541 (NID:g13133979)" FT /note="match to EST BG576318 (NID:g13583971)" FT /note="similar to EST BM455055 (NID:g18504095)" FT /note="match to EST BG677679 (NID:g13909076)" FT /note="match to EST BG104253 (NID:g12598095)" FT /note="match to EST BE410262 (NID:g9346712)" FT /note="match to EST AU124308 (NID:g10949024)" FT /note="similar to EST BM550181 (NID:g18786168)" FT /note="match to EST BE397388 (NID:g9342753)" FT /note="similar to Mus musculus EST BI415697 FT (NID:g15176620)" FT /note="similar to Silurana tropicalis EST AL595405 FT (NID:g15007480)" FT /note="match to EST BE514079 (NID:g9721291)" FT /note="match to EST AU138091 (NID:g10999612)" FT /note="match to EST BG036475 (NID:g12431678)" FT /note="match to EST BG167893 (NID:g12674596)" FT /note="similar to Xenopus laevis EST BE025557 FT (NID:g8318976) db25h05.y1" FT /note="similar to EST BM556261 (NID:g18797379)" FT /note="similar to EST BM480181 (NID:g18529223)" FT /note="similar to EST BM696975 (NID:g19010233)" FT /note="match to EST BG034607 (NID:g12428096)" FT /note="similar to EST AL657773 (NID:g17670686)" FT /note="similar to Xenopus laevis EST BE508819 FT (NID:g9728594) dc13e04.y1" FT /note="similar to Xenopus laevis EST BE506003 FT (NID:g9709534) dc18b02.y1" FT /note="match to EST C02897 (NID:g1466148)" FT /note="match to EST BE743505 (NID:g10157497)" FT /note="match to EST AI907183 (NID:g6497510)" FT /note="match to EST AW368037 (NID:g6872791)" FT /note="match to EST BG281034 (NID:g13029958)" FT /note="match to EST BE706544 (NID:g10094809)" FT /note="match to EST BI160391 (NID:g14620405)" FT /note="match to EST BI046201 (NID:g14452823)" FT /note="match to EST AW382612 (NID:g6887271)" FT /note="match to EST AA602235 (NID:g2436213) np05d04.s1" FT /note="match to EST BI046442 (NID:g14453051)" FT /note="match to EST BI046881 (NID:g14453503)" FT misc_feature complement(2411408..2411488) FT /note="similar to Mus musculus EST AA939924 (NID:g3099468) FT vq64c06.s1" FT misc_feature complement(2411406..2411488) FT /note="match to EST AA488488 (NID:g2215919) ab39a11.r1" FT misc_feature complement(2411426..2411488) FT /note="similar to Homo sapiens EST BF375300 FT (NID:g11337325)" FT misc_feature complement(2411424..2411488) FT /note="similar to Ictalurus punctatus EST BM027846 FT (NID:g16740702)" FT misc_feature complement(2411437..2411488) FT /note="similar to Mus musculus EST BI456584 FT (NID:g15247240)" FT /note="similar to EST BM556498 (NID:g18797788)" FT misc_feature complement(2411470..2411488) FT /note="match to EST BE908155 (NID:g10402447)" FT misc_feature complement(2411458..2411488) FT /note="match to EST BF804972 (NID:g12133961)" FT misc_feature complement(2411409..2411488) FT /note="similar to Homo sapiens EST BE153305 (NID:g8616026)" FT /note="match to EST BE763471 (NID:g10193395)" FT misc_feature complement(2411412..2411484) FT /note="match to EST BE902722 (NID:g10393199)" FT misc_feature complement(2411412..2411480) FT /note="match to EST BG741163 (NID:g14051816)" FT misc_feature complement(2411412..2411477) FT /note="match to EST AA580653 (NID:g2358310) nd41a08.r1" FT /note="match to EST BF799442 (NID:g12128431)" FT misc_feature complement(2411412..2411456) FT /note="match to EST BG951836 (NID:g14370007)" FT misc_feature complement(2411412..2411434) FT /note="match to EST BE276703 (NID:g9151666)" FT misc_feature complement(2411396) FT /note="match to EST AI699772 (NID:g4987672) tz12e01.x1" FT misc_feature complement(2410996..2411361) FT /note="match to EST T03191 (NID:g314432)" FT misc_feature complement(2411266) FT /note="match to EST BI160391 (NID:g14620405)" FT repeat_region complement(2410721..2410914) FT /rpt_family="L1" FT misc_feature complement(2410745) FT /note="match to EST BF802902 (NID:g12131891)" FT repeat_region complement(2410429..2410719) FT /rpt_family="Alu" FT repeat_region complement(2410334..2410409) FT /rpt_family="Alu" FT repeat_region complement(2410182..2410305) FT /rpt_family="L1" FT repeat_region complement(2409830..2410129) FT /rpt_family="Alu" FT misc_feature complement(2409842..2409877) FT /note="match to EST AW936364 (NID:g8111770)" FT repeat_region complement(2409757..2409782) FT /rpt_family="AT_rich" FT repeat_region complement(2409401..2409711) FT /rpt_family="Alu" FT misc_feature complement(2409389) FT /note="match to EST AU142395 (NID:g11003916)" FT misc_feature complement(2409107..2409321) FT /note="match to EST AU142395 (NID:g11003916)" FT misc_feature complement(2409108..2409317) FT /note="similar to EST AL657773 (NID:g17670686)" FT misc_feature complement(2409123..2409317) FT /note="similar to Xenopus laevis EST BE508819 FT (NID:g9728594) dc13e04.y1" FT misc_feature complement(2409129..2409317) FT /note="similar to Xenopus laevis EST BE506003 FT (NID:g9709534) dc18b02.y1" FT misc_feature complement(2409133..2409317) FT /note="match to EST C02897 (NID:g1466148)" FT misc_feature complement(2409155..2409317) FT /note="match to EST BE743505 (NID:g10157497)" FT misc_feature complement(2409182..2409317) FT /note="match to EST AI907183 (NID:g6497510)" FT misc_feature complement(2409259..2409317) FT /note="match to EST AW368037 (NID:g6872791)" FT misc_feature complement(2409273..2409317) FT /note="match to EST BG281034 (NID:g13029958)" FT misc_feature complement(2408992..2409317) FT /note="match to EST BG951836 (NID:g14370007)" FT misc_feature complement(2409094..2409317) FT /note="match to EST BG950711 (NID:g14368882)" FT misc_feature complement(2409222..2409317) FT /note="match to EST AW382612 (NID:g6887271)" FT misc_feature complement(2409149..2409317) FT /note="match to EST AA602235 (NID:g2436213) np05d04.s1" FT misc_feature complement(2409107..2409317) FT /note="match to EST BG576318 (NID:g13583971)" FT /note="match to EST BE902722 (NID:g10393199)" FT /note="similar to EST BM455055 (NID:g18504095)" FT /note="match to EST BG677679 (NID:g13909076)" FT /note="match to EST BE276703 (NID:g9151666)" FT /note="match to EST BG104253 (NID:g12598095)" FT /note="match to EST BE410262 (NID:g9346712)" FT /note="similar to Danio rerio EST BI533157 (NID:g15373724) FT fq97c09.y3" FT /note="match to EST AU124308 (NID:g10949024)" FT /note="match to EST BG327541 (NID:g13133979)" FT /note="similar to EST BM550181 (NID:g18786168)" FT /note="match to EST BE397388 (NID:g9342753)" FT /note="match to EST AA580653 (NID:g2358310) nd41a08.r1" FT /note="similar to Mus musculus EST BI415697 FT (NID:g15176620)" FT /note="similar to Silurana tropicalis EST AL595405 FT (NID:g15007480)" FT /note="match to EST BE514079 (NID:g9721291)" FT /note="match to EST AU138091 (NID:g10999612)" FT /note="match to EST BG036475 (NID:g12431678)" FT /note="match to EST BG167893 (NID:g12674596)" FT /note="similar to Danio rerio EST AI496690 (NID:g4397693) FT fb48f04.y1" FT /note="similar to Xenopus laevis EST BE025557 FT (NID:g8318976) db25h05.y1" FT /note="similar to EST BM556261 (NID:g18797379)" FT /note="match to EST BG741163 (NID:g14051816)" FT /note="similar to EST BM480181 (NID:g18529223)" FT /note="similar to EST BM696975 (NID:g19010233)" FT /note="match to EST BG034607 (NID:g12428096)" FT /note="match to EST BF799442 (NID:g12128431)" FT /note="match to EST BI046201 (NID:g14452823)" FT /note="match to EST BI046442 (NID:g14453051)" FT /note="match to EST BI046881 (NID:g14453503)" FT misc_feature complement(2409107..2409310) FT /note="match to EST AW402799 (NID:g6921543)" FT misc_feature complement(2409107..2409308) FT /note="match to EST AA362023 (NID:g2014344)" FT misc_feature complement(2409252..2409308) FT /note="match to EST BE706544 (NID:g10094809)" FT misc_feature complement(2409107..2409301) FT /note="match to EST BF663062 (NID:g11936957)" FT misc_feature complement(2409107..2409295) FT /note="similar to Mus musculus EST AA184495 (NID:g1768145) FT mt49h07.r1" FT misc_feature complement(2409107..2409289) FT /note="match to EST BE814572 (NID:g10246806)" FT misc_feature complement(2409133..2409282) FT /note="similar to Homo sapiens EST C03152 (NID:g1466403)" FT misc_feature complement(2409109..2409271) FT /note="similar to Homo sapiens EST BE868764 FT (NID:g10317540)" FT misc_feature complement(2409107..2409204) FT /note="similar to Mus musculus EST BG794964 FT (NID:g14130534)" FT misc_feature complement(2409179) FT /note="match to EST BE706544 (NID:g10094809)" FT misc_feature complement(2408825..2409067) FT /note="match to EST BG951616 (NID:g14369787)" FT misc_feature complement(2408054..2408507) FT /note="match to EST BF771734 (NID:g12119634)" FT misc_feature complement(2408040..2408344) FT /note="similar to Homo sapiens EST BF812060 FT (NID:g12141376)" FT misc_feature complement(2407602..2408088) FT /note="match to EST BG741163 (NID:g14051816)" FT repeat_region complement(2407780..2408084) FT /rpt_family="Alu" FT repeat_region complement(2407465..2407778) FT /rpt_family="Alu" FT repeat_region complement(2407109..2407402) FT /rpt_family="Alu" FT repeat_region complement(2406703..2407067) FT /rpt_family="MaLR" FT misc_feature complement(2407015..2407016) FT /note="match to EST AW408372 (NID:g6927429)" FT misc_feature complement(2406320..2406738) FT /note="match to EST AI677741 (NID:g4887923) wc88b03.x1" FT misc_feature complement(2406118..2406737) FT /note="match to EST AW129967 (NID:g6131572) xf26b06.x1" FT misc_feature complement(2406634..2406736) FT /note="match to EST AA679866 (NID:g2656333) ac83h04.s1" FT misc_feature complement(2406634..2406705) FT /note="similar to EST BM727927 (NID:g19049260)" FT misc_feature complement(2406634..2406692) FT /note="match to EST BG774395 (NID:g14044712)" FT /note="similar to Mus musculus EST AA407744 (NID:g2067282)" FT misc_feature complement(2406634..2406691) FT /note="match to EST BG961170 (NID:g14379341)" FT misc_feature complement(2406641..2406680) FT /note="match to EST AA362023 (NID:g2014344)" FT misc_feature complement(2406649..2406680) FT /note="similar to EST BM556261 (NID:g18797379)" FT misc_feature complement(2406669..2406680) FT /note="match to EST BG034607 (NID:g12428096)" FT misc_feature complement(2406631..2406680) FT /note="match to EST BE814572 (NID:g10246806)" FT misc_feature complement(2406634..2406680) FT /note="match to EST BF663062 (NID:g11936957)" FT /note="match to EST BG576318 (NID:g13583971)" FT /note="match to EST AU142395 (NID:g11003916)" FT /note="match to EST BE902722 (NID:g10393199)" FT /note="similar to EST BM455055 (NID:g18504095)" FT /note="match to EST BG677679 (NID:g13909076)" FT /note="match to EST BE276703 (NID:g9151666)" FT /note="match to EST BG104253 (NID:g12598095)" FT /note="match to EST BE410262 (NID:g9346712)" FT /note="match to EST AW402799 (NID:g6921543)" FT /note="similar to Danio rerio EST BI533157 (NID:g15373724) FT fq97c09.y3" FT /note="match to EST AU124308 (NID:g10949024)" FT /note="match to EST BG327541 (NID:g13133979)" FT /note="similar to EST BM550181 (NID:g18786168)" FT /note="match to EST BE397388 (NID:g9342753)" FT /note="similar to Mus musculus EST AA184495 (NID:g1768145) FT mt49h07.r1" FT /note="match to EST AA580653 (NID:g2358310) nd41a08.r1" FT /note="similar to Mus musculus EST BI415697 FT (NID:g15176620)" FT /note="similar to Silurana tropicalis EST AL595405 FT (NID:g15007480)" FT /note="match to EST BE514079 (NID:g9721291)" FT /note="match to EST AU138091 (NID:g10999612)" FT /note="match to EST BG036475 (NID:g12431678)" FT /note="match to EST BG167893 (NID:g12674596)" FT /note="similar to Danio rerio EST AI496690 (NID:g4397693) FT fb48f04.y1" FT /note="similar to Xenopus laevis EST BE025557 FT (NID:g8318976) db25h05.y1" FT /note="similar to Mus musculus EST BG794964 FT (NID:g14130534)" FT /note="match to EST BF799442 (NID:g12128431)" FT /note="match to EST BI046201 (NID:g14452823)" FT /note="match to EST BI046442 (NID:g14453051)" FT misc_feature complement(2406665..2406680) FT /note="match to EST BI046881 (NID:g14453503)" FT misc_feature complement(2406430..2406433) FT /note="match to EST BG167893 (NID:g12674596)" FT misc_feature complement(2405952..2406329) FT /note="match to EST AA088362 (NID:g1633874) zl82c01.r1" FT misc_feature complement(2405952..2406327) FT /note="match to EST AW864452 (NID:g7998411)" FT misc_feature complement(2406160..2406230) FT /note="match to EST AW408372 (NID:g6927429)" FT misc_feature complement(2406160..2406229) FT /note="match to EST BE311638 (NID:g9147992)" FT /note="match to EST BG338604 (NID:g13145042)" FT misc_feature complement(2405952..2406226) FT /note="similar to EST BM727927 (NID:g19049260)" FT misc_feature complement(2406152..2406226) FT /note="match to EST BE397388 (NID:g9342753)" FT misc_feature complement(2406154..2406226) FT /note="similar to Mus musculus EST AA184495 (NID:g1768145) FT mt49h07.r1" FT misc_feature complement(2406158..2406226) FT /note="similar to Mus musculus EST BI415697 FT (NID:g15176620)" FT misc_feature complement(2406168..2406226) FT /note="similar to Silurana tropicalis EST AL595405 FT (NID:g15007480)" FT misc_feature complement(2406171..2406226) FT /note="match to EST BE514079 (NID:g9721291)" FT misc_feature complement(2406178..2406226) FT /note="match to EST AU138091 (NID:g10999612)" FT misc_feature complement(2406222..2406226) FT /note="match to EST BG036475 (NID:g12431678)" FT misc_feature complement(2406161..2406226) FT /note="similar to Xenopus laevis EST BE025557 FT (NID:g8318976) db25h05.y1" FT misc_feature complement(2406162..2406226) FT /note="match to EST BF799442 (NID:g12128431)" FT misc_feature complement(2406160..2406226) FT /note="match to EST BF663062 (NID:g11936957)" FT /note="match to EST AU134271 (NID:g10994810)" FT /note="match to EST BG576318 (NID:g13583971)" FT /note="match to EST BG774395 (NID:g14044712)" FT /note="match to EST AU142395 (NID:g11003916)" FT /note="match to EST BE902722 (NID:g10393199)" FT /note="similar to EST BM455055 (NID:g18504095)" FT /note="match to EST BG677679 (NID:g13909076)" FT /note="match to EST BE276703 (NID:g9151666)" FT /note="match to EST BG104253 (NID:g12598095)" FT /note="match to EST BE410262 (NID:g9346712)" FT /note="similar to Mus musculus EST AA407744 (NID:g2067282)" FT /note="match to EST AW402799 (NID:g6921543)" FT /note="similar to Danio rerio EST BI533157 (NID:g15373724) FT fq97c09.y3" FT /note="match to EST AU124308 (NID:g10949024)" FT /note="match to EST BG327541 (NID:g13133979)" FT /note="similar to EST BM550181 (NID:g18786168)" FT /note="match to EST AA580653 (NID:g2358310) nd41a08.r1" FT /note="similar to Danio rerio EST AI496690 (NID:g4397693) FT fb48f04.y1" FT /note="match to EST BG961170 (NID:g14379341)" FT /note="match to EST AA679866 (NID:g2656333) ac83h04.s1" FT /note="similar to Mus musculus EST BG794964 FT (NID:g14130534)" FT /note="match to EST BI046201 (NID:g14452823)" FT misc_feature complement(2406209..2406226) FT /note="match to EST BI046442 (NID:g14453051)" FT misc_feature complement(2406160..2406202) FT /note="similar to Homo sapiens EST BE868764 FT (NID:g10317540)" FT misc_feature complement(2405952..2406098) FT /note="similar to Homo sapiens EST BE257426 (NID:g9127901)" FT misc_feature complement(2405933..2406088) FT /note="match to EST AW804649 (NID:g7856519)" FT misc_feature complement(2405961..2406083) FT /note="match to EST AW402799 (NID:g6921543)" FT misc_feature complement(2405968..2406083) FT /note="similar to Danio rerio EST BI533157 (NID:g15373724) FT fq97c09.y3" FT misc_feature complement(2405970..2406083) FT /note="similar to Homo sapiens EST BE868764 FT (NID:g10317540)" FT misc_feature complement(2405980..2406083) FT /note="match to EST AW408372 (NID:g6927429)" FT misc_feature complement(2406005..2406083) FT /note="match to EST AU124308 (NID:g10949024)" FT misc_feature complement(2406021..2406083) FT /note="match to EST BG327541 (NID:g13133979)" FT misc_feature complement(2406050..2406083) FT /note="similar to EST BM550181 (NID:g18786168)" FT misc_feature complement(2406022..2406083) FT /note="similar to Danio rerio EST AI496690 (NID:g4397693) FT fb48f04.y1" FT misc_feature complement(2405952..2406083) FT /note="match to EST BF663062 (NID:g11936957)" FT /note="match to EST BE311638 (NID:g9147992)" FT /note="match to EST AU134271 (NID:g10994810)" FT /note="match to EST BG338604 (NID:g13145042)" FT /note="match to EST BG576318 (NID:g13583971)" FT /note="match to EST BG774395 (NID:g14044712)" FT /note="match to EST AU142395 (NID:g11003916)" FT /note="match to EST BE902722 (NID:g10393199)" FT /note="similar to EST BM455055 (NID:g18504095)" FT /note="match to EST BG677679 (NID:g13909076)" FT /note="match to EST BE276703 (NID:g9151666)" FT /note="match to EST BG104253 (NID:g12598095)" FT /note="match to EST BE410262 (NID:g9346712)" FT /note="match to EST BG961170 (NID:g14379341)" FT /note="match to EST AA679866 (NID:g2656333) ac83h04.s1" FT misc_feature complement(2405957..2406083) FT /note="similar to Mus musculus EST AA407744 (NID:g2067282)" FT /note="similar to Mus musculus EST BG794964 FT (NID:g14130534)" FT misc_feature complement(2405996..2406083) FT /note="match to EST BI046201 (NID:g14452823)" FT misc_feature complement(2405952..2406070) FT /note="match to EST AA308795 (NID:g1961125)" FT misc_feature complement(2406037..2406038) FT /note="match to EST AA580653 (NID:g2358310) nd41a08.r1" FT misc_feature complement(2405393..2405896) FT /note="match to EST BG960498 (NID:g14378656)" FT misc_feature complement(2405455..2405778) FT /note="similar to Homo sapiens EST AW855179 (NID:g7950872)" FT repeat_region complement(2405280..2405620) FT /rpt_family="Alu" FT repeat_region complement(2404615..2404884) FT /rpt_family="Alu" FT misc_feature complement(2404795..2404797) FT /note="similar to Homo sapiens EST BE257426 (NID:g9127901)" FT repeat_region complement(2404232..2404591) FT /rpt_family="L1" FT misc_feature complement(2404032..2404172) FT /note="match to EST AW900299 (NID:g8064504)" FT misc_feature complement(2404080..2404164) FT /note="similar to EST BM455055 (NID:g18504095)" FT misc_feature complement(2404094..2404164) FT /note="match to EST BG677679 (NID:g13909076)" FT misc_feature complement(2404138..2404164) FT /note="match to EST AA088362 (NID:g1633874) zl82c01.r1" FT misc_feature complement(2404161..2404164) FT /note="match to EST BG104253 (NID:g12598095)" FT misc_feature complement(2404144..2404164) FT /note="match to EST BE276703 (NID:g9151666)" FT /note="match to EST BE410262 (NID:g9346712)" FT misc_feature complement(2404123..2404164) FT /note="match to EST AW864452 (NID:g7998411)" FT misc_feature complement(2404032..2404164) FT /note="match to EST BF663062 (NID:g11936957)" FT /note="match to EST BE311638 (NID:g9147992)" FT /note="match to EST AU134271 (NID:g10994810)" FT /note="match to EST BG338604 (NID:g13145042)" FT /note="match to EST BG576318 (NID:g13583971)" FT /note="match to EST BG774395 (NID:g14044712)" FT /note="match to EST AU142395 (NID:g11003916)" FT /note="match to EST AA308795 (NID:g1961125)" FT /note="match to EST BE902722 (NID:g10393199)" FT /note="match to EST AA382480 (NID:g2035041)" FT /note="similar to EST BM727927 (NID:g19049260)" FT /note="match to EST AW804649 (NID:g7856519)" FT /note="match to EST BG961170 (NID:g14379341)" FT /note="match to EST AA679866 (NID:g2656333) ac83h04.s1" FT repeat_region 2551729..2551911 FT /rpt_family="MER1_type" FT misc_feature 2552033 FT /note="match to EST AA453321 (NID:g2166990) zx44e09.r1" FT repeat_region 2552517..2552610 FT /rpt_family="C-rich" FT repeat_region 2552851..2552915 FT /rpt_family="(TGGA)n" FT repeat_region 2553922..2553947 FT /rpt_family="(TCCA)n" FT repeat_region 2553956..2554058 FT /rpt_family="L2" FT repeat_region 2554131..2554289 FT /rpt_family="(TCCA)n" FT repeat_region 2554309..2554726 FT /rpt_family="(TCCA)n" FT repeat_region 2554744..2554912 FT /rpt_family="(TCCA)n" FT repeat_region 2554933..2554981 FT /rpt_family="L2" FT repeat_region 2556460..2556602 FT /rpt_family="MIR" FT misc_feature 2557497..2557578 FT /note="similar to Homo sapiens EST BG163784 FT (NID:g12670487)" FT repeat_region 2558127..2558233 FT /rpt_family="L2" FT misc_feature 2558182..2558232 FT /note="similar to Homo sapiens EST BG163784 FT (NID:g12670487)" FT misc_feature 2558285..2559967 FT /note="CpG_island (%GC=74.8, o/e=0.80, #CpGs=207)" FT repeat_region 2558320..2558346 FT /rpt_family="(TGG)n" FT repeat_region 2559137..2559240 FT /rpt_family="GC_rich" FT misc_feature 2559481..2559955 FT /note="similar to Mus musculus EST AW120548 (NID:g6095881)" FT misc_feature 2559491..2560320 FT /note="similar to Mus musculus EST BF579500 FT (NID:g11653212)" FT misc_feature 2559498..2559927 FT /note="similar to Mus musculus EST BE634793 (NID:g9917569) FT uv87a06.x1" FT misc_feature 2559559..2559927 FT /note="similar to Mus musculus EST BE691975 (NID:g10079599) FT ut23h05.x1" FT repeat_region 2559594..2559694 FT /rpt_family="GC_rich" FT misc_feature 2559744..2559927 FT /note="similar to Mus musculus EST BG091212 FT (NID:g12573775)" FT repeat_region 2559757..2559833 FT /rpt_family="GC_rich" FT misc_feature 2559766..2559927 FT /note="similar to Mus musculus EST BG243528 FT (NID:g12753343)" FT misc_feature 2559787..2560618 FT /note="similar to EST BM549606 (NID:g18785159)" FT misc_feature 2559792..2559927 FT /note="similar to Mus musculus EST AA138083 (NID:g1700036) FT mr02e03.r1" FT misc_feature 2559804..2559927 FT /note="match to EST R56561 (NID:g826667) yg91c10.r1" FT misc_feature 2559826..2559861 FT /note="similar to Homo sapiens EST AL530686 FT (NID:g12794179)" FT misc_feature 2561245..2561602 FT /note="match to EST BG953224 (NID:g14371395)" FT repeat_region 2561385..2561448 FT /rpt_family="MIR" FT repeat_region 2561840..2561880 FT /rpt_family="L2" FT repeat_region 2562301..2562459 FT /rpt_family="MIR" FT misc_feature 2562354..2562822 FT /note="match to EST AA453321 (NID:g2166990) zx44e09.r1" FT repeat_region 2562496..2562546 FT /rpt_family="MIR" FT misc_feature 2562756..2563238 FT /note="match to EST AA628444 (NID:g2540831) af26f09.s1" FT misc_feature 2564326..2564351 FT /note="similar to Homo sapiens EST AL530686 FT (NID:g12794179)" FT misc_feature 2564329..2564377 FT /note="match to EST R56561 (NID:g826667) yg91c10.r1" FT /note="similar to Homo sapiens EST BG163784 FT (NID:g12670487)" FT /note="similar to Mus musculus EST BG243528 FT (NID:g12753343)" FT /note="similar to Mus musculus EST AA138083 (NID:g1700036) FT mr02e03.r1" FT /note="similar to Mus musculus EST BE634793 (NID:g9917569) FT uv87a06.x1" FT /note="similar to Mus musculus EST BG091212 FT (NID:g12573775)" FT /note="similar to Mus musculus EST BE691975 (NID:g10079599) FT ut23h05.x1" FT misc_feature 2564331..2564377 FT /note="similar to Mus musculus EST AI430284 (NID:g4276120) FT mf50b06.y1" FT misc_feature 2564846..2564952 FT /note="similar to Mus musculus EST BI416089 FT (NID:g15176999)" FT misc_feature 2564848..2564952 FT /note="similar to Sus scrofa EST BF191491 (NID:g11074860)" FT /note="similar to Sus scrofa EST BF191493 (NID:g11074862)" FT misc_feature 2564850..2564952 FT /note="similar to Gallus gallus EST BI393721 FT (NID:g15087003)" FT misc_feature 2564853..2564952 FT /note="match to EST R56561 (NID:g826667) yg91c10.r1" FT /note="similar to Mus musculus EST AI430284 (NID:g4276120) FT mf50b06.y1" FT /note="similar to Homo sapiens EST BG163784 FT (NID:g12670487)" FT /note="similar to Mus musculus EST BG243528 FT (NID:g12753343)" FT /note="similar to Mus musculus EST BE634793 (NID:g9917569) FT uv87a06.x1" FT /note="similar to Mus musculus EST AA138083 (NID:g1700036) FT mr02e03.r1" FT /note="similar to Mus musculus EST BG091212 FT (NID:g12573775)" FT misc_feature 2564853..2564943 FT /note="similar to Mus musculus EST BE691975 (NID:g10079599) FT ut23h05.x1" FT misc_feature 2564895..2564952 FT /note="similar to Mus musculus EST BI904375 FT (NID:g16166663)" FT misc_feature 2564905..2564952 FT /note="similar to Homo sapiens EST AL530686 FT (NID:g12794179)" FT misc_feature 2565048..2565412 FT /note="similar to Gallus gallus EST BI393721 FT (NID:g15087003)" FT misc_feature 2565048..2565201 FT /note="similar to Mus musculus EST AA138083 (NID:g1700036) FT mr02e03.r1" FT /note="similar to Mus musculus EST BG091212 FT (NID:g12573775)" FT /note="similar to Sus scrofa EST BF191491 (NID:g11074860)" FT /note="similar to Mus musculus EST BG243528 FT (NID:g12753343)" FT /note="similar to Mus musculus EST BI904375 FT (NID:g16166663)" FT /note="similar to Homo sapiens EST BG163784 FT (NID:g12670487)" FT /note="similar to Mus musculus EST BI416089 FT (NID:g15176999)" FT /note="similar to Sus scrofa EST BF191493 (NID:g11074862)" FT /note="similar to Mus musculus EST AI430284 (NID:g4276120) FT mf50b06.y1" FT misc_feature 2565048..2565074 FT /note="similar to Homo sapiens EST AL530686 FT (NID:g12794179)" FT misc_feature 2565048..2565174 FT /note="similar to Mus musculus EST BE634793 (NID:g9917569) FT uv87a06.x1" FT misc_feature 2565048..2565126 FT /note="match to EST R56561 (NID:g826667) yg91c10.r1" FT misc_feature 2565049..2565201 FT /note="similar to Mus musculus EST BI653884 FT (NID:g15568120)" FT misc_feature 2565064..2565201 FT /note="similar to Mus musculus EST AA183096 (NID:g1766964) FT mt84b02.r1" FT misc_feature 2565127..2565201 FT /note="match to EST BE697302 (NID:g10084449)" FT misc_feature 2565147..2565159 FT /note="similar to Homo sapiens EST AL530686 FT (NID:g12794179)" FT misc_feature 2565178..2565201 FT /note="match to EST BF373191 (NID:g11335216)" FT misc_feature 2565319..2565404 FT /note="similar to Sus scrofa EST BF191493 (NID:g11074862)" FT /note="similar to Mus musculus EST BI904375 FT (NID:g16166663)" FT /note="match to EST BE697302 (NID:g10084449)" FT /note="similar to Homo sapiens EST BG163784 FT (NID:g12670487)" FT /note="similar to Mus musculus EST AI430284 (NID:g4276120) FT mf50b06.y1" FT /note="similar to Sus scrofa EST BF191507 (NID:g11074876)" FT /note="similar to Mus musculus EST AA183096 (NID:g1766964) FT mt84b02.r1" FT /note="similar to Sus scrofa EST BF191491 (NID:g11074860)" FT /note="similar to Mus musculus EST BI416089 FT (NID:g15176999)" FT /note="match to EST BF373191 (NID:g11335216)" FT /note="similar to Mus musculus EST BG243528 FT (NID:g12753343)" FT /note="similar to Mus musculus EST BI653884 FT (NID:g15568120)" FT misc_feature 2565319..2565408 FT /note="similar to Mus musculus EST BG091212 FT (NID:g12573775)" FT misc_feature 2565331..2565404 FT /note="similar to Homo sapiens EST AL530686 FT (NID:g12794179)" FT misc_feature 2565373..2565404 FT /note="similar to Mus musculus EST BI409623 FT (NID:g15170546)" FT misc_feature 2565875..2566043 FT /note="similar to EST BM256132 (NID:g17891731)" FT misc_feature 2565878..2566021 FT /note="similar to Homo sapiens EST AL530686 FT (NID:g12794179)" FT misc_feature 2565878..2566043 FT /note="similar to Sus scrofa EST BF191493 (NID:g11074862)" FT /note="similar to Mus musculus EST BI409623 FT (NID:g15170546)" FT /note="similar to Mus musculus EST BI653884 FT (NID:g15568120)" FT /note="similar to Mus musculus EST AA183096 (NID:g1766964) FT mt84b02.r1" FT /note="match to EST BF373191 (NID:g11335216)" FT /note="similar to Mus musculus EST BI904375 FT (NID:g16166663)" FT /note="match to EST BE697302 (NID:g10084449)" FT misc_feature 2565878..2566046 FT /note="similar to Homo sapiens EST BG163784 FT (NID:g12670487)" FT /note="similar to Mus musculus EST BI416089 FT (NID:g15176999)" FT misc_feature 2565878..2566050 FT /note="similar to Mus musculus EST BG243528 FT (NID:g12753343)" FT /note="similar to Sus scrofa EST BF191491 (NID:g11074860)" FT misc_feature 2565878..2565998 FT /note="similar to Mus musculus EST BG091212 FT (NID:g12573775)" FT /note="similar to Mus musculus EST AI430284 (NID:g4276120) FT mf50b06.y1" FT misc_feature 2565878..2566009 FT /note="similar to Sus scrofa EST BF191507 (NID:g11074876)" FT misc_feature 2565945..2566043 FT /note="match to EST BG422267 (NID:g13328773)" FT misc_feature 2566008..2566043 FT /note="similar to Mus musculus EST BF019649 (NID:g10750981) FT ux14b06.y1" FT misc_feature 2566470..2566555 FT /note="similar to Mus musculus EST BI653884 FT (NID:g15568120)" FT /note="similar to Mus musculus EST BF019649 (NID:g10750981) FT ux14b06.y1" FT /note="similar to Mus musculus EST BI409623 FT (NID:g15170546)" FT /note="match to EST BG422267 (NID:g13328773)" FT /note="similar to Mus musculus EST BI904375 FT (NID:g16166663)" FT /note="similar to EST BM256132 (NID:g17891731)" FT /note="similar to Mus musculus EST AA183096 (NID:g1766964) FT mt84b02.r1" FT misc_feature 2566470..2566509 FT /note="match to EST BF373191 (NID:g11335216)" FT misc_feature 2566470..2566506 FT /note="similar to Sus scrofa EST BF191493 (NID:g11074862)" FT misc_feature 2566470..2566475 FT /note="match to EST BE697302 (NID:g10084449)" FT misc_feature 2566515..2566555 FT /note="similar to Rattus norvegicus EST BF545295 FT (NID:g11636402)" FT misc_feature 2566779..2566981 FT /note="similar to Bos taurus EST BI539760 (NID:g15380870)" FT misc_feature 2566780..2567011 FT /note="similar to Mus musculus EST BI409623 FT (NID:g15170546)" FT misc_feature 2566780..2567032 FT /note="similar to Mus musculus EST BF019649 (NID:g10750981) FT ux14b06.y1" FT misc_feature 2566780..2566939 FT /note="similar to Mus musculus EST BI904375 FT (NID:g16166663)" FT misc_feature 2566780..2567084 FT /note="similar to Rattus norvegicus EST BF545295 FT (NID:g11636402)" FT misc_feature 2566780..2567412 FT /note="match to EST BG422267 (NID:g13328773)" FT misc_feature 2566780..2566955 FT /note="similar to EST BM256132 (NID:g17891731)" FT misc_feature 2566780..2566871 FT /note="similar to Mus musculus EST BI653884 FT (NID:g15568120)" FT misc_feature 2566780..2566813 FT /note="similar to Mus musculus EST AA183096 (NID:g1766964) FT mt84b02.r1" FT misc_feature 2566815..2567099 FT /note="similar to Rattus sp. EST AI236775 (NID:g3830281)" FT repeat_region 2566955..2566987 FT /rpt_family="(TG)n" FT misc_feature 2567009..2567377 FT /note="similar to Bos taurus EST BI539760 (NID:g15380870)" FT misc_feature 2567116..2567737 FT /note="match to EST BG325616 (NID:g13132053)" FT misc_feature 2567129..2567637 FT /note="match to EST BF110401 (NID:g10940091)" FT misc_feature 2567345..2568063 FT /note="match to EST BG164143 (NID:g12670846)" FT misc_feature 2567508..2567981 FT /note="similar to Bos taurus EST BF606756 (NID:g11707685)" FT misc_feature 2567571..2568061 FT /note="match to EST AW151924 (NID:g6199744) xf70d01.x1" FT misc_feature 2567742..2568152 FT /note="similar to Cavia porcellus EST AU083199 FT (NID:g9987907)" FT misc_feature 2567751..2568063 FT /note="match to EST D20171 (NID:g501268)" FT misc_feature 2567787..2568063 FT /note="match to EST AI970064 (NID:g5766884) wq80g06.x1" FT misc_feature 2567811..2568061 FT /note="similar to Rattus sp. EST AI236775 (NID:g3830281)" FT misc_feature 2568302..2568446 FT /note="similar to Homo sapiens EST BF353481 FT (NID:g11312555)" FT repeat_region 2568471..2568611 FT /rpt_family="MIR" FT misc_feature 2568505..2568811 FT /note="match to EST R56562 (NID:g826668) yg91c10.s1" FT misc_feature 2568641 FT /note="similar to Homo sapiens EST BF353481 FT (NID:g11312555)" FT repeat_region 2570421..2570609 FT /rpt_family="L2" FT misc_feature 2570855..2570869 FT /note="match to EST BF873272 (NID:g12263402)" FT misc_feature 2570870..2571218 FT /note="match to EST BF873272 (NID:g12263402)" FT repeat_region 2571002..2571167 FT /rpt_family="L2" FT misc_feature 2571728..2571730 FT /note="match to EST BE174035 (NID:g8636761)" FT repeat_region 2571960..2572443 FT /rpt_family="MaLR" FT misc_feature 2572602..2572922 FT /note="match to EST BE174035 (NID:g8636761)" FT repeat_region 2572826..2572960 FT /rpt_family="MIR" FT repeat_region 2572975..2573114 FT /rpt_family="L1" FT misc_feature 2573011..2573021 FT /note="match to EST AI185415 (NID:g3736053) qe53a04.x1" FT misc_feature 2573086..2573105 FT /note="similar to Homo sapiens EST BG335073 FT (NID:g13141511)" FT repeat_region 2573126..2574918 FT /rpt_family="SVA" FT misc_feature 2573132..2573143 FT /note="match to EST AI081542 (NID:g3418334) on04g10.x1" FT misc_feature 2573655..2574795 FT /note="CpG_island (%GC=71.4, o/e=0.70, #CpGs=88)" FT misc_feature 2574227..2574231 FT /note="match to EST BF530824 (NID:g11618187)" FT repeat_region 2574925..2575012 FT /rpt_family="(GGGAGA)n" FT repeat_region 2575034..2575097 FT /rpt_family="Alu" FT repeat_region 2575176..2575465 FT /rpt_family="Alu" FT repeat_region 2575477..2575771 FT /rpt_family="Alu" FT repeat_region 2576166..2576446 FT /rpt_family="L1" FT repeat_region 2576504..2576678 FT /rpt_family="Alu" FT repeat_region 2576679..2576922 FT /rpt_family="Alu" FT repeat_region 2576923..2577044 FT /rpt_family="Alu" FT repeat_region 2577074..2577364 FT /rpt_family="Alu" FT repeat_region 2577390..2577503 FT /rpt_family="L1" FT misc_feature 2577446..2578086 FT /note="match to EST BG403468 (NID:g13296916)" FT misc_feature 2577475..2577962 FT /note="match to EST AW270148 (NID:g6657178) xv47f08.x1" FT misc_feature 2577483..2577698 FT /note="match to EST AI185415 (NID:g3736053) qe53a04.x1" FT misc_feature 2577483..2577717 FT /note="match to EST AI081542 (NID:g3418334) on04g10.x1" FT misc_feature 2577485..2578170 FT /note="similar to EST BM675122 (NID:g18985020)" FT misc_feature 2577486..2577815 FT /note="match to EST AA284609 (NID:g1927520) zt22d02.r1" FT misc_feature 2577518..2578121 FT /note="similar to Homo sapiens EST BG335073 FT (NID:g13141511)" FT misc_feature 2577528..2577791 FT /note="match to EST AW663729 (NID:g7456267) hj12g06.x1" FT misc_feature 2577543..2578382 FT /note="match to EST AL580785 (NID:g12947145)" FT misc_feature 2577556..2578398 FT /note="match to EST AL529638 (NID:g12793131)" FT misc_feature 2577560..2578249 FT /note="similar to Homo sapiens EST BI520624 FT (NID:g15345416)" FT misc_feature 2577627..2578398 FT /note="match to EST BF683471 (NID:g11968879)" FT misc_feature 2577702..2578198 FT /note="similar to Mus musculus EST BB433365 FT (NID:g16424279)" FT misc_feature 2577720..2578398 FT /note="match to EST BF972673 (NID:g12339888)" FT misc_feature 2577766..2577980 FT /note="similar to Homo sapiens EST AA626600 (NID:g2538987) FT ab54h01.r1" FT misc_feature 2577777..2578277 FT /note="match to EST AL531484 (NID:g12794977)" FT misc_feature 2577779..2578349 FT /note="similar to Mus musculus EST BE310685 (NID:g9170772)" FT misc_feature 2577812..2578398 FT /note="similar to Mus musculus EST BF579562 FT (NID:g11653274)" FT misc_feature 2577826..2578763 FT /note="similar to EST BM553644 (NID:g18792556)" FT misc_feature 2577879..2578398 FT /note="match to EST BG678287 (NID:g13909684)" FT misc_feature 2577933..2578398 FT /note="match to EST AL531485 (NID:g12794978)" FT misc_feature 2577953..2578398 FT /note="match to EST BE744900 (NID:g10158892)" FT misc_feature 2578021..2578398 FT /note="match to EST BI117382 (NID:g14568283)" FT misc_feature 2578046..2578398 FT /note="similar to EST BM547611 (NID:g18781526)" FT misc_feature 2578138..2578398 FT /note="match to EST BG259877 (NID:g12769693)" FT misc_feature 2578148..2578398 FT /note="match to EST BG481753 (NID:g13414032)" FT misc_feature 2578183..2578398 FT /note="match to EST BI964092 (NID:g16338497) ie64g10.y1" FT misc_feature 2578315..2578398 FT /note="match to EST BI260965 (NID:g14819769)" FT misc_feature 2578323..2578578 FT /note="match to EST BE886527 (NID:g10340904)" FT misc_feature 2578339..2578398 FT /note="match to EST C17837 (NID:g1579439)" FT misc_feature 2578347..2578361 FT /note="match to EST BM009979 (NID:g16524333)" FT misc_feature 2578356..2578398 FT /note="match to EST BE884662 (NID:g10333438)" FT misc_feature 2578435..2578578 FT /note="match to EST BM009979 (NID:g16524333)" FT repeat_region 2578485..2578599 FT /rpt_family="MIR" FT misc_feature 2578527 FT /note="match to EST BF683471 (NID:g11968879)" FT misc_feature 2578813..2578985 FT /note="match to EST AL531485 (NID:g12794978)" FT /note="match to EST BI964092 (NID:g16338497) ie64g10.y1" FT /note="match to EST BE884662 (NID:g10333438)" FT /note="match to EST BE744900 (NID:g10158892)" FT /note="match to EST BM009979 (NID:g16524333)" FT /note="match to EST AW976249 (NID:g8167475)" FT /note="match to EST C17837 (NID:g1579439)" FT /note="match to EST BI260965 (NID:g14819769)" FT /note="match to EST BE886527 (NID:g10340904)" FT /note="match to EST BG481753 (NID:g13414032)" FT /note="match to EST BI117382 (NID:g14568283)" FT /note="match to EST BG678287 (NID:g13909684)" FT /note="similar to Mus musculus EST BF579562 FT (NID:g11653274)" FT misc_feature 2578813..2578852 FT /note="match to EST BF972673 (NID:g12339888)" FT misc_feature 2578813..2578949 FT /note="match to EST BG259877 (NID:g12769693)" FT misc_feature 2578813..2578910 FT /note="match to EST AL529638 (NID:g12793131)" FT misc_feature 2578838..2578985 FT /note="match to EST BG912901 (NID:g14293377)" FT misc_feature 2578876..2578985 FT /note="match to EST BI335238 (NID:g15019895)" FT misc_feature 2578897..2578985 FT /note="match to EST AL525642 (NID:g12789135)" FT misc_feature 2578929..2578985 FT /note="match to EST AW754500 (NID:g7669432)" FT misc_feature 2578933..2578985 FT /note="match to EST BF984964 (NID:g12387776)" FT /note="match to EST AA282722 (NID:g1925648) zs89g11.r1" FT misc_feature 2578970..2578985 FT /note="match to EST BI824049 (NID:g15935599)" FT misc_feature 2579178..2579276 FT /note="match to EST AL525642 (NID:g12789135)" FT /note="match to EST BI335238 (NID:g15019895)" FT /note="match to EST BI824049 (NID:g15935599)" FT /note="match to EST BF984964 (NID:g12387776)" FT /note="match to EST BG912901 (NID:g14293377)" FT /note="match to EST BM009979 (NID:g16524333)" FT /note="match to EST AW976249 (NID:g8167475)" FT /note="match to EST BI260965 (NID:g14819769)" FT /note="match to EST BE886527 (NID:g10340904)" FT /note="match to EST BI117382 (NID:g14568283)" FT /note="match to EST BG481753 (NID:g13414032)" FT /note="similar to EST BM547611 (NID:g18781526)" FT /note="match to EST BG678287 (NID:g13909684)" FT /note="match to EST AW754500 (NID:g7669432)" FT /note="match to EST AL531485 (NID:g12794978)" FT /note="match to EST BI964092 (NID:g16338497) ie64g10.y1" FT /note="match to EST BE884662 (NID:g10333438)" FT /note="match to EST AA282722 (NID:g1925648) zs89g11.r1" FT /note="match to EST C17837 (NID:g1579439)" FT misc_feature 2579178..2579261 FT /note="match to EST BE744900 (NID:g10158892)" FT misc_feature 2579178..2579224 FT /note="similar to Mus musculus EST BF579562 FT (NID:g11653274)" FT misc_feature 2579215..2579276 FT /note="match to EST BE246539 (NID:g9098288)" FT misc_feature 2579230..2579276 FT /note="match to EST BF530824 (NID:g11618187)" FT misc_feature 2579232..2579276 FT /note="match to EST AL536228 (NID:g12799721)" FT misc_feature 2579256..2579276 FT /note="match to EST BE783629 (NID:g10204827)" FT misc_feature 2579420..2579522 FT /note="match to EST AL525642 (NID:g12789135)" FT /note="match to EST BI335238 (NID:g15019895)" FT /note="match to EST BE783629 (NID:g10204827)" FT /note="match to EST BF530824 (NID:g11618187)" FT /note="match to EST BI824049 (NID:g15935599)" FT /note="match to EST BF984964 (NID:g12387776)" FT /note="match to EST BG912901 (NID:g14293377)" FT /note="match to EST BM009979 (NID:g16524333)" FT /note="match to EST AW976249 (NID:g8167475)" FT /note="match to EST BI260965 (NID:g14819769)" FT /note="match to EST BE886527 (NID:g10340904)" FT /note="match to EST BI117382 (NID:g14568283)" FT /note="match to EST BG481753 (NID:g13414032)" FT /note="similar to EST BM547611 (NID:g18781526)" FT /note="match to EST BG678287 (NID:g13909684)" FT misc_feature 2579420..2580168 FT /note="match to EST AL536228 (NID:g12799721)" FT misc_feature 2579420..2579831 FT /note="match to EST AW754500 (NID:g7669432)" FT misc_feature 2579420..2579541 FT /note="match to EST AL531485 (NID:g12794978)" FT misc_feature 2579420..2579512 FT /note="match to EST BI964092 (NID:g16338497) ie64g10.y1" FT misc_feature 2579420..2579453 FT /note="match to EST BE884662 (NID:g10333438)" FT misc_feature 2579420..2579444 FT /note="match to EST AA282722 (NID:g1925648) zs89g11.r1" FT misc_feature 2579420..2579740 FT /note="match to EST BE246539 (NID:g9098288)" FT repeat_region 2579665..2579996 FT /rpt_family="Alu" FT misc_feature 2579741..2579743 FT /note="match to EST C17837 (NID:g1579439)" FT misc_feature 2579882..2580337 FT /note="match to EST AI627352 (NID:g4664152) ty75d04.x1" FT misc_feature 2580025..2580198 FT /note="match to EST BE697518 (NID:g10084678)" FT misc_feature 2580464..2580528 FT /note="similar to EST BM547611 (NID:g18781526)" FT misc_feature 2580542..2580686 FT /note="match to EST BG177420 (NID:g12684123)" FT misc_feature 2580611..2580686 FT /note="match to EST BF526009 (NID:g11613370)" FT misc_feature 2580613..2580686 FT /note="match to EST AL525642 (NID:g12789135)" FT /note="match to EST BI335238 (NID:g15019895)" FT /note="match to EST BE783629 (NID:g10204827)" FT /note="match to EST BF530824 (NID:g11618187)" FT /note="match to EST BI824049 (NID:g15935599)" FT /note="match to EST BF984964 (NID:g12387776)" FT /note="match to EST BG912901 (NID:g14293377)" FT /note="match to EST BM009979 (NID:g16524333)" FT /note="match to EST AW976249 (NID:g8167475)" FT /note="match to EST BI260965 (NID:g14819769)" FT /note="match to EST BE886527 (NID:g10340904)" FT misc_feature 2580613..2580678 FT /note="match to EST BI117382 (NID:g14568283)" FT /note="match to EST BG481753 (NID:g13414032)" FT misc_feature 2580613..2580658 FT /note="similar to EST BM547611 (NID:g18781526)" FT misc_feature 2580613..2580637 FT /note="match to EST BG678287 (NID:g13909684)" FT misc_feature 2580627..2580686 FT /note="match to EST BM045207 (NID:g16774474)" FT misc_feature 2580630..2580686 FT /note="similar to Homo sapiens EST BM010932 FT (NID:g16525286)" FT misc_feature 2580932..2581118 FT /note="match to EST AL525642 (NID:g12789135)" FT /note="match to EST BE783629 (NID:g10204827)" FT /note="match to EST BF984964 (NID:g12387776)" FT /note="match to EST BF526009 (NID:g11613370)" FT /note="similar to Homo sapiens EST BM010932 FT (NID:g16525286)" FT /note="match to EST BI335238 (NID:g15019895)" FT /note="match to EST BI824049 (NID:g15935599)" FT /note="match to EST BG177420 (NID:g12684123)" FT /note="match to EST BF530824 (NID:g11618187)" FT /note="match to EST BG912901 (NID:g14293377)" FT /note="match to EST BM009979 (NID:g16524333)" FT misc_feature 2580932..2581256 FT /note="match to EST BM045207 (NID:g16774474)" FT misc_feature 2580932..2581070 FT /note="match to EST AW976249 (NID:g8167475)" FT misc_feature 2580932..2581010 FT /note="match to EST BI260965 (NID:g14819769)" FT misc_feature 2580932..2580935 FT /note="match to EST BE886527 (NID:g10340904)" FT misc_feature 2580969..2581118 FT /note="match to EST AL554148 (NID:g12894649)" FT misc_feature 2581347..2581470 FT /note="match to EST BI257350 (NID:g14812641)" FT misc_feature 2581348..2581470 FT /note="match to EST H17234 (NID:g883474) ym42e05.r1" FT misc_feature 2581352..2581470 FT /note="match to EST BF984964 (NID:g12387776)" FT /note="match to EST BG177420 (NID:g12684123)" FT /note="similar to Homo sapiens EST BM010932 FT (NID:g16525286)" FT /note="match to EST BI335238 (NID:g15019895)" FT /note="match to EST AL525642 (NID:g12789135)" FT /note="match to EST BI824049 (NID:g15935599)" FT /note="match to EST BG912901 (NID:g14293377)" FT /note="match to EST BF530824 (NID:g11618187)" FT /note="match to EST AL554148 (NID:g12894649)" FT /note="match to EST BE783629 (NID:g10204827)" FT /note="match to EST BF526009 (NID:g11613370)" FT /note="match to EST BM045207 (NID:g16774474)" FT misc_feature 2581352..2581391 FT /note="match to EST BM009979 (NID:g16524333)" FT misc_feature 2581754..2581845 FT /note="match to EST BE783629 (NID:g10204827)" FT /note="match to EST BF526009 (NID:g11613370)" FT /note="match to EST BI335238 (NID:g15019895)" FT /note="match to EST H17234 (NID:g883474) ym42e05.r1" FT /note="match to EST BI257350 (NID:g14812641)" FT /note="match to EST AL554148 (NID:g12894649)" FT /note="match to EST BM045207 (NID:g16774474)" FT /note="similar to Homo sapiens EST BM010932 FT (NID:g16525286)" FT /note="match to EST AL525642 (NID:g12789135)" FT /note="match to EST BG177420 (NID:g12684123)" FT /note="match to EST BF530824 (NID:g11618187)" FT misc_feature 2581754..2581803 FT /note="match to EST BF984964 (NID:g12387776)" FT misc_feature 2581754..2581806 FT /note="match to EST BI824049 (NID:g15935599)" FT misc_feature 2581754..2581775 FT /note="match to EST BG912901 (NID:g14293377)" FT misc_feature 2581776..2581780 FT /note="match to EST AL531485 (NID:g12794978)" FT misc_feature 2581815..2581845 FT /note="match to EST AL559089 (NID:g12904244)" FT misc_feature 2581825..2581845 FT /note="similar to Homo sapiens EST BG829171 FT (NID:g14176758)" FT misc_feature 2582224..2582655 FT /note="similar to Homo sapiens EST BM007555 FT (NID:g16521909)" FT misc_feature 2582800..2583596 FT /note="similar to EST BM543881 (NID:g18774659)" FT misc_feature 2582838..2582957 FT /note="match to EST AL554148 (NID:g12894649)" FT /note="match to EST BI335238 (NID:g15019895)" FT /note="match to EST BF526009 (NID:g11613370)" FT /note="similar to Homo sapiens EST BG829171 FT (NID:g14176758)" FT /note="match to EST AL559089 (NID:g12904244)" FT /note="match to EST BI257350 (NID:g14812641)" FT /note="similar to Homo sapiens EST BM010932 FT (NID:g16525286)" FT /note="match to EST AL525642 (NID:g12789135)" FT /note="match to EST BG177420 (NID:g12684123)" FT /note="match to EST BM045207 (NID:g16774474)" FT misc_feature 2582838..2582961 FT /note="match to EST H17234 (NID:g883474) ym42e05.r1" FT misc_feature 2582838..2582911 FT /note="match to EST BF530824 (NID:g11618187)" FT misc_feature 2582838..2582951 FT /note="match to EST BE783629 (NID:g10204827)" FT misc_feature 2582842..2582957 FT /note="match to EST BF340204 (NID:g11286666)" FT misc_feature 2582844..2582968 FT /note="match to EST AL602701 (NID:g15166207)" FT misc_feature 2582855..2582957 FT /note="match to EST AL520479 (NID:g12783972)" FT misc_feature 2582867..2582957 FT /note="match to EST BE303038 (NID:g9186746) ba72g06.y1" FT misc_feature 2583026..2583277 FT /note="match to EST AA323423 (NID:g1975748)" FT misc_feature 2583224..2583583 FT /note="similar to Homo sapiens EST BG829171 FT (NID:g14176758)" FT misc_feature 2583224..2583596 FT /note="match to EST AL520479 (NID:g12783972)" FT /note="match to EST AL559089 (NID:g12904244)" FT /note="match to EST BF340204 (NID:g11286666)" FT misc_feature 2583224..2583608 FT /note="match to EST AL554148 (NID:g12894649)" FT misc_feature 2583224..2583584 FT /note="match to EST BI257350 (NID:g14812641)" FT misc_feature 2583224..2583563 FT /note="similar to Homo sapiens EST BM010932 FT (NID:g16525286)" FT misc_feature 2583224..2583548 FT /note="match to EST BE303038 (NID:g9186746) ba72g06.y1" FT misc_feature 2583224..2583311 FT /note="match to EST AL525642 (NID:g12789135)" FT misc_feature 2583224..2583304 FT /note="match to EST BF526009 (NID:g11613370)" FT misc_feature 2583224..2583279 FT /note="match to EST BM045207 (NID:g16774474)" FT misc_feature 2583224..2583245 FT /note="match to EST BG177420 (NID:g12684123)" FT misc_feature 2583262..2583605 FT /note="similar to Bos taurus EST AW426553 (NID:g6954500)" FT misc_feature 2583268..2583596 FT /note="match to EST AL528965 (NID:g12792458)" FT misc_feature 2583310..2583596 FT /note="match to EST AL529639 (NID:g12793132)" FT misc_feature 2583316 FT /note="match to EST BM045207 (NID:g16774474)" FT misc_feature 2583462..2583463 FT /note="match to EST BF526009 (NID:g11613370)" FT misc_feature 2583510..2583596 FT /note="match to EST BF913055 (NID:g12304513)" FT misc_feature 2583540..2583596 FT /note="match to EST BM149247 (NID:g17170689)" FT misc_feature 2583756 FT /note="similar to Homo sapiens EST BM010932 FT (NID:g16525286)" FT repeat_region 2583826..2584135 FT /rpt_family="Alu" FT repeat_region 2584139..2584299 FT /rpt_family="Alu" FT repeat_region 2584444..2584504 FT /rpt_family="MIR" FT misc_feature 2584529..2584690 FT /note="match to EST AL602701 (NID:g15166207)" FT misc_feature 2584543..2584687 FT /note="match to EST BM149247 (NID:g17170689)" FT misc_feature 2584543..2584690 FT /note="match to EST AL529639 (NID:g12793132)" FT /note="match to EST AL520479 (NID:g12783972)" FT /note="match to EST AL528965 (NID:g12792458)" FT /note="match to EST BF913055 (NID:g12304513)" FT /note="match to EST BF340204 (NID:g11286666)" FT /note="similar to EST BM543881 (NID:g18774659)" FT misc_feature 2584553..2584690 FT /note="match to EST AI081542 (NID:g3418334) on04g10.x1" FT misc_feature 2584558..2584690 FT /note="match to EST BF726952 (NID:g12042863) by14e09.y1" FT misc_feature 2584582..2584690 FT /note="match to EST AA078212 (NID:g1837686)" FT repeat_region 2584718..2585026 FT /rpt_family="Alu" FT repeat_region 2585121..2585423 FT /rpt_family="Alu" FT repeat_region 2585794..2586085 FT /rpt_family="Alu" FT repeat_region 2586086..2586396 FT /rpt_family="Alu" FT repeat_region 2586397..2586423 FT /rpt_family="AT_rich" FT misc_feature 2586958..2587112 FT /note="match to EST AL529639 (NID:g12793132)" FT /note="match to EST BF726952 (NID:g12042863) by14e09.y1" FT /note="match to EST BM149247 (NID:g17170689)" FT /note="match to EST AL559089 (NID:g12904244)" FT /note="match to EST AL602701 (NID:g15166207)" FT /note="match to EST AL520479 (NID:g12783972)" FT /note="match to EST AL528965 (NID:g12792458)" FT /note="match to EST BF913055 (NID:g12304513)" FT misc_feature 2586958..2587104 FT /note="match to EST BF340204 (NID:g11286666)" FT misc_feature 2586958..2587107 FT /note="match to EST AA078212 (NID:g1837686)" FT misc_feature 2586958..2586990 FT /note="similar to EST BM543881 (NID:g18774659)" FT misc_feature 2586958..2587030 FT /note="match to EST AI081542 (NID:g3418334) on04g10.x1" FT misc_feature 2586964..2587112 FT /note="similar to EST BM555599 (NID:g18796181)" FT misc_feature 2586982..2587112 FT /note="similar to Homo sapiens EST BG829171 FT (NID:g14176758)" FT misc_feature 2586984..2587112 FT /note="match to EST BE247601 (NID:g9099358)" FT repeat_region 2587247..2587435 FT /rpt_family="L1" FT repeat_region 2587436..2587747 FT /rpt_family="Alu" FT repeat_region 2587748..2587779 FT /rpt_family="L1" FT repeat_region 2588051..2588314 FT /rpt_family="Alu" FT repeat_region 2588315..2588628 FT /rpt_family="Alu" FT misc_feature 2588347..2588961 FT /note="similar to EST BM477906 (NID:g18526948)" FT repeat_region 2588857..2589124 FT /rpt_family="Alu" FT repeat_region 2589126..2589597 FT /rpt_family="L1" FT repeat_region 2589598..2589818 FT /rpt_family="Alu" FT repeat_region 2589820..2590131 FT /rpt_family="Alu" FT repeat_region 2590132..2590327 FT /rpt_family="L1" FT repeat_region 2590339..2590479 FT /rpt_family="L1" FT repeat_region 2590501..2590591 FT /rpt_family="U13" FT misc_feature 2590523..2590525 FT /note="match to EST BI335238 (NID:g15019895)" FT repeat_region 2590592..2590887 FT /rpt_family="Alu" FT repeat_region 2590890..2590928 FT /rpt_family="(TA)n" FT repeat_region 2590929..2590955 FT /rpt_family="U13" FT repeat_region 2590958..2591020 FT /rpt_family="L1" FT repeat_region 2591043..2591340 FT /rpt_family="Alu" FT repeat_region 2591414..2591715 FT /rpt_family="L1" FT repeat_region 2591716..2591741 FT /rpt_family="(TA)n" FT repeat_region 2591742..2592051 FT /rpt_family="Alu" FT repeat_region 2592052..2592087 FT /rpt_family="L1" FT repeat_region 2592112..2592223 FT /rpt_family="Alu" FT repeat_region 2592378..2592677 FT /rpt_family="Alu" FT repeat_region 2592685..2592964 FT /rpt_family="Alu" FT repeat_region 2592971..2593229 FT /rpt_family="L1" FT repeat_region 2593280..2593580 FT /rpt_family="Alu" FT misc_feature 2593461..2593737 FT /note="match to EST AA077951 (NID:g1837425)" FT misc_feature 2593939..2594082 FT /note="match to EST BF726952 (NID:g12042863) by14e09.y1" FT /note="similar to EST BM555599 (NID:g18796181)" FT misc_feature 2593939..2594081 FT /note="match to EST AL529639 (NID:g12793132)" FT /note="match to EST AL602701 (NID:g15166207)" FT /note="match to EST BE247601 (NID:g9099358)" FT /note="match to EST BM149247 (NID:g17170689)" FT /note="match to EST AL520479 (NID:g12783972)" FT /note="similar to Homo sapiens EST BG829171 FT (NID:g14176758)" FT /note="match to EST AL528965 (NID:g12792458)" FT /note="match to EST AL559089 (NID:g12904244)" FT misc_feature 2593939..2594066 FT /note="match to EST BF913055 (NID:g12304513)" FT misc_feature 2594077..2594081 FT /note="match to EST BI918340 (NID:g16199851)" FT misc_feature 2594359..2594360 FT /note="similar to Homo sapiens EST BG829171 FT (NID:g14176758)" FT misc_feature 2594725..2595598 FT /note="CpG_island (%GC=70.5, o/e=0.80, #CpGs=82)" FT misc_feature 2594735..2594927 FT /note="similar to Homo sapiens EST BE560463 (NID:g9804183)" FT misc_feature 2595121..2595346 FT /note="match to EST BI918340 (NID:g16199851)" FT misc_feature 2595121..2595324 FT /note="match to EST AL529639 (NID:g12793132)" FT misc_feature 2595121..2595158 FT /note="match to EST AL602701 (NID:g15166207)" FT misc_feature 2595121..2595150 FT /note="match to EST BE247601 (NID:g9099358)" FT /note="match to EST BM149247 (NID:g17170689)" FT misc_feature 2595121..2595141 FT /note="match to EST AL520479 (NID:g12783972)" FT misc_feature 2595121..2595124 FT /note="match to EST AL528965 (NID:g12792458)" FT misc_feature 2595121..2595132 FT /note="match to EST AL559089 (NID:g12904244)" FT repeat_region 2595596..2595740 FT /rpt_family="Alu" FT repeat_region 2595741..2596054 FT /rpt_family="Alu" FT repeat_region 2596055..2596228 FT /rpt_family="Alu" FT repeat_region 2596383..2596406 FT /rpt_family="AT_rich" FT repeat_region 2596429..2596733 FT /rpt_family="Alu" FT repeat_region 2596937..2597114 FT /rpt_family="MIR" FT repeat_region 2597144..2597439 FT /rpt_family="Alu" FT repeat_region 2597440..2597602 FT /rpt_family="MER2_type" FT repeat_region 2597603..2597898 FT /rpt_family="Alu" FT repeat_region 2597899..2598075 FT /rpt_family="MER2_type" FT repeat_region 2598216..2598526 FT /rpt_family="Alu" FT misc_feature 2598655..2598851 FT /note="similar to EST BM549816 (NID:g18785536)" FT misc_feature 2598666..2598851 FT /note="match to EST AL119407 (NID:g5925306)" FT misc_feature 2598682..2598851 FT /note="match to EST BG717305 (NID:g13996492)" FT misc_feature 2598686..2598851 FT /note="match to EST BI562322 (NID:g15449636)" FT repeat_region 2598925..2598955 FT /rpt_family="GC_rich" FT misc_feature 2599056..2599154 FT /note="match to EST BI462602 (NID:g15253258)" FT misc_feature 2599074..2599154 FT /note="similar to EST BM563787 (NID:g18811014)" FT repeat_region 2599431..2599492 FT /rpt_family="L2" FT repeat_region 2599500..2599782 FT /rpt_family="Alu" FT repeat_region 2599783..2599895 FT /rpt_family="Alu" FT repeat_region 2599915..2600021 FT /rpt_family="L2" FT repeat_region 2600271..2600309 FT /rpt_family="Alu" FT repeat_region 2600310..2600613 FT /rpt_family="Alu" FT repeat_region 2600614..2600891 FT /rpt_family="Alu" FT repeat_region 2600901..2601056 FT /rpt_family="L1" FT repeat_region 2601057..2601354 FT /rpt_family="Alu" FT repeat_region 2601355..2602546 FT /rpt_family="L1" FT repeat_region 2602551..2602845 FT /rpt_family="Alu" FT repeat_region 2602877..2603009 FT /rpt_family="Alu" FT repeat_region 2603010..2603046 FT /rpt_family="(TG)n" FT repeat_region 2603047..2603141 FT /rpt_family="Alu" FT repeat_region 2603142..2603280 FT /rpt_family="L1" FT repeat_region 2603281..2603550 FT /rpt_family="Alu" FT repeat_region 2603551..2603561 FT /rpt_family="L1" FT repeat_region 2603562..2603859 FT /rpt_family="Alu" FT repeat_region 2603860..2603946 FT /rpt_family="L1" FT repeat_region 2603947..2604244 FT /rpt_family="Alu" FT repeat_region 2604245..2604505 FT /rpt_family="L1" FT repeat_region 2604510..2604615 FT /rpt_family="MaLR" FT repeat_region 2604703..2604797 FT /rpt_family="(TG)n" FT repeat_region 2604851..2604914 FT /rpt_family="(TG)n" FT misc_feature 2605024..2605303 FT /note="similar to Homo sapiens EST BE071694 (NID:g8416994)" FT repeat_region 2606084..2606321 FT /rpt_family="Alu" FT misc_feature 2606750..2606797 FT /note="similar to EST BM549816 (NID:g18785536)" FT misc_feature 2607698..2607700 FT /note="similar to Homo sapiens EST BE071694 (NID:g8416994)" FT repeat_region 2607738..2608050 FT /rpt_family="MER2_type" FT misc_feature 2608588..2608633 FT /note="match to EST BG717305 (NID:g13996492)" FT /note="similar to EST BM549816 (NID:g18785536)" FT misc_feature 2609240..2609367 FT /note="similar to Homo sapiens EST BF872291 FT (NID:g12262330)" FT repeat_region 2609674..2609712 FT /rpt_family="L2" FT repeat_region 2610657..2610676 FT /rpt_family="(TTTTC)n" FT repeat_region 2610686..2610952 FT /rpt_family="Alu" FT misc_feature 2611036..2611288 FT /note="match to EST BI462602 (NID:g15253258)" FT misc_feature 2611160..2611288 FT /note="similar to EST BM563787 (NID:g18811014)" FT /note="match to EST BI562322 (NID:g15449636)" FT /note="match to EST BG717305 (NID:g13996492)" FT /note="match to EST AL119407 (NID:g5925306)" FT /note="similar to EST BM549816 (NID:g18785536)" FT misc_feature 2611174..2611288 FT /note="match to EST AI698349 (NID:g4986249) tx63f04.x1" FT repeat_region 2611572..2611707 FT /rpt_family="MER1_type" FT misc_feature 2611826..2611960 FT /note="match to EST AI698349 (NID:g4986249) tx63f04.x1" FT /note="similar to EST BM563787 (NID:g18811014)" FT /note="match to EST BI462602 (NID:g15253258)" FT /note="match to EST BI562322 (NID:g15449636)" FT /note="match to EST BG717305 (NID:g13996492)" FT /note="match to EST AL119407 (NID:g5925306)" FT /note="similar to EST BM549816 (NID:g18785536)" FT misc_feature 2611929..2611960 FT /note="similar to EST BM553044 (NID:g18791427)" FT misc_feature 2612348..2612453 FT /note="similar to EST BM549816 (NID:g18785536)" FT repeat_region 2612348..2612477 FT /rpt_family="Alu" FT misc_feature 2613050..2613122 FT /note="similar to EST BM549816 (NID:g18785536)" FT misc_feature 2613052..2613107 FT /note="match to EST AI698349 (NID:g4986249) tx63f04.x1" FT misc_feature 2613052..2613122 FT /note="similar to EST BM553044 (NID:g18791427)" FT /note="similar to EST BM563787 (NID:g18811014)" FT /note="match to EST BI462602 (NID:g15253258)" FT /note="match to EST BI562322 (NID:g15449636)" FT /note="match to EST BG717305 (NID:g13996492)" FT /note="match to EST AL119407 (NID:g5925306)" FT repeat_region 2613474..2613673 FT /rpt_family="MIR" FT repeat_region 2613876..2613996 FT /rpt_family="CR1" FT repeat_region 2614053..2614232 FT /rpt_family="CR1" FT repeat_region 2614234..2615622 FT /rpt_family="L1" FT repeat_region 2616044..2616332 FT /rpt_family="Alu" FT misc_feature 2616220..2616312 FT /note="match to EST AL119407 (NID:g5925306)" FT misc_feature 2616534..2618014 FT /note="CpG_island (%GC=67.5, o/e=0.90, #CpGs=187)" FT repeat_region 2616599..2616740 FT /rpt_family="MER1_type" FT repeat_region 2616832..2617006 FT /rpt_family="(TG)n" FT repeat_region 2616897..2617071 FT /rpt_family="(CGTG)n" FT repeat_region 2617102..2617262 FT /rpt_family="(TG)n" FT repeat_region 2617151..2617631 FT /rpt_family="(CGTG)n" FT repeat_region 2617661..2617833 FT /rpt_family="(CGTG)n" FT misc_feature 2617876..2617970 FT /note="match to EST AL119407 (NID:g5925306)" FT misc_feature 2617876..2617989 FT /note="similar to EST BM553044 (NID:g18791427)" FT /note="similar to EST BM563787 (NID:g18811014)" FT /note="match to EST BI462602 (NID:g15253258)" FT /note="match to EST BI562322 (NID:g15449636)" FT /note="match to EST BG717305 (NID:g13996492)" FT /note="similar to EST BM549816 (NID:g18785536)" FT misc_feature 2618110..2618153 FT /note="match to EST BI462602 (NID:g15253258)" FT misc_feature 2618110..2618167 FT /note="match to EST BI562322 (NID:g15449636)" FT misc_feature 2618110..2618160 FT /note="similar to EST BM553044 (NID:g18791427)" FT /note="similar to EST BM563787 (NID:g18811014)" FT /note="match to EST BG717305 (NID:g13996492)" FT misc_feature 2618110..2618161 FT /note="similar to EST BM549816 (NID:g18785536)" FT repeat_region 2618441..2618691 FT /rpt_family="Alu" FT repeat_region 2619335..2619377 FT /rpt_family="(TG)n" FT repeat_region 2619382..2619667 FT /rpt_family="Alu" FT misc_feature 2619744..2619884 FT /note="match to EST BI462472 (NID:g15253128)" FT repeat_region 2619963..2620258 FT /rpt_family="Alu" FT misc_feature 2620037..2620579 FT /note="match to EST AA166630 (NID:g1745094) zq39a02.r1" FT repeat_region 2620590..2620776 FT /rpt_family="Alu" FT repeat_region 2620829..2621139 FT /rpt_family="Alu" FT repeat_region 2621193..2621317 FT /rpt_family="Alu" FT repeat_region 2621343..2621644 FT /rpt_family="Alu" FT misc_feature 2621652..2622154 FT /note="similar to Homo sapiens EST BG992046 FT (NID:g14396116)" FT misc_feature 2622207..2622284 FT /note="similar to Mus musculus EST BI688410 FT (NID:g15651039)" FT misc_feature 2622214..2622284 FT /note="match to EST BI462472 (NID:g15253128)" FT /note="similar to EST BM553044 (NID:g18791427)" FT /note="similar to EST BM563787 (NID:g18811014)" FT /note="match to EST BG717305 (NID:g13996492)" FT misc_feature 2623271..2623343 FT /note="similar to Mus musculus EST BI688410 FT (NID:g15651039)" FT /note="match to EST BI462472 (NID:g15253128)" FT /note="similar to EST BM553044 (NID:g18791427)" FT /note="similar to EST BM563787 (NID:g18811014)" FT repeat_region 2623357..2623525 FT /rpt_family="G-rich" FT repeat_region 2623422..2623636 FT /rpt_family="(CGGGG)n" FT misc_feature 2623870..2624300 FT /note="match to EST BI462472 (NID:g15253128)" FT misc_feature 2623870..2623919 FT /note="similar to Mus musculus EST BI688410 FT (NID:g15651039)" FT /note="similar to EST BM553044 (NID:g18791427)" FT /note="similar to EST BM563787 (NID:g18811014)" FT repeat_region 2624474..2624513 FT /rpt_family="MER1_type" FT repeat_region 2624552..2624588 FT /rpt_family="tRNA-Val-GTG" FT repeat_region 2624593..2624682 FT /rpt_family="MER2_type" FT repeat_region 2624683..2624971 FT /rpt_family="Alu" FT repeat_region 2624972..2625478 FT /rpt_family="MER2_type" FT repeat_region 2625479..2625742 FT /rpt_family="MER1_type" FT misc_feature 2625842..2626005 FT /note="similar to Mus musculus EST BI688410 FT (NID:g15651039)" FT /note="similar to EST BM553044 (NID:g18791427)" FT /note="similar to EST BM563787 (NID:g18811014)" FT repeat_region 2626149..2626418 FT /rpt_family="L2" FT repeat_region 2626628..2627093 FT /rpt_family="L2" FT repeat_region 2627107..2627299 FT /rpt_family="L2" FT misc_feature 2627456..2627528 FT /note="similar to Mus musculus EST BI688410 FT (NID:g15651039)" FT misc_feature 2627456..2627511 FT /note="similar to EST BM553044 (NID:g18791427)" FT /note="similar to EST BM563787 (NID:g18811014)" FT repeat_region 2627977..2628286 FT /rpt_family="Alu" FT repeat_region 2628289..2628598 FT /rpt_family="Alu" FT repeat_region 2628720..2629010 FT /rpt_family="Alu" FT misc_feature 2629209..2629678 FT /note="match to EST AI791135 (NID:g5338851) ab92c11.x5" FT misc_feature 2629541..2629744 FT /note="similar to EST BM553044 (NID:g18791427)" FT misc_feature 2629541..2629629 FT /note="similar to EST BM563787 (NID:g18811014)" FT misc_feature 2629582..2629741 FT /note="match to EST BG958222 (NID:g14376393)" FT repeat_region 2630117..2630402 FT /rpt_family="Alu" FT repeat_region 2630605..2630912 FT /rpt_family="Alu" FT repeat_region 2631117..2631227 FT /rpt_family="MER1_type" FT repeat_region 2631251..2631553 FT /rpt_family="Alu" FT repeat_region 2631555..2631720 FT /rpt_family="Alu" FT misc_feature 2632656..2632760 FT /note="similar to EST BM553044 (NID:g18791427)" FT misc_feature 2632687..2632760 FT /note="match to EST BI194550 (NID:g14649570)" FT repeat_region 2632695..2632750 FT /rpt_family="GA-rich" FT repeat_region 2633093..2633522 FT /rpt_family="L1" FT misc_feature 2633426..2633427 FT /note="match to EST BM007814 (NID:g16522168)" FT repeat_region 2633614..2633915 FT /rpt_family="Alu" FT misc_feature 2633759..2634579 FT /note="match to EST BM007814 (NID:g16522168)" FT misc_feature 2633891..2634073 FT /note="match to EST BG957564 (NID:g14375735)" FT repeat_region 2634110..2634175 FT /rpt_family="Alu" FT repeat_region 2634200..2634314 FT /rpt_family="L2" FT misc_feature 2634520..2634610 FT /note="match to EST BI194550 (NID:g14649570)" FT misc_feature 2634677..2634679 FT /note="match to EST BG957564 (NID:g14375735)" FT repeat_region 2635765..2635925 FT /rpt_family="Alu" FT repeat_region 2635949..2635970 FT /rpt_family="(GA)n" FT repeat_region 2635971..2636105 FT /rpt_family="L1" FT misc_feature 2636533..2636771 FT /note="match to EST BI826915 (NID:g15938465)" FT repeat_region 2636638..2637073 FT /rpt_family="ERVL" FT repeat_region 2637301..2637601 FT /rpt_family="Alu" FT misc_feature 2638099..2638266 FT /note="match to EST BI826915 (NID:g15938465)" FT /note="match to EST BI194550 (NID:g14649570)" FT repeat_region 2638310..2638409 FT /rpt_family="ERVL" FT repeat_region 2638829..2639129 FT /rpt_family="Alu" FT repeat_region 2639130..2639415 FT /rpt_family="Alu" FT repeat_region 2639420..2639727 FT /rpt_family="Alu" FT repeat_region 2639807..2639919 FT /rpt_family="L1" FT repeat_region complement(2690265..2690586) FT /rpt_family="L2" FT repeat_region complement(2689932..2690223) FT /rpt_family="Alu" FT repeat_region complement(2688047..2688163) FT /rpt_family="MIR" FT misc_feature complement(2686574..2687306) FT /note="CpG_island (%GC=73.1, o/e=0.73, #CpGs=72)" FT repeat_region complement(2686659..2686748) FT /rpt_family="(CCCCG)n" FT repeat_region complement(2685957..2686008) FT /rpt_family="MIR" FT repeat_region complement(2685654..2685948) FT /rpt_family="Alu" FT repeat_region complement(2682708..2683007) FT /rpt_family="Alu" FT repeat_region complement(2682415..2682707) FT /rpt_family="Alu" FT repeat_region complement(2682370..2682400) FT /rpt_family="(A)n" FT repeat_region complement(2682202..2682369) FT /rpt_family="Alu" FT repeat_region complement(2681894..2682201) FT /rpt_family="Alu" FT repeat_region complement(2681749..2681893) FT /rpt_family="Alu" FT repeat_region complement(2675626..2675707) FT /rpt_family="CR1" FT repeat_region complement(2675447..2675552) FT /rpt_family="L2" FT repeat_region complement(2675207..2675238) FT /rpt_family="L2" FT repeat_region complement(2674332..2674474) FT /rpt_family="MIR" FT misc_feature complement(2671157..2671937) FT /note="CpG_island (%GC=74.5, o/e=0.86, #CpGs=93)" FT repeat_region complement(2671615..2671667) FT /rpt_family="(CTCGG)n" FT repeat_region complement(2671529..2671587) FT /rpt_family="(CCCCCG)n" FT repeat_region complement(2670847..2670949) FT /rpt_family="MIR" FT repeat_region complement(2670535..2670822) FT /rpt_family="Alu" FT repeat_region complement(2668888..2669198) FT /rpt_family="Alu" FT repeat_region complement(2668789..2668875) FT /rpt_family="MaLR" FT repeat_region complement(2668521..2668788) FT /rpt_family="Alu" FT repeat_region complement(2668234..2668520) FT /rpt_family="Alu" FT repeat_region complement(2667876..2668233) FT /rpt_family="MaLR" FT repeat_region complement(2666827..2667312) FT /rpt_family="CT-rich" FT repeat_region complement(2665673..2665997) FT /rpt_family="Alu" FT repeat_region complement(2665515..2665648) FT /rpt_family="Alu" FT repeat_region complement(2665215..2665511) FT /rpt_family="Alu" FT misc_feature complement(2665238..2665508) FT /note="CpG_island (%GC=60.9, o/e=0.77, #CpGs=20)" FT repeat_region complement(2665083..2665167) FT /rpt_family="MIR" FT repeat_region complement(2664994..2665066) FT /rpt_family="MIR" FT repeat_region complement(2664792..2664963) FT /rpt_family="L1" FT repeat_region complement(2664484..2664791) FT /rpt_family="Alu" FT repeat_region complement(2663889..2663966) FT /rpt_family="MIR" FT repeat_region complement(2662232..2662366) FT /rpt_family="GA-rich" FT repeat_region complement(2662100..2662220) FT /rpt_family="(CTGGGG)n" FT repeat_region complement(2661205..2661490) FT /rpt_family="Alu" FT repeat_region complement(2660863..2660998) FT /rpt_family="L2" FT repeat_region complement(2660364..2660639) FT /rpt_family="Alu" FT repeat_region complement(2660038..2660335) FT /rpt_family="Alu" FT repeat_region complement(2659644..2659769) FT /rpt_family="Alu" FT repeat_region complement(2659595..2659643) FT /rpt_family="Alu" FT repeat_region complement(2659288..2659594) FT /rpt_family="Alu" FT repeat_region complement(2659120..2659287) FT /rpt_family="Alu" FT repeat_region complement(2658411..2658702) FT /rpt_family="Alu" FT repeat_region complement(2657953..2658048) FT /rpt_family="(TG)n" FT repeat_region complement(2657783..2657941) FT /rpt_family="(TG)n" FT repeat_region complement(2657660..2657761) FT /rpt_family="(TG)n" FT repeat_region complement(2655946..2656076) FT /rpt_family="Alu" FT repeat_region complement(2655858..2655944) FT /rpt_family="Alu" FT repeat_region complement(2655567..2655848) FT /rpt_family="Alu" FT repeat_region complement(2655432..2655531) FT /rpt_family="Alu" FT repeat_region complement(2655152..2655431) FT /rpt_family="Alu" FT repeat_region complement(2654976..2655151) FT /rpt_family="Alu" FT repeat_region complement(2654930..2654961) FT /rpt_family="(CA)n" FT repeat_region complement(2651002..2651120) FT /rpt_family="CR1" FT repeat_region complement(2650745..2650782) FT /rpt_family="(CAGCC)n" FT repeat_region complement(2648947..2649077) FT /rpt_family="Alu" FT repeat_region complement(2647266..2647413) FT /rpt_family="MIR" FT misc_feature complement(2645525..2645765) FT /note="CpG_island (%GC=71.0, o/e=0.63, #CpGs=19)" FT repeat_region complement(2644973..2645309) FT /rpt_family="Alu" FT repeat_region complement(2643919..2644044) FT /rpt_family="Alu" FT repeat_region complement(2643622..2643917) FT /rpt_family="Alu" FT repeat_region complement(2642957..2643026) FT /rpt_family="L2" FT repeat_region complement(2642326..2642448) FT /rpt_family="L2" FT repeat_region complement(2641183..2641482) FT /rpt_family="Alu" FT repeat_region complement(2900757..2901019) FT /rpt_family="Alu" FT repeat_region complement(2900430..2900752) FT /rpt_family="ERVL" FT repeat_region complement(2900238..2900412) FT /rpt_family="MaLR" FT repeat_region complement(2899916..2900196) FT /rpt_family="Alu" FT repeat_region complement(2899585..2899834) FT /rpt_family="MIR" FT repeat_region complement(2899210..2899507) FT /rpt_family="Alu" FT repeat_region complement(2899045..2899206) FT /rpt_family="L1" FT repeat_region complement(2899097..2899198) FT /rpt_family="L1" FT repeat_region complement(2898910..2899036) FT /rpt_family="MaLR" FT repeat_region complement(2898885..2898909) FT /rpt_family="(ATTG)n" FT repeat_region complement(2898602..2898884) FT /rpt_family="Alu" FT repeat_region complement(2898480..2898601) FT /rpt_family="MaLR" FT repeat_region complement(2898198..2898225) FT /rpt_family="MIR" FT repeat_region complement(2897811..2898120) FT /rpt_family="Alu" FT repeat_region complement(2897513..2897803) FT /rpt_family="Alu" FT repeat_region complement(2896737..2897041) FT /rpt_family="Alu" FT repeat_region complement(2896595..2896735) FT /rpt_family="MaLR" FT repeat_region complement(2896347..2896531) FT /rpt_family="(TG)n" FT repeat_region complement(2896106..2896196) FT /rpt_family="MaLR" FT repeat_region complement(2895630..2895922) FT /rpt_family="Alu" FT repeat_region complement(2895332..2895564) FT /rpt_family="Alu" FT repeat_region complement(2894925..2895098) FT /rpt_family="Alu" FT repeat_region complement(2894539..2894850) FT /rpt_family="Alu" FT repeat_region complement(2894164..2894531) FT /rpt_family="L1" FT repeat_region complement(2894117..2894159) FT /rpt_family="MaLR" FT repeat_region complement(2893982..2894116) FT /rpt_family="Alu" FT repeat_region complement(2893677..2893981) FT /rpt_family="Alu" FT repeat_region complement(2893509..2893676) FT /rpt_family="Alu" FT repeat_region complement(2893200..2893508) FT /rpt_family="MaLR" FT repeat_region complement(2892702..2893146) FT /rpt_family="MaLR" FT repeat_region complement(2892556..2892598) FT /rpt_family="L1" FT repeat_region complement(2892253..2892555) FT /rpt_family="Alu" FT repeat_region complement(2891989..2892252) FT /rpt_family="L1" FT repeat_region complement(2891710..2891988) FT /rpt_family="Alu" FT repeat_region complement(2891681..2891709) FT /rpt_family="L1" FT repeat_region complement(2891370..2891677) FT /rpt_family="Alu" FT repeat_region complement(2891118..2891344) FT /rpt_family="L1" FT repeat_region complement(2890836..2891116) FT /rpt_family="L1" FT repeat_region complement(2890526..2890835) FT /rpt_family="Alu" FT repeat_region complement(2890510..2890525) FT /rpt_family="L1" FT repeat_region complement(2890266..2890477) FT /rpt_family="(ATGGTG)n" FT repeat_region complement(2889897..2890254) FT /rpt_family="(ATGGTG)n" FT repeat_region complement(2889589..2889872) FT /rpt_family="(ATGGTG)n" FT repeat_region complement(2889304..2889365) FT /rpt_family="L2" FT repeat_region complement(2888899..2889269) FT /rpt_family="MaLR" FT repeat_region complement(2888185..2888469) FT /rpt_family="Alu" FT repeat_region complement(2887807..2888007) FT /rpt_family="MIR" FT repeat_region complement(2887091..2887396) FT /rpt_family="Alu" FT repeat_region complement(2886909..2887015) FT /rpt_family="Alu" FT repeat_region complement(2886347..2886637) FT /rpt_family="Alu" FT repeat_region complement(2886300..2886346) FT /rpt_family="Alu" FT repeat_region complement(2885971..2886281) FT /rpt_family="Alu" FT repeat_region complement(2885628..2885793) FT /rpt_family="Alu" FT repeat_region complement(2885075..2885603) FT /rpt_family="L1" FT repeat_region complement(2885016..2885078) FT /rpt_family="L1" FT repeat_region complement(2884920..2884976) FT /rpt_family="MER1_type" FT repeat_region complement(2884616..2884790) FT /rpt_family="MIR" FT misc_feature complement(2883289..2884314) FT /note="CpG_island (%GC=74.4, o/e=0.95, #CpGs=142)" FT repeat_region complement(2883955..2884000) FT /rpt_family="GC_rich" FT repeat_region complement(2883805..2883838) FT /rpt_family="GC_rich" FT gene complement(2770815..2883795) FT /gene="GNA12" FT mRNA complement(join(2770815..2771384,2773085..2773135, FT 2834562..2834777,2883487..2883795)) FT /gene="GNA12" FT CDS complement(join(2770815..2771384,2773085..2773135, FT 2834562..2834777,2883487..2883795)) FT /codon_start=1 FT /gene="GNA12" FT /product="unknown" FT /note="Homo sapiens guanine nucleotide binding protein (G FT protein) alpha 12 (GNA12), mRNA.; H_GS165O14.1 This gene FT was based on gi(6680032)" FT /protein_id="AAP21870.1" FT /translation="MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDA FT LLARERRAVRRLVKILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKG FT SRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGI FT REAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIP FT FKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIV FT NNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRR FT NRSKPLFHHFTTAIDTENVRFVFHAVKDTILQENLKDIMLQ" FT repeat_region complement(2883705..2883757) FT /rpt_family="GC_rich" FT repeat_region complement(2883392..2883434) FT /rpt_family="GC_rich" FT repeat_region complement(2882996..2883285) FT /rpt_family="Alu" FT repeat_region complement(2882650..2882764) FT /rpt_family="Alu" FT repeat_region complement(2882351..2882647) FT /rpt_family="L1" FT repeat_region complement(2881949..2882231) FT /rpt_family="Alu" FT repeat_region complement(2881760..2881813) FT /rpt_family="CT-rich" FT repeat_region complement(2881646..2881759) FT /rpt_family="L1" FT repeat_region complement(2880777..2880900) FT /rpt_family="Alu" FT repeat_region complement(2880227..2880512) FT /rpt_family="Alu" FT repeat_region complement(2879915..2880014) FT /rpt_family="MIR" FT repeat_region complement(2879645..2879908) FT /rpt_family="L1" FT repeat_region complement(2879361..2879644) FT /rpt_family="Alu" FT repeat_region complement(2879318..2879360) FT /rpt_family="L1" FT repeat_region complement(2879023..2879317) FT /rpt_family="Alu" FT repeat_region complement(2878872..2879022) FT /rpt_family="Alu" FT repeat_region complement(2878221..2878871) FT /rpt_family="L1" FT repeat_region complement(2877932..2878220) FT /rpt_family="Alu" FT repeat_region complement(2876960..2877931) FT /rpt_family="L1" FT repeat_region complement(2876589..2876824) FT /rpt_family="L1" FT repeat_region complement(2876276..2876588) FT /rpt_family="Alu" FT repeat_region complement(2875917..2876275) FT /rpt_family="L1" FT repeat_region complement(2874266..2874586) FT /rpt_family="MER2_type" FT repeat_region complement(2873898..2874165) FT /rpt_family="L2" FT repeat_region complement(2871921..2872012) FT /rpt_family="L2" FT repeat_region complement(2871035..2871336) FT /rpt_family="Alu" FT misc_feature complement(2871098..2871334) FT /gene="GNA12" FT /note="CpG_island (%GC=58.6, o/e=0.89, #CpGs=17)" FT repeat_region complement(2870667..2870722) FT /rpt_family="L2" FT repeat_region complement(2870438..2870608) FT /rpt_family="Alu" FT repeat_region complement(2869135..2869565) FT /rpt_family="L1" FT repeat_region complement(2868408..2868734) FT /rpt_family="Alu" FT repeat_region complement(2867985..2868151) FT /rpt_family="Alu" FT repeat_region complement(2867547..2867572) FT /rpt_family="AT_rich" FT repeat_region complement(2866747..2867047) FT /rpt_family="L1" FT repeat_region complement(2866039..2866746) FT /rpt_family="L1" FT repeat_region complement(2865731..2866038) FT /rpt_family="Alu" FT repeat_region complement(2865515..2865730) FT /rpt_family="L1" FT repeat_region complement(2864862..2865056) FT /rpt_family="ERVL" FT repeat_region complement(2864096..2864298) FT /rpt_family="L2" FT repeat_region complement(2863727..2863969) FT /rpt_family="L2" FT repeat_region complement(2863332..2863357) FT /rpt_family="AT_rich" FT repeat_region complement(2862214..2862459) FT /rpt_family="Alu" FT repeat_region complement(2862097..2862186) FT /rpt_family="Alu" FT repeat_region complement(2861539..2861654) FT /rpt_family="L2" FT repeat_region complement(2860379..2860673) FT /rpt_family="Alu" FT repeat_region complement(2860061..2860177) FT /rpt_family="Alu" FT repeat_region complement(2859189..2860039) FT /rpt_family="L1" FT repeat_region complement(2858616..2859111) FT /rpt_family="MaLR" FT repeat_region complement(2858115..2858421) FT /rpt_family="Alu" FT repeat_region complement(2857851..2858051) FT /rpt_family="MER1_type" FT repeat_region complement(2857190..2857334) FT /rpt_family="L2" FT repeat_region complement(2857047..2857183) FT /rpt_family="L2" FT repeat_region complement(2856735..2857046) FT /rpt_family="Alu" FT repeat_region complement(2856516..2856734) FT /rpt_family="L2" FT repeat_region complement(2856356..2856494) FT /rpt_family="MIR" FT repeat_region complement(2855875..2856164) FT /rpt_family="Alu" FT repeat_region complement(2855592..2855792) FT /rpt_family="L1" FT repeat_region complement(2855117..2855448) FT /rpt_family="ERVL" FT repeat_region complement(2854676..2855064) FT /rpt_family="L2" FT repeat_region complement(2854291..2854393) FT /rpt_family="CR1" FT repeat_region complement(2853427..2853899) FT /rpt_family="ERVL" FT repeat_region complement(2852956..2852977) FT /rpt_family="AT_rich" FT repeat_region complement(2852585..2852805) FT /rpt_family="Alu" FT repeat_region complement(2852271..2852331) FT /rpt_family="(ATGTG)n" FT repeat_region complement(2851982..2852268) FT /rpt_family="Alu" FT repeat_region complement(2850251..2850562) FT /rpt_family="Alu" FT repeat_region complement(2849743..2850086) FT /rpt_family="MaLR" FT repeat_region complement(2849236..2849288) FT /rpt_family="ERV1" FT repeat_region complement(2848521..2848903) FT /rpt_family="L2" FT repeat_region complement(2848241..2848533) FT /rpt_family="L2" FT repeat_region complement(2846311..2846643) FT /rpt_family="L1" FT repeat_region complement(2846140..2846285) FT /rpt_family="L1" FT repeat_region complement(2845831..2846121) FT /rpt_family="Alu" FT repeat_region complement(2845511..2845797) FT /rpt_family="MER1_type" FT repeat_region complement(2845039..2845140) FT /rpt_family="Alu" FT repeat_region complement(2844844..2844994) FT /rpt_family="MIR" FT repeat_region complement(2844412..2844551) FT /rpt_family="Alu" FT repeat_region complement(2843427..2843459) FT /rpt_family="(TTTTG)n" FT repeat_region complement(2840686..2840796) FT /rpt_family="MER1_type" FT repeat_region complement(2839305..2840225) FT /rpt_family="L1" FT repeat_region complement(2839228..2839275) FT /rpt_family="L1" FT repeat_region complement(2839212..2839253) FT /rpt_family="L1" FT repeat_region complement(2838932..2839211) FT /rpt_family="Alu" FT repeat_region complement(2837563..2838931) FT /rpt_family="L1" FT repeat_region complement(2837094..2837177) FT /rpt_family="L1" FT repeat_region complement(2836791..2837078) FT /rpt_family="Alu" FT repeat_region complement(2835792..2836059) FT /rpt_family="MER2_type" FT repeat_region complement(2835649..2835759) FT /rpt_family="Alu" FT repeat_region complement(2835451..2835641) FT /rpt_family="Alu" FT repeat_region complement(2834985..2835291) FT /rpt_family="Alu" FT repeat_region complement(2833547..2833842) FT /rpt_family="L1" FT repeat_region complement(2833239..2833543) FT /rpt_family="Alu" FT repeat_region complement(2832450..2833134) FT /rpt_family="L1" FT repeat_region complement(2831894..2832056) FT /rpt_family="MIR" FT repeat_region complement(2831856..2831887) FT /rpt_family="(TTCA)n" FT repeat_region complement(2831756..2831854) FT /rpt_family="L2" FT repeat_region complement(2830735..2830771) FT /rpt_family="AT_rich" FT repeat_region complement(2830321..2830638) FT /rpt_family="Alu" FT repeat_region complement(2829894..2830039) FT /rpt_family="Alu" FT repeat_region complement(2828767..2829068) FT /rpt_family="Alu" FT misc_feature complement(2828722..2829065) FT /gene="GNA12" FT /note="CpG_island (%GC=59.0, o/e=0.90, #CpGs=28)" FT repeat_region complement(2828456..2828751) FT /rpt_family="Alu" FT repeat_region complement(2827935..2828089) FT /rpt_family="MaLR" FT repeat_region complement(2827507..2827801) FT /rpt_family="Alu" FT repeat_region complement(2827395..2827458) FT /rpt_family="MaLR" FT repeat_region complement(2826871..2827174) FT /rpt_family="L2" FT repeat_region complement(2826011..2826113) FT /rpt_family="L1" FT repeat_region complement(2825718..2825963) FT /rpt_family="L1" FT repeat_region complement(2825404..2825707) FT /rpt_family="Alu" FT repeat_region complement(2825353..2825403) FT /rpt_family="L1" FT repeat_region complement(2824939..2825053) FT /rpt_family="MIR" FT repeat_region complement(2824069..2824293) FT /rpt_family="L1" FT repeat_region complement(2823749..2824051) FT /rpt_family="Alu" FT repeat_region complement(2823724..2823746) FT /rpt_family="AT_rich" FT repeat_region complement(2823284..2823618) FT /rpt_family="Alu" FT repeat_region complement(2822347..2822958) FT /rpt_family="L1" FT repeat_region complement(2822118..2822338) FT /rpt_family="L1" FT repeat_region complement(2821480..2821935) FT /rpt_family="L1" FT repeat_region complement(2821450..2821498) FT /rpt_family="L1" FT repeat_region complement(2821204..2821405) FT /rpt_family="MER1_type" FT repeat_region complement(2821084..2821112) FT /rpt_family="L1" FT repeat_region complement(2821042..2821083) FT /rpt_family="(CA)n" FT repeat_region complement(2820988..2821041) FT /rpt_family="L1" FT repeat_region complement(2820962..2820987) FT /rpt_family="(TG)n" FT repeat_region complement(2820832..2820961) FT /rpt_family="L1" FT repeat_region complement(2820073..2820700) FT /rpt_family="L1" FT repeat_region complement(2819999..2820026) FT /rpt_family="AT_rich" FT repeat_region complement(2819729..2819986) FT /rpt_family="L1" FT repeat_region complement(2819683..2819727) FT /rpt_family="(TA)n" FT repeat_region complement(2819237..2819530) FT /rpt_family="Alu" FT repeat_region complement(2818998..2819151) FT /rpt_family="Alu" FT repeat_region complement(2818711..2818997) FT /rpt_family="Alu" FT repeat_region complement(2818640..2818710) FT /rpt_family="Alu" FT repeat_region complement(2817072..2817428) FT /rpt_family="MaLR" FT repeat_region complement(2817011..2817067) FT /rpt_family="ERV1" FT repeat_region complement(2816600..2817009) FT /rpt_family="ERV1" FT repeat_region complement(2816438..2816599) FT /rpt_family="Alu" FT repeat_region complement(2815871..2816437) FT /rpt_family="ERV1" FT repeat_region complement(2815732..2815868) FT /rpt_family="Alu" FT repeat_region complement(2815565..2815684) FT /rpt_family="ERV1" FT repeat_region complement(2813951..2814221) FT /rpt_family="L2" FT repeat_region complement(2813877..2813927) FT /rpt_family="(TA)n" FT repeat_region complement(2813218..2813876) FT /rpt_family="L1" FT repeat_region complement(2812916..2813217) FT /rpt_family="Alu" FT repeat_region complement(2812905..2812915) FT /rpt_family="L1" FT repeat_region complement(2812213..2812904) FT /rpt_family="L1" FT repeat_region complement(2811915..2812212) FT /rpt_family="Alu" FT repeat_region complement(2811783..2811914) FT /rpt_family="L1" FT repeat_region complement(2810979..2811782) FT /rpt_family="L1" FT repeat_region complement(2810959..2811044) FT /rpt_family="L1" FT repeat_region complement(2810643..2810958) FT /rpt_family="Alu" FT repeat_region complement(2810623..2810642) FT /rpt_family="L1" FT repeat_region complement(2810273..2810349) FT /rpt_family="T-rich" FT repeat_region complement(2810109..2810269) FT /rpt_family="Alu" FT repeat_region complement(2809834..2809961) FT /rpt_family="AcHobo" FT repeat_region complement(2809397..2809562) FT /rpt_family="L1" FT repeat_region complement(2809083..2809396) FT /rpt_family="Alu" FT repeat_region complement(2808889..2809082) FT /rpt_family="L1" FT repeat_region complement(2808565..2808837) FT /rpt_family="Alu" FT repeat_region complement(2808302..2808330) FT /rpt_family="(TTTTG)n" FT repeat_region complement(2807781..2807849) FT /rpt_family="MER2_type" FT repeat_region complement(2807488..2807780) FT /rpt_family="Alu" FT repeat_region complement(2807318..2807487) FT /rpt_family="MER2_type" FT repeat_region complement(2807079..2807196) FT /rpt_family="L1" FT repeat_region complement(2806320..2807058) FT /rpt_family="L1" FT repeat_region complement(2806022..2806319) FT /rpt_family="Alu" FT repeat_region complement(2805586..2806021) FT /rpt_family="L1" FT repeat_region complement(2805251..2805575) FT /rpt_family="Alu" FT repeat_region complement(2804785..2805092) FT /rpt_family="Alu" FT repeat_region complement(2803703..2804014) FT /rpt_family="Alu" FT repeat_region complement(2802826..2802865) FT /rpt_family="(TG)n" FT misc_feature complement(2802441..2802698) FT /gene="GNA12" FT /note="CpG_island (%GC=70.2, o/e=0.67, #CpGs=20)" FT repeat_region complement(2800848..2800919) FT /rpt_family="MIR" FT repeat_region complement(2799115..2799208) FT /rpt_family="L1" FT repeat_region complement(2798951..2799111) FT /rpt_family="MIR" FT repeat_region complement(2798839..2798937) FT /rpt_family="L1" FT repeat_region complement(2798498..2798838) FT /rpt_family="Alu" FT repeat_region complement(2798331..2798497) FT /rpt_family="L1" FT repeat_region complement(2798249..2798309) FT /rpt_family="MER1_type" FT repeat_region complement(2798103..2798273) FT /rpt_family="MaLR" FT repeat_region complement(2797912..2798062) FT /rpt_family="MER1_type" FT repeat_region complement(2797878..2797929) FT /rpt_family="Alu" FT repeat_region complement(2797817..2797864) FT /rpt_family="MER1_type" FT repeat_region complement(2796977..2797339) FT /rpt_family="MaLR" FT repeat_region complement(2796764..2796976) FT /rpt_family="Alu" FT repeat_region complement(2796720..2796763) FT /rpt_family="MaLR" FT repeat_region complement(2796470..2796710) FT /rpt_family="Alu" FT repeat_region complement(2796317..2796449) FT /rpt_family="MaLR" FT repeat_region complement(2796264..2796309) FT /rpt_family="L1" FT repeat_region complement(2796034..2796263) FT /rpt_family="Alu" FT repeat_region complement(2795413..2795894) FT /rpt_family="L1" FT repeat_region complement(2794387..2795390) FT /rpt_family="L1" FT repeat_region complement(2794095..2794386) FT /rpt_family="Alu" FT repeat_region complement(2793674..2794094) FT /rpt_family="L1" FT repeat_region complement(2793071..2793377) FT /rpt_family="L1" FT repeat_region complement(2792789..2793070) FT /rpt_family="Alu" FT repeat_region complement(2792370..2792788) FT /rpt_family="L1" FT repeat_region complement(2791048..2792348) FT /rpt_family="L1" FT repeat_region complement(2790740..2791047) FT /rpt_family="Alu" FT repeat_region complement(2790606..2790739) FT /rpt_family="L1" FT repeat_region complement(2790416..2790582) FT /rpt_family="L1" FT repeat_region complement(2790031..2790340) FT /rpt_family="MER2_type" FT repeat_region complement(2789776..2789972) FT /rpt_family="L1" FT repeat_region complement(2789304..2789749) FT /rpt_family="L1" FT repeat_region complement(2782649..2783182) FT /rpt_family="L1" FT repeat_region complement(2782329..2782604) FT /rpt_family="L1" FT repeat_region complement(2782235..2782280) FT /rpt_family="L1" FT repeat_region complement(2782082..2782210) FT /rpt_family="L1" FT repeat_region complement(2781651..2781949) FT /rpt_family="Alu" FT repeat_region complement(2781599..2781647) FT /rpt_family="L1" FT repeat_region complement(2781225..2781436) FT /rpt_family="L1" FT repeat_region complement(2780814..2781006) FT /rpt_family="Alu" FT repeat_region complement(2780404..2780718) FT /rpt_family="Alu" FT repeat_region complement(2779863..2780221) FT /rpt_family="MaLR" FT repeat_region complement(2779606..2779832) FT /rpt_family="L1" FT repeat_region complement(2779312..2779605) FT /rpt_family="Alu" FT repeat_region complement(2778805..2779311) FT /rpt_family="L1" FT repeat_region complement(2777994..2778409) FT /rpt_family="L1" FT repeat_region complement(2777775..2777899) FT /rpt_family="Alu" FT repeat_region complement(2776911..2777222) FT /rpt_family="Alu" FT misc_feature complement(2774445..2774655) FT /gene="GNA12" FT /note="CpG_island (%GC=69.2, o/e=0.70, #CpGs=16)" FT repeat_region complement(2772258..2772694) FT /rpt_family="L1" FT repeat_region complement(2771904..2772210) FT /rpt_family="Alu" FT gene complement(2768193..2769413) FT /gene="WUGSC:H_GS165O14.4" FT mRNA complement(2768193..2769413) FT /gene="WUGSC:H_GS165O14.4" FT gene complement(2768710..2769006) FT /gene="WUGSC:H_GS165O14.2" FT CDS complement(2768710..2769006) FT /codon_start=1 FT /gene="WUGSC:H_GS165O14.2" FT /product="unknown" FT /note="Homo sapiens, clone MGC:15932 IMAGE:3536596, mRNA, FT complete cds.; H_GS165O14.2 This gene was based on FT gi(14495690)" FT /protein_id="AAP21871.1" FT /translation="MSADDHVLKEKESSWWGPRGGLRSHLQSATVTRSPVRSVVSFVCL FT LGQLSLCLLCVLESRAQRKCKRVLRQRGEPLRGAVGDSSAVIRVAGELFETPS" FT repeat_region complement(2767641..2767662) FT /rpt_family="(T)n" FT repeat_region complement(2767400..2767627) FT /rpt_family="Alu" FT repeat_region complement(2767021..2767289) FT /rpt_family="Alu" FT repeat_region complement(2766715..2767013) FT /rpt_family="Alu" FT repeat_region complement(2766008..2766156) FT /rpt_family="MER1_type" FT repeat_region complement(2763552..2763852) FT /rpt_family="Alu" FT repeat_region complement(2762613..2762652) FT /rpt_family="(TTTTA)n" FT repeat_region complement(2762324..2762609) FT /rpt_family="Alu" FT repeat_region complement(2761909..2762204) FT /rpt_family="Alu" FT misc_feature complement(2761937..2762152) FT /note="CpG_island (%GC=60.2, o/e=0.71, #CpGs=15)" FT repeat_region complement(2761072..2761364) FT /rpt_family="Alu" FT repeat_region complement(2760350..2760612) FT /rpt_family="Alu" FT repeat_region complement(2760035..2760334) FT /rpt_family="Alu" FT repeat_region complement(2759318..2759614) FT /rpt_family="Alu" FT misc_feature complement(2758005..2758257) FT /note="CpG_island (%GC=64.0, o/e=1.05, #CpGs=21)" FT repeat_region complement(2754707..2754880) FT /rpt_family="MaLR" FT repeat_region complement(2754228..2754459) FT /rpt_family="MaLR" FT repeat_region complement(2753556..2753726) FT /rpt_family="L1" FT repeat_region complement(2752622..2752886) FT /rpt_family="Alu" FT repeat_region complement(2751400..2751695) FT /rpt_family="Alu" FT repeat_region complement(2751359..2751387) FT /rpt_family="AT_rich" FT repeat_region complement(2751246..2751348) FT /rpt_family="Alu" FT repeat_region complement(2750984..2751226) FT /rpt_family="MER1_type" FT repeat_region complement(2747757..2747897) FT /rpt_family="MaLR" FT repeat_region complement(2747453..2747756) FT /rpt_family="Alu" FT repeat_region complement(2747200..2747452) FT /rpt_family="MaLR" FT repeat_region complement(2746627..2746930) FT /rpt_family="Alu" FT repeat_region complement(2746501..2746621) FT /rpt_family="Alu" FT repeat_region complement(2746034..2746449) FT /rpt_family="MaLR" FT repeat_region complement(2745811..2746011) FT /rpt_family="Alu" FT repeat_region complement(2745017..2745119) FT /rpt_family="L1" FT repeat_region complement(2744595..2744831) FT /rpt_family="L1" FT repeat_region complement(2744223..2744529) FT /rpt_family="Alu" FT repeat_region complement(2744135..2744205) FT /rpt_family="L1" FT repeat_region complement(2743855..2744126) FT /rpt_family="Alu" FT repeat_region complement(2743530..2743822) FT /rpt_family="Alu" FT repeat_region complement(2743316..2743502) FT /rpt_family="L1" FT repeat_region complement(2742778..2743065) FT /rpt_family="Alu" FT misc_feature complement(2742274..2742546) FT /note="CpG_island (%GC=70.3, o/e=0.61, #CpGs=22)" FT repeat_region complement(2741631..2741707) FT /rpt_family="MER1_type" FT repeat_region complement(2740911..2741052) FT /rpt_family="MIR" FT repeat_region complement(2740707..2740873) FT /rpt_family="Alu" FT misc_feature complement(2739969..2740417) FT /note="CpG_island (%GC=67.5, o/e=0.68, #CpGs=34)" FT repeat_region complement(2738222..2738480) FT /rpt_family="Alu" FT repeat_region complement(2737893..2738186) FT /rpt_family="Alu" FT repeat_region complement(2737788..2737887) FT /rpt_family="Alu" FT repeat_region complement(2737638..2737672) FT /rpt_family="AT_rich" FT repeat_region complement(2737359..2737465) FT /rpt_family="L1" FT repeat_region complement(2737034..2737358) FT /rpt_family="Alu" FT repeat_region complement(2736733..2737030) FT /rpt_family="Alu" FT repeat_region complement(2736551..2736711) FT /rpt_family="L1" FT repeat_region complement(2736237..2736542) FT /rpt_family="Alu" FT repeat_region complement(2735892..2736190) FT /rpt_family="Alu" FT repeat_region complement(2735765..2735840) FT /rpt_family="MIR" FT repeat_region complement(2735363..2735668) FT /rpt_family="Alu" FT repeat_region complement(2735077..2735362) FT /rpt_family="Alu" FT repeat_region complement(2734607..2734624) FT /rpt_family="(TATAA)n" FT repeat_region complement(2734306..2734606) FT /rpt_family="Alu" FT repeat_region complement(2734249..2734305) FT /rpt_family="(TATAA)n" FT repeat_region complement(2734115..2734221) FT /rpt_family="Alu" FT repeat_region complement(2733679..2734105) FT /rpt_family="ERVL" FT repeat_region complement(2733490..2733667) FT /rpt_family="L2" FT repeat_region complement(2733182..2733488) FT /rpt_family="Alu" FT repeat_region complement(2733022..2733181) FT /rpt_family="Alu" FT repeat_region complement(2732730..2733012) FT /rpt_family="Alu" FT repeat_region complement(2732373..2732680) FT /rpt_family="L2" FT repeat_region complement(2731893..2732196) FT /rpt_family="Alu" FT misc_feature complement(2731886..2732125) FT /note="CpG_island (%GC=57.9, o/e=0.85, #CpGs=17)" FT repeat_region complement(2731095..2731385) FT /rpt_family="Alu" FT repeat_region complement(2730973..2731042) FT /rpt_family="MIR" FT repeat_region complement(2730493..2730784) FT /rpt_family="Alu" FT repeat_region complement(2729878..2730102) FT /rpt_family="Alu" FT repeat_region complement(2729844..2729877) FT /rpt_family="(TCTG)n" FT repeat_region complement(2729205..2729295) FT /rpt_family="MIR" FT misc_feature complement(2727683..2728392) FT /note="CpG_island (%GC=77.7, o/e=0.94, #CpGs=91)" FT repeat_region complement(2728046..2728081) FT /rpt_family="GC_rich" FT repeat_region complement(2726681..2726974) FT /rpt_family="Alu" FT repeat_region complement(2726338..2726646) FT /rpt_family="Alu" FT repeat_region complement(2726212..2726325) FT /rpt_family="L1" FT repeat_region complement(2725885..2726175) FT /rpt_family="Alu" FT repeat_region complement(2725618..2725752) FT /rpt_family="L1" FT repeat_region complement(2725207..2725514) FT /rpt_family="Alu" FT repeat_region complement(2724910..2725206) FT /rpt_family="Alu" FT repeat_region complement(2724507..2724801) FT /rpt_family="Alu" FT repeat_region complement(2724048..2724099) FT /rpt_family="MIR" FT repeat_region complement(2723862..2724046) FT /rpt_family="MaLR" FT repeat_region complement(2723530..2723822) FT /rpt_family="Alu" FT repeat_region complement(2723380..2723500) FT /rpt_family="Alu" FT repeat_region complement(2723062..2723371) FT /rpt_family="Alu" FT repeat_region complement(2722796..2723018) FT /rpt_family="MaLR" FT repeat_region complement(2721481..2721540) FT /rpt_family="(TCTG)n" FT repeat_region complement(2720865..2721194) FT /rpt_family="Alu" FT misc_feature complement(2718827..2719206) FT /note="CpG_island (%GC=71.8, o/e=0.81, #CpGs=46)" FT repeat_region complement(2719008..2719066) FT /rpt_family="(CACG)n" FT repeat_region complement(2717900..2718384) FT /rpt_family="MaLR" FT repeat_region complement(2716975..2717271) FT /rpt_family="Alu" FT repeat_region complement(2716659..2716962) FT /rpt_family="Alu" FT repeat_region complement(2715928..2716264) FT /rpt_family="L1" FT repeat_region complement(2715749..2715927) FT /rpt_family="Alu" FT repeat_region complement(2715505..2715748) FT /rpt_family="Alu" FT repeat_region complement(2715385..2715504) FT /rpt_family="Alu" FT repeat_region complement(2715172..2715384) FT /rpt_family="L1" FT repeat_region complement(2714951..2715123) FT /rpt_family="MaLR" FT repeat_region complement(2714620..2714931) FT /rpt_family="Alu" FT repeat_region complement(2714271..2714611) FT /rpt_family="L1" FT repeat_region complement(2714188..2714250) FT /rpt_family="Alu" FT repeat_region complement(2714093..2714187) FT /rpt_family="Alu" FT repeat_region complement(2713604..2714092) FT /rpt_family="L1" FT repeat_region complement(2713512..2713592) FT /rpt_family="Alu" FT repeat_region complement(2713478..2713511) FT /rpt_family="Alu" FT repeat_region complement(2713454..2713477) FT /rpt_family="(TAAA)n" FT repeat_region complement(2713258..2713453) FT /rpt_family="Alu" FT repeat_region complement(2712947..2713241) FT /rpt_family="Alu" FT repeat_region complement(2712643..2712933) FT /rpt_family="Alu" FT repeat_region complement(2712620..2712642) FT /rpt_family="(CAGA)n" FT repeat_region complement(2712605..2712619) FT /rpt_family="Alu" FT repeat_region complement(2712501..2712604) FT /rpt_family="L1" FT repeat_region complement(2712131..2712400) FT /rpt_family="Alu" FT repeat_region complement(2711849..2712124) FT /rpt_family="Alu" FT repeat_region complement(2711695..2711822) FT /rpt_family="Alu" FT repeat_region complement(2711378..2711686) FT /rpt_family="Alu" FT repeat_region complement(2710209..2710531) FT /rpt_family="Alu" FT repeat_region complement(2709786..2709925) FT /rpt_family="L2" FT repeat_region complement(2709477..2709738) FT /rpt_family="L2" FT repeat_region complement(2709264..2709468) FT /rpt_family="Alu" FT repeat_region complement(2709055..2709214) FT /rpt_family="Alu" FT repeat_region complement(2708738..2709054) FT /rpt_family="Alu" FT repeat_region complement(2708642..2708737) FT /rpt_family="Alu" FT repeat_region complement(2708320..2708607) FT /rpt_family="Alu" FT repeat_region complement(2707503..2708318) FT /rpt_family="L2" FT repeat_region complement(2707211..2707502) FT /rpt_family="Alu" FT repeat_region complement(2706971..2707210) FT /rpt_family="L2" FT repeat_region complement(2706520..2706970) FT /rpt_family="MaLR" FT repeat_region complement(2706249..2706519) FT /rpt_family="L2" FT misc_feature complement(2704540..2705327) FT /note="CpG_island (%GC=65.5, o/e=0.80, #CpGs=63)" FT repeat_region complement(2704778..2705075) FT /rpt_family="Alu" FT repeat_region complement(2704412..2704432) FT /rpt_family="AT_rich" FT repeat_region complement(2704100..2704125) FT /rpt_family="AT_rich" FT misc_feature complement(2701331..2701744) FT /note="CpG_island (%GC=72.0, o/e=0.63, #CpGs=34)" FT misc_feature complement(2700060..2700305) FT /note="CpG_island (%GC=72.8, o/e=0.88, #CpGs=23)" FT repeat_region complement(2700176..2700208) FT /rpt_family="(CGGGA)n" FT repeat_region complement(2699525..2699544) FT /rpt_family="(GA)n" FT misc_feature complement(2697935..2698204) FT /note="CpG_island (%GC=70.0, o/e=0.65, #CpGs=24)" FT repeat_region complement(2697156..2697307) FT /rpt_family="MIR" FT repeat_region complement(2697090..2697139) FT /rpt_family="(CACCAT)n" FT repeat_region complement(2696915..2697076) FT /rpt_family="(CACCAT)n" FT repeat_region complement(2694774..2695079) FT /rpt_family="Alu" FT repeat_region complement(2694589..2694748) FT /rpt_family="MaLR" FT repeat_region complement(2694409..2694588) FT /rpt_family="Alu" FT repeat_region complement(2694215..2694408) FT /rpt_family="MaLR" FT repeat_region complement(2694088..2694113) FT /rpt_family="AT_rich" FT repeat_region complement(2694045..2694087) FT /rpt_family="(TA)n" FT repeat_region complement(2693748..2694028) FT /rpt_family="Alu" FT repeat_region complement(2693215..2693524) FT /rpt_family="Alu" FT repeat_region complement(2692906..2692949) FT /rpt_family="Alu" FT repeat_region complement(2691531..2691707) FT /rpt_family="(TG)n" FT unsure complement(2994219..2998069) FT /note="unresolved tandem repeat" FT repeat_region complement(2996131..2996400) FT /rpt_family="L1" FT repeat_region complement(2995853..2996130) FT /rpt_family="Alu" FT repeat_region complement(2995831..2995852) FT /rpt_family="L1" FT repeat_region complement(2995539..2995830) FT /rpt_family="Alu" FT repeat_region complement(2995185..2995538) FT /rpt_family="L1" FT repeat_region complement(2994784..2994924) FT /rpt_family="MIR" FT repeat_region complement(2994482..2994783) FT /rpt_family="Alu" FT repeat_region complement(2994438..2994481) FT /rpt_family="MIR" FT repeat_region complement(2993932..2994034) FT /rpt_family="Alu" FT repeat_region complement(2993447..2993557) FT /rpt_family="MaLR" FT repeat_region complement(2993408..2993455) FT /rpt_family="MaLR" FT repeat_region complement(2993065..2993212) FT /rpt_family="MaLR" FT repeat_region complement(2992367..2992677) FT /rpt_family="Alu" FT repeat_region complement(2991826..2991999) FT /rpt_family="L1" FT repeat_region complement(2991535..2991825) FT /rpt_family="Alu" FT repeat_region complement(2991435..2991534) FT /rpt_family="L1" FT repeat_region complement(2991281..2991434) FT /rpt_family="Alu" FT repeat_region complement(2991171..2991280) FT /rpt_family="Alu" FT repeat_region complement(2991111..2991168) FT /rpt_family="L1" FT repeat_region complement(2990957..2991110) FT /rpt_family="ERV1" FT repeat_region complement(2987888..2990954) FT /rpt_family="L1" FT repeat_region complement(2987711..2987893) FT /rpt_family="L1" FT repeat_region complement(2987466..2987679) FT /rpt_family="L1" FT gene complement(2945782..2987421) FT /gene="CARD11" FT mRNA complement(join(2945782..2946476,2949684..2949799, FT 2951806..2951930,2952921..2953100,2954871..2955006, FT 2956924..2957019,2958125..2958221,2959006..2959246, FT 2962268..2962394,2962766..2962967,2963867..2963999, FT 2966373..2966425,2968232..2968332,2969626..2969708, FT 2972169..2972220,2974087..2974263,2976671..2976868, FT 2977541..2977666,2978313..2978465,2979383..2979562, FT 2983846..2984171,2985453..2985590,2987209..2987421)) FT /gene="CARD11" FT CDS complement(join(2946272..2946476,2949684..2949799, FT 2951806..2951930,2952921..2953100,2954871..2955006, FT 2956924..2957019,2958125..2958221,2959006..2959246, FT 2962268..2962394,2962766..2962967,2963867..2963999, FT 2966373..2966425,2968232..2968332,2969626..2969708, FT 2972169..2972220,2974087..2974263,2976671..2976868, FT 2977541..2977666,2978313..2978465,2979383..2979562, FT 2983846..2984171,2985453..2985590,2987209..2987407)) FT /codon_start=1 FT /gene="CARD11" FT /product="unknown" FT /note="Homo sapiens caspase recruitment domain family, FT member 11 (CARD11), mRNA.; H_DJ0852O24.1" FT /protein_id="AAQ96893.1" FT /translation="MDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVI FT DEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEP FT TRRFSTIVVEEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEKKQMTLTR FT VELLTFQERYYKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEI FT DQLKHRLNKMEEECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQELQSIIQ FT AGKRSLPDSDKAILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKEDL FT ELKCSTLGKDCEMYKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQ FT IRELEEKNDEMRIEMVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTIISQDFGDA FT SPRTNGQEADDSSTSEESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQA FT KGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPH FT RSTVEEDNDSGGFDALDLDDDSHERYSFGPSSIHSSSSSHQSEGLDAYDLEQVNLMFRK FT FSLERPFRPSVTSVGHVRGPGPSVQHTTLNGDSLTSQLTLLGGNARGSFVHSVKPGSLA FT EKAGLREGHQLLLLEGCIRGERQSVPLDTCTKEEAHWTIQRCSGPVTLHYKVNHEGYRK FT LVKDMEDGLITSGDSFYIRLNLNISSQLDACTMSLKCDDVVHVRDTMYQDRHEWLCARV FT DPFTDHDLDMGTIPSYSRAQQLLLVKLQRLMHRGSREEVDGTHHTLRALRNTLQPEEAL FT STSDPRVSPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSLARSSLDA FT TKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFTPTVLAKTLVQRLLNSG FT GAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAKNKHCLLE FT AGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALP FT CLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL" FT repeat_region complement(2986613..2987045) FT /rpt_family="MER1_type" FT repeat_region complement(2986423..2986503) FT /rpt_family="MER1_type" FT repeat_region complement(2986243..2986398) FT /rpt_family="MER1_type" FT repeat_region complement(2985362..2985405) FT /rpt_family="(TG)n" FT repeat_region complement(2984747..2984909) FT /rpt_family="Alu" FT repeat_region complement(2984249..2984744) FT /rpt_family="L2" FT repeat_region complement(2983108..2983472) FT /rpt_family="Alu" FT repeat_region complement(2983065..2983104) FT /rpt_family="L2" FT repeat_region complement(2982725..2983064) FT /rpt_family="Alu" FT repeat_region complement(2982470..2982724) FT /rpt_family="L2" FT repeat_region complement(2982413..2982441) FT /rpt_family="(TTTTTG)n" FT repeat_region complement(2982173..2982397) FT /rpt_family="Alu" FT repeat_region complement(2981900..2982152) FT /rpt_family="GA-rich" FT repeat_region complement(2981663..2981878) FT /rpt_family="L2" FT repeat_region complement(2981532..2981665) FT /rpt_family="L2" FT repeat_region complement(2981331..2981487) FT /rpt_family="MIR" FT repeat_region complement(2981174..2981196) FT /rpt_family="(T)n" FT repeat_region complement(2980448..2980523) FT /rpt_family="CT-rich" FT repeat_region complement(2980164..2980447) FT /rpt_family="L1" FT repeat_region complement(2980104..2980163) FT /rpt_family="CT-rich" FT repeat_region complement(2977062..2977255) FT /rpt_family="MIR" FT repeat_region complement(2976119..2976420) FT /rpt_family="Alu" FT repeat_region complement(2975853..2975985) FT /rpt_family="Alu" FT repeat_region complement(2975532..2975823) FT /rpt_family="Alu" FT repeat_region complement(2975118..2975240) FT /rpt_family="MIR" FT repeat_region complement(2975069..2975114) FT /rpt_family="Alu" FT repeat_region complement(2974663..2974817) FT /rpt_family="MIR" FT repeat_region complement(2973505..2973831) FT /rpt_family="Alu" FT repeat_region complement(2973295..2973483) FT /rpt_family="(GAAA)n" FT repeat_region complement(2972941..2973242) FT /rpt_family="Alu" FT repeat_region complement(2971650..2971678) FT /rpt_family="L2" FT repeat_region complement(2971302..2971520) FT /rpt_family="Alu" FT repeat_region complement(2971185..2971301) FT /rpt_family="Alu" FT repeat_region complement(2969976..2970095) FT /rpt_family="Alu" FT repeat_region complement(2969720..2969819) FT /rpt_family="C-rich" FT misc_feature complement(2968235..2968596) FT /gene="CARD11" FT /note="CpG_island (%GC=64.6, o/e=0.72, #CpGs=33)" FT repeat_region complement(2967998..2968131) FT /rpt_family="MIR" FT repeat_region complement(2967618..2967920) FT /rpt_family="Alu" FT repeat_region complement(2967000..2967317) FT /rpt_family="Alu" FT repeat_region complement(2965977..2966103) FT /rpt_family="MIR" FT repeat_region complement(2964574..2964687) FT /rpt_family="Alu" FT repeat_region complement(2964268..2964567) FT /rpt_family="Alu" FT repeat_region complement(2963712..2963747) FT /rpt_family="MIR" FT repeat_region complement(2963419..2963711) FT /rpt_family="Alu" FT repeat_region complement(2963288..2963418) FT /rpt_family="MIR" FT repeat_region complement(2962147..2962214) FT /rpt_family="MIR" FT repeat_region complement(2960174..2960503) FT /rpt_family="(TAGA)n" FT repeat_region complement(2960078..2960170) FT /rpt_family="L1" FT repeat_region complement(2960042..2960077) FT /rpt_family="(TAGA)n" FT repeat_region complement(2959556..2960041) FT /rpt_family="L1" FT repeat_region complement(2958405..2958539) FT /rpt_family="MIR" FT repeat_region complement(2957592..2957886) FT /rpt_family="Alu" FT repeat_region complement(2957301..2957591) FT /rpt_family="Alu" FT repeat_region complement(2955700..2955995) FT /rpt_family="Alu" FT repeat_region complement(2954624..2954739) FT /rpt_family="Alu" FT repeat_region complement(2954307..2954613) FT /rpt_family="Alu" FT repeat_region complement(2954256..2954306) FT /rpt_family="AT_rich" FT repeat_region complement(2954040..2954231) FT /rpt_family="Alu" FT repeat_region complement(2952606..2952861) FT /rpt_family="CT-rich" FT repeat_region complement(2952248..2952605) FT /rpt_family="(TGGA)n" FT repeat_region complement(2952070..2952174) FT /rpt_family="L2" FT repeat_region complement(2950873..2950946) FT /rpt_family="L1" FT repeat_region complement(2950584..2950867) FT /rpt_family="Alu" FT repeat_region complement(2950353..2950396) FT /rpt_family="(TG)n" FT repeat_region complement(2950069..2950352) FT /rpt_family="Alu" FT repeat_region complement(2949007..2949301) FT /rpt_family="G-rich" FT unsure complement(2949017..2949140) FT /gene="CARD11" FT /note="unresolved tandem repeat" FT repeat_region complement(2948760..2948884) FT /rpt_family="L2" FT repeat_region complement(2948448..2948759) FT /rpt_family="Alu" FT repeat_region complement(2948389..2948447) FT /rpt_family="L2" FT repeat_region complement(2948210..2948290) FT /rpt_family="L2" FT repeat_region complement(2947851..2948193) FT /rpt_family="L1" FT repeat_region complement(2947662..2947679) FT /rpt_family="L1" FT repeat_region complement(2947368..2947661) FT /rpt_family="Alu" FT repeat_region complement(2946985..2947367) FT /rpt_family="L1" FT repeat_region complement(2946693..2946972) FT /rpt_family="Alu" FT repeat_region complement(2946672..2946692) FT /rpt_family="(CAAT)n" FT misc_feature complement(2946237..2946463) FT /gene="CARD11" FT /note="CpG_island (%GC=66.1, o/e=0.76, #CpGs=19)" FT repeat_region complement(2945516..2945649) FT /rpt_family="AcHobo" FT repeat_region complement(2944923..2945052) FT /rpt_family="MaLR" FT repeat_region complement(2944611..2944884) FT /rpt_family="MaLR" FT repeat_region complement(2942957..2943063) FT /rpt_family="MIR" FT repeat_region complement(2942712..2942759) FT /rpt_family="(TTTTTG)n" FT repeat_region complement(2942423..2942709) FT /rpt_family="Alu" FT repeat_region complement(2942311..2942422) FT /rpt_family="Alu" FT repeat_region complement(2942013..2942081) FT /rpt_family="Alu" FT repeat_region complement(2941754..2942005) FT /rpt_family="Alu" FT repeat_region complement(2940935..2941074) FT /rpt_family="L1" FT repeat_region complement(2940801..2940934) FT /rpt_family="Alu" FT repeat_region complement(2940488..2940800) FT /rpt_family="Alu" FT repeat_region complement(2940172..2940487) FT /rpt_family="Alu" FT repeat_region complement(2940005..2940171) FT /rpt_family="Alu" FT repeat_region complement(2939640..2940004) FT /rpt_family="L1" FT misc_feature complement(2939343..2939631) FT /note="CpG_island (%GC=60.6, o/e=0.76, #CpGs=22)" FT repeat_region complement(2939307..2939625) FT /rpt_family="Alu" FT repeat_region complement(2938705..2938845) FT /rpt_family="ERV1" FT repeat_region complement(2938568..2938706) FT /rpt_family="MER1_type" FT repeat_region complement(2938414..2938549) FT /rpt_family="L2" FT repeat_region complement(2938212..2938399) FT /rpt_family="MER1_type" FT repeat_region complement(2938118..2938210) FT /rpt_family="MaLR" FT repeat_region complement(2937781..2938091) FT /rpt_family="Alu" FT repeat_region complement(2937449..2937598) FT /rpt_family="MER1_type" FT repeat_region complement(2937134..2937441) FT /rpt_family="Alu" FT repeat_region complement(2936191..2936494) FT /rpt_family="Alu" FT repeat_region complement(2935627..2935670) FT /rpt_family="MIR" FT repeat_region complement(2935304..2935582) FT /rpt_family="Alu" FT repeat_region complement(2934798..2935119) FT /rpt_family="Alu" FT repeat_region complement(2934770..2934796) FT /rpt_family="AT_rich" FT repeat_region complement(2933953..2934061) FT /rpt_family="GA-rich" FT repeat_region complement(2933506..2933819) FT /rpt_family="Alu" FT repeat_region complement(2933116..2933231) FT /rpt_family="L2" FT repeat_region complement(2932797..2933115) FT /rpt_family="Alu" FT repeat_region complement(2932686..2932796) FT /rpt_family="L2" FT repeat_region complement(2932103..2932623) FT /rpt_family="MER1_type" FT repeat_region complement(2931704..2932019) FT /rpt_family="Alu" FT repeat_region complement(2931548..2931689) FT /rpt_family="Alu" FT repeat_region complement(2931118..2931231) FT /rpt_family="MaLR" FT repeat_region complement(2930815..2931117) FT /rpt_family="Alu" FT repeat_region complement(2930539..2930814) FT /rpt_family="MaLR" FT repeat_region complement(2930435..2930537) FT /rpt_family="L2" FT repeat_region complement(2929817..2929903) FT /rpt_family="L1" FT repeat_region complement(2929526..2929816) FT /rpt_family="Alu" FT repeat_region complement(2929232..2929525) FT /rpt_family="L1" FT repeat_region complement(2929101..2929229) FT /rpt_family="Alu" FT repeat_region complement(2928705..2929080) FT /rpt_family="L1" FT repeat_region complement(2928420..2928704) FT /rpt_family="Alu" FT repeat_region complement(2928244..2928419) FT /rpt_family="L1" FT repeat_region complement(2927956..2928243) FT /rpt_family="Alu" FT repeat_region complement(2927939..2927955) FT /rpt_family="L1" FT repeat_region complement(2927135..2927467) FT /rpt_family="Alu" FT repeat_region complement(2926712..2926775) FT /rpt_family="(TG)n" FT repeat_region complement(2925864..2925987) FT /rpt_family="MIR" FT repeat_region complement(2925231..2925536) FT /rpt_family="Alu" FT repeat_region complement(2924854..2924963) FT /rpt_family="Alu" FT repeat_region complement(2924813..2924842) FT /rpt_family="(TA)n" FT repeat_region complement(2924516..2924812) FT /rpt_family="Alu" FT repeat_region complement(2924448..2924515) FT /rpt_family="(TA)n" FT repeat_region complement(2924142..2924441) FT /rpt_family="Alu" FT repeat_region complement(2924033..2924128) FT /rpt_family="MER1_type" FT repeat_region complement(2923865..2923980) FT /rpt_family="MER1_type" FT repeat_region complement(2923658..2923777) FT /rpt_family="MIR" FT repeat_region complement(2922597..2922728) FT /rpt_family="MIR" FT repeat_region complement(2921614..2921680) FT /rpt_family="MIR" FT repeat_region complement(2921473..2921497) FT /rpt_family="(A)n" FT repeat_region complement(2921171..2921470) FT /rpt_family="Alu" FT repeat_region complement(2919792..2919944) FT /rpt_family="(CATA)n" FT repeat_region complement(2919682..2919904) FT /rpt_family="(CA)n" FT repeat_region complement(2919504..2919667) FT /rpt_family="(CA)n" FT repeat_region complement(2919344..2919486) FT /rpt_family="(CATA)n" FT repeat_region complement(2919215..2919385) FT /rpt_family="(CA)n" FT repeat_region complement(2919007..2919185) FT /rpt_family="(CA)n" FT repeat_region complement(2918894..2918974) FT /rpt_family="(CA)n" FT repeat_region complement(2918279..2918586) FT /rpt_family="Alu" FT repeat_region complement(2917934..2918073) FT /rpt_family="L2" FT repeat_region complement(2917767..2917905) FT /rpt_family="Alu" FT repeat_region complement(2917458..2917766) FT /rpt_family="Alu" FT repeat_region complement(2917276..2917457) FT /rpt_family="Alu" FT repeat_region complement(2916781..2917088) FT /rpt_family="Alu" FT repeat_region complement(2915718..2915832) FT /rpt_family="MER1_type" FT repeat_region complement(2915382..2915557) FT /rpt_family="MaLR" FT repeat_region complement(2915068..2915381) FT /rpt_family="Alu" FT repeat_region complement(2914775..2915067) FT /rpt_family="MaLR" FT repeat_region complement(2914645..2914752) FT /rpt_family="ERVL" FT repeat_region complement(2914176..2914482) FT /rpt_family="Alu" FT repeat_region complement(2912380..2912682) FT /rpt_family="Alu" FT repeat_region complement(2912240..2912346) FT /rpt_family="L2" FT repeat_region complement(2911638..2911791) FT /rpt_family="MER1_type" FT repeat_region complement(2910663..2910932) FT /rpt_family="Alu" FT repeat_region complement(2910259..2910502) FT /rpt_family="ERVL" FT repeat_region complement(2909623..2909658) FT /rpt_family="MaLR" FT repeat_region complement(2909332..2909622) FT /rpt_family="Alu" FT repeat_region complement(2908979..2909331) FT /rpt_family="MaLR" FT repeat_region complement(2908870..2908907) FT /rpt_family="(TGGG)n" FT repeat_region complement(2908574..2908688) FT /rpt_family="L1" FT repeat_region complement(2908261..2908410) FT /rpt_family="L1" FT repeat_region complement(2907958..2908249) FT /rpt_family="Alu" FT repeat_region complement(2907934..2907957) FT /rpt_family="AT_rich" FT repeat_region complement(2907799..2907928) FT /rpt_family="Alu" FT repeat_region complement(2907516..2907798) FT /rpt_family="Alu" FT repeat_region complement(2907493..2907512) FT /rpt_family="(TG)n" FT repeat_region complement(2907466..2907492) FT /rpt_family="(TG)n" FT repeat_region complement(2907155..2907446) FT /rpt_family="Alu" FT repeat_region complement(2907120..2907154) FT /rpt_family="(TCTA)n" FT repeat_region complement(2907092..2907117) FT /rpt_family="(GA)n" FT repeat_region complement(2906545..2906965) FT /rpt_family="MaLR" FT repeat_region complement(2905739..2906040) FT /rpt_family="Alu" FT repeat_region complement(2905567..2905737) FT /rpt_family="Alu" FT repeat_region complement(2905512..2905566) FT /rpt_family="Alu" FT repeat_region complement(2904511..2904666) FT /rpt_family="L2" FT repeat_region complement(2904157..2904448) FT /rpt_family="Alu" FT repeat_region complement(2903789..2904055) FT /rpt_family="MIR" FT repeat_region complement(2903718..2903754) FT /rpt_family="(TCC)n" FT repeat_region complement(2903088..2903217) FT /rpt_family="AcHobo" FT repeat_region complement(2902571..2902601) FT /rpt_family="MIR" FT repeat_region complement(2902267..2902570) FT /rpt_family="Alu" FT repeat_region complement(2902204..2902266) FT /rpt_family="MIR" FT repeat_region complement(2901978..2902035) FT /rpt_family="ERVL" FT repeat_region complement(2901931..2901960) FT /rpt_family="(CA)n" FT repeat_region complement(2901833..2901928) FT /rpt_family="MER2_type" FT repeat_region complement(2901620..2901795) FT /rpt_family="Alu" FT repeat_region complement(2901419..2901578) FT /rpt_family="Alu" FT repeat_region complement(2901341..2901403) FT /rpt_family="Alu" FT repeat_region complement(2901160..2901342) FT /rpt_family="MER2_type" FT repeat_region complement(2900820..2901079) FT /rpt_family="Alu" FT repeat_region complement(3021648..3021870) FT /rpt_family="L1" FT repeat_region complement(3021404..3021642) FT /rpt_family="ERVL" FT repeat_region complement(3021110..3021333) FT /rpt_family="L1" FT repeat_region complement(3017795..3018031) FT /rpt_family="Alu" FT repeat_region complement(3017503..3017794) FT /rpt_family="Alu" FT repeat_region complement(3016951..3017258) FT /rpt_family="Alu" FT repeat_region complement(3016546..3016935) FT /rpt_family="L1" FT repeat_region complement(3016373..3016538) FT /rpt_family="Alu" FT repeat_region complement(3016057..3016370) FT /rpt_family="Alu" FT repeat_region complement(3014978..3015279) FT /rpt_family="Alu" FT repeat_region complement(3014505..3014819) FT /rpt_family="Alu" FT repeat_region complement(3013688..3013982) FT /rpt_family="Alu" FT repeat_region complement(3013552..3013687) FT /rpt_family="Alu" FT repeat_region complement(3012626..3012753) FT /rpt_family="Alu" FT repeat_region complement(3012604..3012625) FT /rpt_family="(TAAA)n" FT repeat_region complement(3012430..3012603) FT /rpt_family="Alu" FT repeat_region complement(3012293..3012405) FT /rpt_family="MIR" FT repeat_region complement(3011637..3011925) FT /rpt_family="Alu" FT repeat_region complement(3011331..3011625) FT /rpt_family="Alu" FT repeat_region complement(3010317..3010363) FT /rpt_family="(TGAG)n" FT repeat_region complement(3009901..3010299) FT /rpt_family="(TGAG)n" FT repeat_region complement(3009217..3009885) FT /rpt_family="(TGAG)n" FT repeat_region complement(3009008..3009186) FT /rpt_family="(TGAG)n" FT repeat_region complement(3008703..3008966) FT /rpt_family="(TGAG)n" FT repeat_region complement(3007680..3007979) FT /rpt_family="Alu" FT repeat_region complement(3005428..3005920) FT /rpt_family="MaLR" FT repeat_region complement(3004659..3004750) FT /rpt_family="L2" FT repeat_region complement(3004509..3004655) FT /rpt_family="MIR" FT repeat_region complement(3004437..3004506) FT /rpt_family="L1" FT repeat_region complement(3004389..3004436) FT /rpt_family="Alu" FT repeat_region complement(3004071..3004217) FT /rpt_family="MIR" FT repeat_region complement(3003737..3003851) FT /rpt_family="Alu" FT repeat_region complement(3003606..3003736) FT /rpt_family="L1" FT repeat_region complement(3003303..3003605) FT /rpt_family="Alu" FT repeat_region complement(3001863..3003302) FT /rpt_family="L1" FT repeat_region complement(3001574..3001862) FT /rpt_family="Alu" FT repeat_region complement(3001409..3001573) FT /rpt_family="L1" FT repeat_region complement(3001088..3001394) FT /rpt_family="Alu" FT repeat_region complement(3000660..3000959) FT /rpt_family="Alu" FT repeat_region complement(3000520..3000656) FT /rpt_family="Alu" FT repeat_region complement(3000465..3000489) FT /rpt_family="(TGG)n" FT repeat_region complement(2999822..3000129) FT /rpt_family="Alu" FT repeat_region complement(2999501..2999793) FT /rpt_family="Alu" FT repeat_region complement(2998892..2998940) FT /rpt_family="Alu" FT gene complement(2998134..2998265) FT /gene="CARD11" FT mRNA complement(2998134..2998265) FT /gene="CARD11" FT repeat_region complement(2997805..2998086) FT /rpt_family="Alu" FT repeat_region complement(2997272..2997575) FT /rpt_family="Alu" FT repeat_region complement(2996958..2997262) FT /rpt_family="Alu" FT repeat_region 3022882..3023177 FT /rpt_family="Alu" FT repeat_region 3023728..3024192 FT /rpt_family="ERVL" FT repeat_region 3024193..3024488 FT /rpt_family="Alu" FT repeat_region 3024489..3024633 FT /rpt_family="ERVL" FT repeat_region 3024688..3024983 FT /rpt_family="Alu" FT repeat_region 3025321..3025439 FT /rpt_family="MIR" FT repeat_region 3026299..3026427 FT /rpt_family="MER1_type" FT misc_feature 3026309..3026541 FT /note="CpG_island (%GC=64.4, o/e=0.82, #CpGs=18)" FT repeat_region 3026583..3026650 FT /rpt_family="L1" FT repeat_region 3026786..3026899 FT /rpt_family="Alu" FT repeat_region 3026900..3027400 FT /rpt_family="L1" FT repeat_region 3027401..3027693 FT /rpt_family="Alu" FT repeat_region 3027694..3028086 FT /rpt_family="L1" FT repeat_region 3028087..3028358 FT /rpt_family="Alu" FT repeat_region 3028359..3028394 FT /rpt_family="(CAA)n" FT repeat_region 3028395..3028427 FT /rpt_family="Alu" FT repeat_region 3028428..3028580 FT /rpt_family="L1" FT repeat_region 3028581..3028890 FT /rpt_family="Alu" FT repeat_region 3028891..3029470 FT /rpt_family="L1" FT repeat_region 3029471..3029769 FT /rpt_family="Alu" FT repeat_region 3029770..3030358 FT /rpt_family="L1" FT repeat_region 3030397..3030696 FT /rpt_family="Alu" FT repeat_region 3030697..3031322 FT /rpt_family="L1" FT repeat_region 3031411..3031872 FT /rpt_family="L1" FT repeat_region 3032040..3032316 FT /rpt_family="MaLR" FT repeat_region 3032317..3032642 FT /rpt_family="Alu" FT repeat_region 3032643..3032809 FT /rpt_family="MaLR" FT repeat_region 3034104..3034398 FT /rpt_family="MaLR" FT repeat_region 3034399..3034848 FT /rpt_family="L1" FT repeat_region 3034849..3035206 FT /rpt_family="MaLR" FT repeat_region 3035207..3035345 FT /rpt_family="L1" FT repeat_region 3035346..3035458 FT /rpt_family="MaLR" FT repeat_region 3035755..3036008 FT /rpt_family="L2" FT repeat_region 3036212..3036502 FT /rpt_family="Alu" FT repeat_region 3036548..3036811 FT /rpt_family="ERVL" FT repeat_region 3037526..3037665 FT /rpt_family="MaLR" FT repeat_region 3037666..3037977 FT /rpt_family="Alu" FT repeat_region 3037978..3038038 FT /rpt_family="MaLR" FT repeat_region 3038039..3038146 FT /rpt_family="Alu" FT repeat_region 3038147..3038170 FT /rpt_family="(CAAAA)n" FT repeat_region 3038171..3038332 FT /rpt_family="Alu" FT repeat_region 3038333..3038616 FT /rpt_family="MaLR" FT repeat_region 3038634..3038727 FT /rpt_family="MIR" FT ncRNA 3038728..3038973 FT /product="snRNA-7SK_RNA-related" FT /ncRNA_class="snRNA" FT repeat_region 3038728..3038973 FT /rpt_family="7SK" FT repeat_region 3039158..3039196 FT /rpt_family="MER1_type" FT repeat_region 3039205..3039512 FT /rpt_family="Alu" FT repeat_region 3039514..3039810 FT /rpt_family="Alu" FT repeat_region 3039820..3039949 FT /rpt_family="Alu" FT repeat_region 3040042..3040344 FT /rpt_family="Alu" FT repeat_region 3040350..3040512 FT /rpt_family="MIR" FT repeat_region 3041708..3041879 FT /rpt_family="Alu" FT repeat_region 3041917..3042217 FT /rpt_family="Alu" FT repeat_region 3042218..3042497 FT /rpt_family="MaLR" FT repeat_region 3042498..3042548 FT /rpt_family="Alu" FT repeat_region 3042549..3042918 FT /rpt_family="ERV1" FT repeat_region 3042919..3043221 FT /rpt_family="Alu" FT repeat_region 3043222..3043298 FT /rpt_family="ERV1" FT repeat_region 3044184..3044242 FT /rpt_family="(TA)n" FT repeat_region 3044317..3044459 FT /rpt_family="(TA)n" FT repeat_region 3044477..3044736 FT /rpt_family="L1" FT repeat_region 3044739..3044769 FT /rpt_family="AT_rich" FT repeat_region 3044774..3044900 FT /rpt_family="Alu" FT repeat_region 3045136..3045442 FT /rpt_family="Alu" FT repeat_region 3045499..3045720 FT /rpt_family="MIR" FT repeat_region 3045845..3045933 FT /rpt_family="MER103" FT repeat_region 3046610..3046862 FT /rpt_family="L1" FT repeat_region 3046888..3047029 FT /rpt_family="MER2_type" FT repeat_region 3047064..3047110 FT /rpt_family="(TCC)n" FT repeat_region 3047111..3047282 FT /rpt_family="Alu" FT repeat_region 3047285..3047722 FT /rpt_family="MER2_type" FT repeat_region 3047804..3048271 FT /rpt_family="CR1" FT repeat_region 3048278..3048381 FT /rpt_family="(GGAA)n" FT repeat_region 3048388..3048434 FT /rpt_family="CR1" FT repeat_region 3048439..3048499 FT /rpt_family="GA-rich" FT repeat_region 3048504..3048567 FT /rpt_family="CR1" FT repeat_region 3049303..3049594 FT /rpt_family="Alu" FT repeat_region 3049639..3050250 FT /rpt_family="L1" FT repeat_region 3050350..3050520 FT /rpt_family="MaLR" FT repeat_region 3050521..3050598 FT /rpt_family="Mariner" FT repeat_region 3050639..3050935 FT /rpt_family="Alu" FT repeat_region 3050947..3051320 FT /rpt_family="L1" FT repeat_region 3052135..3052324 FT /rpt_family="Alu" FT repeat_region 3052329..3052360 FT /rpt_family="MIR" FT repeat_region 3052363..3052446 FT /rpt_family="Alu" FT repeat_region 3052541..3052697 FT /rpt_family="L1" FT repeat_region 3052724..3053090 FT /rpt_family="MaLR" FT repeat_region 3053189..3053213 FT /rpt_family="L1" FT repeat_region 3053214..3053510 FT /rpt_family="Alu" FT repeat_region 3053511..3053593 FT /rpt_family="L1" FT repeat_region 3054555..3054784 FT /rpt_family="MaLR" FT repeat_region 3054785..3055081 FT /rpt_family="Alu" FT repeat_region 3055082..3055253 FT /rpt_family="MaLR" FT repeat_region 3055458..3055744 FT /rpt_family="Alu" FT repeat_region 3055804..3056220 FT /rpt_family="ERV1" FT repeat_region 3056221..3056508 FT /rpt_family="Alu" FT repeat_region 3056509..3056639 FT /rpt_family="ERV1" FT repeat_region 3057074..3057262 FT /rpt_family="ERV1" FT repeat_region 3057263..3057557 FT /rpt_family="Alu" FT repeat_region 3057558..3057803 FT /rpt_family="ERV1" FT repeat_region 3057804..3058097 FT /rpt_family="Alu" FT repeat_region 3058098..3058187 FT /rpt_family="ERV1" FT repeat_region 3058545..3058763 FT /rpt_family="Alu" FT repeat_region 3058917..3059056 FT /rpt_family="MER1_type" FT repeat_region 3059207..3059301 FT /rpt_family="MER1_type" FT repeat_region 3059357..3059510 FT /rpt_family="L1" FT repeat_region 3059535..3059730 FT /rpt_family="MaLR" FT repeat_region 3059735..3060534 FT /rpt_family="L1" FT repeat_region 3060535..3061381 FT /rpt_family="L1" FT repeat_region 3061382..3062261 FT /rpt_family="L1" FT repeat_region 3062271..3062572 FT /rpt_family="Alu" FT repeat_region 3062573..3062599 FT /rpt_family="(TA)n" FT repeat_region 3062600..3062612 FT /rpt_family="Alu" FT repeat_region 3062925..3063213 FT /rpt_family="MER2_type" FT repeat_region 3063214..3063516 FT /rpt_family="Alu" FT repeat_region 3063517..3063601 FT /rpt_family="MER2_type" FT repeat_region 3063672..3063871 FT /rpt_family="L1" FT repeat_region 3064047..3064354 FT /rpt_family="Alu" FT repeat_region 3064865..3064955 FT /rpt_family="MER1_type" FT repeat_region 3064959..3065100 FT /rpt_family="L1" FT repeat_region 3065100..3065741 FT /rpt_family="L1" FT repeat_region 3065785..3065910 FT /rpt_family="Alu" FT repeat_region 3065911..3066077 FT /rpt_family="L1" FT repeat_region 3066080..3066143 FT /rpt_family="MER53" FT repeat_region 3066144..3066443 FT /rpt_family="Alu" FT repeat_region 3066444..3066525 FT /rpt_family="MER53" FT repeat_region 3066530..3066564 FT /rpt_family="AT_rich" FT repeat_region 3066565..3066699 FT /rpt_family="L1" FT repeat_region 3066991..3067302 FT /rpt_family="L2" FT repeat_region 3067399..3067616 FT /rpt_family="Alu" FT repeat_region 3067672..3067809 FT /rpt_family="MIR" FT repeat_region 3068142..3068184 FT /rpt_family="(A)n" FT repeat_region 3068827..3068937 FT /rpt_family="MIR" FT repeat_region 3068965..3069199 FT /rpt_family="L1" FT repeat_region 3069231..3069542 FT /rpt_family="Alu" FT repeat_region 3069555..3069779 FT /rpt_family="L1" FT repeat_region 3070114..3070191 FT /rpt_family="MIR" FT repeat_region 3070208..3070341 FT /rpt_family="L1" FT repeat_region 3070342..3070642 FT /rpt_family="Alu" FT repeat_region 3070643..3071010 FT /rpt_family="L1" FT repeat_region 3071226..3071342 FT /rpt_family="MIR" FT repeat_region 3071405..3071705 FT /rpt_family="Alu" FT repeat_region 3071800..3072282 FT /rpt_family="L2" FT repeat_region 3072283..3072582 FT /rpt_family="Alu" FT repeat_region 3072583..3072711 FT /rpt_family="L2" FT repeat_region 3072712..3073115 FT /rpt_family="MaLR" FT repeat_region 3073116..3073443 FT /rpt_family="L2" FT repeat_region 3073517..3073538 FT /rpt_family="AT_rich" FT repeat_region 3073540..3073834 FT /rpt_family="Alu" FT repeat_region 3073842..3074002 FT /rpt_family="L1" FT repeat_region 3074011..3074285 FT /rpt_family="Alu" FT repeat_region 3074926..3075234 FT /rpt_family="Alu" FT repeat_region 3075244..3075535 FT /rpt_family="Alu" FT repeat_region 3075572..3075679 FT /rpt_family="L1" FT repeat_region 3075680..3075979 FT /rpt_family="Alu" FT repeat_region 3075980..3076275 FT /rpt_family="L1" FT repeat_region 3076309..3076625 FT /rpt_family="Alu" FT repeat_region 3076626..3076715 FT /rpt_family="L1" FT repeat_region 3076874..3076978 FT /rpt_family="MER1_type" FT repeat_region 3077218..3077489 FT /rpt_family="Alu" FT repeat_region 3077493..3077625 FT /rpt_family="MIR" FT repeat_region 3077652..3077959 FT /rpt_family="Alu" FT repeat_region 3078676..3078990 FT /rpt_family="Alu" FT repeat_region 3079101..3079403 FT /rpt_family="Alu" FT repeat_region 3079537..3079659 FT /rpt_family="MIR" FT repeat_region 3079736..3079882 FT /rpt_family="MIR" FT repeat_region 3079975..3080269 FT /rpt_family="Alu" FT repeat_region 3080545..3080785 FT /rpt_family="Alu" FT repeat_region 3081215..3081510 FT /rpt_family="Alu" FT repeat_region 3081538..3081950 FT /rpt_family="L1" FT repeat_region 3083018..3083125 FT /rpt_family="GA-rich" FT misc_feature 3083142..3083481 FT /note="CpG_island (%GC=77.6, o/e=0.80, #CpGs=35)" FT repeat_region 3083210..3083289 FT /rpt_family="C-rich" FT gene complement(3083301..3083470) FT /gene="CARD11" FT mRNA complement(3083301..3083470) FT /gene="CARD11" FT repeat_region 3083416..3083472 FT /rpt_family="GC_rich" FT repeat_region 3083657..3083699 FT /rpt_family="G-rich" FT repeat_region 3084174..3084477 FT /rpt_family="Alu" FT repeat_region 3084569..3084975 FT /rpt_family="L1" FT repeat_region 3085564..3085586 FT /rpt_family="(TTTA)n" FT repeat_region 3085589..3085865 FT /rpt_family="Alu" FT repeat_region 3085870..3086180 FT /rpt_family="Alu" FT repeat_region 3086313..3086356 FT /rpt_family="L1" FT repeat_region 3086387..3086618 FT /rpt_family="L1" FT repeat_region 3086645..3086755 FT /rpt_family="L1" FT repeat_region 3086797..3087069 FT /rpt_family="Alu" FT repeat_region 3087222..3087369 FT /rpt_family="Alu" FT repeat_region 3087370..3087400 FT /rpt_family="(CATA)n" FT repeat_region 3087489..3087580 FT /rpt_family="MER1_type" FT repeat_region 3087581..3087880 FT /rpt_family="Alu" FT repeat_region 3087881..3087905 FT /rpt_family="MER1_type" FT repeat_region 3087914..3088277 FT /rpt_family="MER1_type" FT repeat_region 3088418..3088730 FT /rpt_family="Alu" FT repeat_region 3089095..3089318 FT /rpt_family="L1" FT repeat_region 3089319..3089539 FT /rpt_family="Alu" FT repeat_region 3089540..3089587 FT /rpt_family="Alu" FT repeat_region 3089590..3089877 FT /rpt_family="Alu" FT repeat_region 3090042..3090295 FT /rpt_family="MER1_type" FT repeat_region 3090606..3091385 FT /rpt_family="L1" FT repeat_region 3091386..3091678 FT /rpt_family="Alu" FT repeat_region 3091679..3091693 FT /rpt_family="L1" FT repeat_region 3091720..3091748 FT /rpt_family="AT_rich" FT repeat_region 3091802..3093100 FT /rpt_family="Mariner" FT repeat_region 3093397..3093486 FT /rpt_family="(TG)n" FT repeat_region 3094418..3094580 FT /rpt_family="ERVL" FT repeat_region 3094713..3095021 FT /rpt_family="Alu" FT repeat_region 3097485..3097803 FT /rpt_family="Alu" FT repeat_region 3098061..3098087 FT /rpt_family="(CA)n" FT repeat_region 3098322..3098473 FT /rpt_family="MER1_type" FT repeat_region 3098474..3098781 FT /rpt_family="Alu" FT repeat_region 3098782..3099108 FT /rpt_family="MER1_type" FT repeat_region 3099113..3099181 FT /rpt_family="L1" FT repeat_region 3099182..3099338 FT /rpt_family="Alu" FT repeat_region 3099339..3099380 FT /rpt_family="L1" FT repeat_region 3099443..3099745 FT /rpt_family="Alu" FT repeat_region 3099881..3100922 FT /rpt_family="L1" FT repeat_region 3100923..3100940 FT /rpt_family="Alu" FT repeat_region 3100941..3100976 FT /rpt_family="(TG)n" FT repeat_region 3100977..3101238 FT /rpt_family="Alu" FT repeat_region 3101239..3102111 FT /rpt_family="L1" FT repeat_region 3102116..3102514 FT /rpt_family="MER1_type" FT repeat_region 3102787..3102906 FT /rpt_family="MIR" FT repeat_region 3103136..3103317 FT /rpt_family="CT-rich" FT repeat_region 3103330..3103641 FT /rpt_family="Alu" FT repeat_region 3103872..3104119 FT /rpt_family="ERVL" FT repeat_region 3104206..3104500 FT /rpt_family="Alu" FT repeat_region 3104903..3105004 FT /rpt_family="MIR" FT repeat_region 3105014..3105058 FT /rpt_family="(TG)n" FT repeat_region 3105762..3105861 FT /rpt_family="ERVL" FT repeat_region 3105968..3106271 FT /rpt_family="Alu" FT repeat_region 3106289..3106389 FT /rpt_family="L1" FT repeat_region 3106850..3107499 FT /rpt_family="ERV1" FT repeat_region 3108295..3108350 FT /rpt_family="L2" FT repeat_region 3108447..3108516 FT /rpt_family="MIR" FT repeat_region 3108518..3108980 FT /rpt_family="MaLR" FT repeat_region 3109239..3109600 FT /rpt_family="ERVL" FT repeat_region 3109601..3109885 FT /rpt_family="MaLR" FT repeat_region 3109947..3110016 FT /rpt_family="Alu" FT repeat_region 3110074..3110202 FT /rpt_family="MaLR" FT repeat_region 3110203..3110463 FT /rpt_family="MaLR" FT repeat_region 3110466..3110674 FT /rpt_family="MaLR" FT repeat_region 3110692..3110739 FT /rpt_family="L1" FT repeat_region 3110740..3110928 FT /rpt_family="MaLR" FT repeat_region 3110929..3111082 FT /rpt_family="MaLR" FT repeat_region 3111139..3111251 FT /rpt_family="ERVL" FT repeat_region 3111706..3112012 FT /rpt_family="Alu" FT repeat_region 3112195..3112221 FT /rpt_family="(TTCA)n" FT repeat_region 3112238..3112277 FT /rpt_family="L2" FT repeat_region 3112308..3112651 FT /rpt_family="L2" FT repeat_region 3112652..3112949 FT /rpt_family="Alu" FT repeat_region 3112950..3113059 FT /rpt_family="L2" FT repeat_region 3113077..3113258 FT /rpt_family="MaLR" FT repeat_region 3113259..3113385 FT /rpt_family="T2_type" FT repeat_region 3113386..3113603 FT /rpt_family="MaLR" FT repeat_region 3113989..3114018 FT /rpt_family="(TTC)n" FT repeat_region 3114519..3114582 FT /rpt_family="(TG)n" FT repeat_region 3114828..3114911 FT /rpt_family="MIR" FT repeat_region 3114912..3115425 FT /rpt_family="L1" FT repeat_region 3115426..3115498 FT /rpt_family="MIR" FT repeat_region 3115610..3116098 FT /rpt_family="MaLR" FT repeat_region 3116118..3116218 FT /rpt_family="MER1_type" FT repeat_region 3116368..3116417 FT /rpt_family="(TATATG)n" FT repeat_region 3116448..3116643 FT /rpt_family="ERVL" FT repeat_region 3116644..3116947 FT /rpt_family="Alu" FT repeat_region 3116948..3117148 FT /rpt_family="ERVL" FT repeat_region 3117659..3117780 FT /rpt_family="L2" FT repeat_region 3118750..3118932 FT /rpt_family="MaLR" FT repeat_region 3118933..3119221 FT /rpt_family="Alu" FT repeat_region 3119222..3119242 FT /rpt_family="MaLR" FT repeat_region 3119243..3119543 FT /rpt_family="Alu" FT repeat_region 3119544..3119762 FT /rpt_family="MaLR" FT repeat_region 3119807..3120186 FT /rpt_family="MaLR" FT repeat_region 3120272..3120565 FT /rpt_family="Alu" FT repeat_region 3120925..3121107 FT /rpt_family="MaLR" FT repeat_region 3121108..3121402 FT /rpt_family="Alu" FT repeat_region 3121501..3121584 FT /rpt_family="Alu" FT repeat_region 3121588..3121619 FT /rpt_family="(TAAA)n" FT repeat_region 3122000..3122299 FT /rpt_family="Alu" FT repeat_region 3122303..3122382 FT /rpt_family="L2" FT repeat_region 3122563..3122781 FT /rpt_family="MaLR" FT repeat_region 3124093..3124528 FT /rpt_family="ERV1" FT repeat_region 3124529..3124837 FT /rpt_family="Alu" FT repeat_region 3124838..3125204 FT /rpt_family="ERV1" FT repeat_region 3125744..3125782 FT /rpt_family="A-rich" FT repeat_region 3127203..3127231 FT /rpt_family="(CAAAA)n" FT repeat_region 3127411..3127734 FT /rpt_family="Alu" FT repeat_region 3128056..3128222 FT /rpt_family="L1" FT repeat_region 3128223..3128522 FT /rpt_family="Alu" FT repeat_region 3128523..3128742 FT /rpt_family="L1" FT repeat_region 3128765..3128865 FT /rpt_family="MIR" FT repeat_region 3129563..3129745 FT /rpt_family="L2" FT repeat_region 3129746..3130056 FT /rpt_family="Alu" FT repeat_region 3130057..3130069 FT /rpt_family="L2" FT repeat_region 3130070..3130338 FT /rpt_family="Alu" FT repeat_region 3130339..3130721 FT /rpt_family="L2" FT repeat_region 3130736..3131020 FT /rpt_family="Alu" FT repeat_region 3131068..3131447 FT /rpt_family="ERVL" FT repeat_region 3131586..3132033 FT /rpt_family="MaLR" FT repeat_region 3132501..3132815 FT /rpt_family="Alu" FT repeat_region 3133423..3133725 FT /rpt_family="Alu" FT repeat_region 3133943..3134115 FT /rpt_family="MIR" FT repeat_region 3135242..3135374 FT /rpt_family="Alu" FT repeat_region 3135391..3135709 FT /rpt_family="Alu" FT repeat_region 3136505..3136861 FT /rpt_family="MaLR" FT repeat_region 3137260..3137391 FT /rpt_family="L2" FT repeat_region 3137539..3137640 FT /rpt_family="MER103" FT repeat_region 3138103..3138390 FT /rpt_family="Alu" FT repeat_region 3138391..3138427 FT /rpt_family="(TA)n" FT repeat_region 3138433..3138962 FT /rpt_family="MER1_type" FT repeat_region 3138970..3139009 FT /rpt_family="MER1_type" FT repeat_region 3139031..3139117 FT /rpt_family="MIR" FT repeat_region 3139225..3139360 FT /rpt_family="ERVL" FT repeat_region 3139530..3139591 FT /rpt_family="MaLR" FT repeat_region 3139796..3139846 FT /rpt_family="L2" FT repeat_region 3139847..3140155 FT /rpt_family="Alu" FT repeat_region 3140156..3140249 FT /rpt_family="L2" FT repeat_region 3140250..3140457 FT /rpt_family="MER1_type" FT repeat_region 3140579..3140679 FT /rpt_family="Alu" FT repeat_region 3140755..3140832 FT /rpt_family="L2" FT repeat_region 3140874..3140935 FT /rpt_family="L2" FT repeat_region 3140944..3141067 FT /rpt_family="Alu" FT repeat_region 3141068..3141141 FT /rpt_family="L2" FT repeat_region 3142217..3142529 FT /rpt_family="Alu" FT repeat_region 3142570..3142860 FT /rpt_family="Alu" FT repeat_region 3142970..3143287 FT /rpt_family="Alu" FT repeat_region 3143505..3143547 FT /rpt_family="MIR" FT repeat_region 3145050..3145343 FT /rpt_family="Alu" FT repeat_region 3145346..3145469 FT /rpt_family="Alu" FT repeat_region 3145483..3145978 FT /rpt_family="MaLR" FT repeat_region 3146423..3146540 FT /rpt_family="L2" FT repeat_region 3147366..3148003 FT /rpt_family="ERV1" FT repeat_region 3148004..3148089 FT /rpt_family="MIR" FT repeat_region 3148090..3148385 FT /rpt_family="Alu" FT repeat_region 3148386..3148436 FT /rpt_family="MIR" FT repeat_region 3149453..3149566 FT /rpt_family="Alu" FT repeat_region 3149568..3149862 FT /rpt_family="Alu" FT repeat_region 3149863..3150042 FT /rpt_family="L1" FT repeat_region 3150043..3150344 FT /rpt_family="Alu" FT repeat_region 3150345..3150783 FT /rpt_family="L1" FT repeat_region 3150784..3151085 FT /rpt_family="Alu" FT repeat_region 3151086..3151223 FT /rpt_family="L1" FT repeat_region 3151229..3151336 FT /rpt_family="MER1_type" FT repeat_region 3151337..3151639 FT /rpt_family="Alu" FT repeat_region 3151648..3151893 FT /rpt_family="MER1_type" FT repeat_region 3151895..3152010 FT /rpt_family="L1" FT repeat_region 3152875..3153064 FT /rpt_family="MIR" FT repeat_region 3153285..3153448 FT /rpt_family="ERVL" FT repeat_region 3153461..3153912 FT /rpt_family="MaLR" FT repeat_region 3153913..3154281 FT /rpt_family="MaLR" FT repeat_region 3157129..3157243 FT /rpt_family="GA-rich" FT repeat_region 3157281..3157450 FT /rpt_family="GA-rich" FT repeat_region 3158083..3158387 FT /rpt_family="Alu" FT repeat_region 3158753..3158889 FT /rpt_family="MIR" FT repeat_region 3159010..3159305 FT /rpt_family="Alu" FT repeat_region 3159390..3159570 FT /rpt_family="MaLR" FT repeat_region 3159755..3159932 FT /rpt_family="(CAT)n" FT repeat_region 3159938..3160041 FT /rpt_family="MIR" FT repeat_region 3160266..3160362 FT /rpt_family="MaLR" FT repeat_region 3160677..3160731 FT /rpt_family="MIR" FT repeat_region 3160764..3161142 FT /rpt_family="L1" FT repeat_region 3168137..3168317 FT /rpt_family="MER1_type" FT repeat_region 3168342..3168509 FT /rpt_family="MER1_type" FT repeat_region 3168813..3169317 FT /rpt_family="ERVL" FT repeat_region 3169318..3169470 FT /rpt_family="MIR" FT repeat_region 3169627..3169890 FT /rpt_family="Alu" FT repeat_region 3169891..3170107 FT /rpt_family="MaLR" FT repeat_region 3170108..3170470 FT /rpt_family="MaLR" FT repeat_region 3170471..3170493 FT /rpt_family="MaLR" FT repeat_region 3170541..3170677 FT /rpt_family="MaLR" FT repeat_region 3170686..3170767 FT /rpt_family="ERVL" FT repeat_region 3170784..3171140 FT /rpt_family="MaLR" FT repeat_region 3171154..3171961 FT /rpt_family="L1" FT repeat_region 3171962..3172190 FT /rpt_family="Alu" FT repeat_region 3172191..3172210 FT /rpt_family="L1" FT repeat_region 3172212..3172334 FT /rpt_family="L1" FT repeat_region 3172335..3173796 FT /rpt_family="L1" FT repeat_region 3173801..3173839 FT /rpt_family="ERVL" FT repeat_region 3173987..3174248 FT /rpt_family="Alu" FT repeat_region 3174281..3174733 FT /rpt_family="MaLR" FT repeat_region 3175588..3175656 FT /rpt_family="MaLR" FT repeat_region 3175665..3175963 FT /rpt_family="Alu" FT repeat_region 3176123..3176420 FT /rpt_family="L2" FT repeat_region 3176421..3176731 FT /rpt_family="Alu" FT repeat_region 3176732..3177076 FT /rpt_family="L2" FT repeat_region 3177147..3177226 FT /rpt_family="Alu" FT repeat_region 3177227..3177265 FT /rpt_family="(CAAA)n" FT repeat_region 3177266..3177436 FT /rpt_family="Alu" FT repeat_region 3177447..3177730 FT /rpt_family="Alu" FT repeat_region 3177750..3178260 FT /rpt_family="MaLR" FT repeat_region 3178421..3178517 FT /rpt_family="MER1_type" FT repeat_region 3178517..3179130 FT /rpt_family="MER1_type" FT repeat_region 3179254..3179436 FT /rpt_family="Alu" FT repeat_region 3179441..3179489 FT /rpt_family="CR1" FT repeat_region 3180843..3180880 FT /rpt_family="MIR" FT repeat_region 3180881..3181190 FT /rpt_family="Alu" FT repeat_region 3181191..3181386 FT /rpt_family="MIR" FT repeat_region 3181411..3181685 FT /rpt_family="Alu" FT repeat_region 3181765..3181877 FT /rpt_family="MIR" FT repeat_region 3182130..3182534 FT /rpt_family="L1" FT repeat_region 3182712..3183016 FT /rpt_family="Alu" FT repeat_region 3183020..3183043 FT /rpt_family="AT_rich" FT repeat_region 3183052..3183192 FT /rpt_family="Alu" FT repeat_region 3183220..3183230 FT /rpt_family="Alu" FT repeat_region 3183231..3183256 FT /rpt_family="(CCA)n" FT repeat_region 3183257..3183433 FT /rpt_family="Alu" FT repeat_region 3183518..3183542 FT /rpt_family="AT_rich" FT repeat_region 3184542..3184845 FT /rpt_family="Alu" FT repeat_region 3184986..3185099 FT /rpt_family="MaLR" FT repeat_region 3185191..3185245 FT /rpt_family="MER1_type" FT repeat_region 3185246..3185541 FT /rpt_family="Alu" FT repeat_region 3185542..3185641 FT /rpt_family="MER1_type" FT repeat_region 3185971..3185992 FT /rpt_family="AT_rich" FT repeat_region 3186106..3186338 FT /rpt_family="Alu" FT repeat_region 3187080..3187400 FT /rpt_family="Alu" FT repeat_region 3187722..3188020 FT /rpt_family="Alu" FT repeat_region 3188021..3188315 FT /rpt_family="Alu" FT repeat_region 3188316..3188532 FT /rpt_family="Alu" FT repeat_region 3188533..3188917 FT /rpt_family="MaLR" FT repeat_region 3188918..3189011 FT /rpt_family="Alu" FT repeat_region 3190222..3190393 FT /rpt_family="Alu" FT repeat_region 3190394..3190414 FT /rpt_family="(TTA)n" FT repeat_region 3190415..3190491 FT /rpt_family="Alu" FT repeat_region 3190635..3190783 FT /rpt_family="L1" FT repeat_region 3190847..3191156 FT /rpt_family="Alu" FT repeat_region 3191181..3191580 FT /rpt_family="L1" FT repeat_region 3191581..3191690 FT /rpt_family="MIR" FT repeat_region 3191772..3191821 FT /rpt_family="(TTA)n" FT repeat_region 3192023..3192331 FT /rpt_family="Alu" FT repeat_region 3192351..3192400 FT /rpt_family="(GGAA)n" FT repeat_region 3192478..3192628 FT /rpt_family="MIR" FT repeat_region 3193584..3193622 FT /rpt_family="(TG)n" FT repeat_region 3193718..3194048 FT /rpt_family="Alu" FT repeat_region 3194377..3194877 FT /rpt_family="L1" FT repeat_region 3194878..3195181 FT /rpt_family="Alu" FT repeat_region 3195182..3195656 FT /rpt_family="L1" FT repeat_region 3195659..3195971 FT /rpt_family="Alu" FT repeat_region 3196138..3196352 FT /rpt_family="MER1_type" FT repeat_region 3196360..3196562 FT /rpt_family="MER1_type" FT repeat_region 3196601..3196756 FT /rpt_family="Alu" FT repeat_region 3196717..3196737 FT /rpt_family="AT_rich" FT repeat_region 3196758..3197034 FT /rpt_family="Alu" FT repeat_region 3198244..3198275 FT /rpt_family="(A)n" FT repeat_region 3198637..3199181 FT /rpt_family="ERV1" FT repeat_region 3199587..3199610 FT /rpt_family="AT_rich" FT repeat_region 3199762..3199800 FT /rpt_family="L1" FT repeat_region 3199801..3200231 FT /rpt_family="ERVL" FT repeat_region 3200232..3200373 FT /rpt_family="L1" FT repeat_region 3200375..3200550 FT /rpt_family="Alu" FT repeat_region 3200554..3200602 FT /rpt_family="L1" FT repeat_region 3200670..3200694 FT /rpt_family="(TG)n" FT repeat_region 3200908..3201190 FT /rpt_family="Alu" FT repeat_region 3201290..3201406 FT /rpt_family="Alu" FT repeat_region 3201425..3201484 FT /rpt_family="MIR" FT repeat_region 3201525..3201656 FT /rpt_family="Alu" FT repeat_region 3201700..3202009 FT /rpt_family="Alu" FT repeat_region 3202428..3202779 FT /rpt_family="MaLR" FT repeat_region 3203383..3203691 FT /rpt_family="Alu" FT repeat_region 3205260..3205369 FT /rpt_family="MIR" FT repeat_region 3205375..3205478 FT /rpt_family="MaLR" FT repeat_region 3205479..3205793 FT /rpt_family="Alu" FT repeat_region 3205794..3206076 FT /rpt_family="MaLR" FT repeat_region 3206079..3206263 FT /rpt_family="Alu" FT repeat_region 3206278..3206581 FT /rpt_family="Alu" FT repeat_region 3206586..3206648 FT /rpt_family="MaLR" FT repeat_region 3206994..3207023 FT /rpt_family="(CCCCCA)n" FT repeat_region 3207892..3207914 FT /rpt_family="(TTTG)n" FT repeat_region 3208528..3209046 FT /rpt_family="ERVL" FT repeat_region 3209064..3209364 FT /rpt_family="Alu" FT repeat_region 3209488..3209553 FT /rpt_family="(TA)n" FT repeat_region 3209591..3209905 FT /rpt_family="Alu" FT repeat_region 3209961..3210198 FT /rpt_family="ERVL" FT repeat_region 3210583..3210736 FT /rpt_family="ERVL" FT repeat_region 3210815..3211114 FT /rpt_family="MER2_type" FT repeat_region 3212046..3212117 FT /rpt_family="MaLR" FT repeat_region 3212126..3212427 FT /rpt_family="Alu" FT repeat_region 3212504..3212770 FT /rpt_family="MaLR" FT repeat_region 3212990..3213042 FT /rpt_family="L2" FT repeat_region 3213165..3213475 FT /rpt_family="Alu" FT repeat_region 3215757..3216084 FT /rpt_family="Alu" FT repeat_region 3216399..3216838 FT /rpt_family="MaLR" FT repeat_region 3216897..3217197 FT /rpt_family="L1" FT repeat_region 3217300..3217906 FT /rpt_family="MER2_type" FT repeat_region 3218132..3218432 FT /rpt_family="Alu" FT repeat_region 3219137..3219437 FT /rpt_family="L2" FT repeat_region 3219635..3219772 FT /rpt_family="Alu" FT repeat_region 3219842..3219888 FT /rpt_family="(CAAAAA)n" FT repeat_region 3219971..3220083 FT /rpt_family="Alu" FT repeat_region 3220105..3220134 FT /rpt_family="AT_rich" FT repeat_region 3220142..3220380 FT /rpt_family="L2" FT repeat_region 3220671..3220985 FT /rpt_family="Alu" FT repeat_region 3221791..3222064 FT /rpt_family="Alu" FT repeat_region 3222328..3222364 FT /rpt_family="(TG)n" FT repeat_region 3222505..3222602 FT /rpt_family="MER1_type" FT repeat_region 3222609..3222767 FT /rpt_family="MER1_type" FT repeat_region 3222833..3223382 FT /rpt_family="MaLR" FT repeat_region 3223476..3223778 FT /rpt_family="Alu" FT repeat_region 3223817..3223975 FT /rpt_family="MIR" FT repeat_region 3224377..3224587 FT /rpt_family="L1" FT repeat_region 3224588..3224659 FT /rpt_family="L1" FT repeat_region 3224960..3225273 FT /rpt_family="Alu" FT repeat_region 3225400..3225709 FT /rpt_family="Alu" FT repeat_region 3225721..3226038 FT /rpt_family="Alu" FT repeat_region 3226178..3226294 FT /rpt_family="L1" FT repeat_region 3226295..3226597 FT /rpt_family="Alu" FT misc_feature 3226298..3226531 FT /note="CpG_island (%GC=59.8, o/e=0.86, #CpGs=19)" FT repeat_region 3226598..3226769 FT /rpt_family="L1" FT repeat_region 3226770..3227139 FT /rpt_family="L1" FT repeat_region 3227140..3227441 FT /rpt_family="L1" FT repeat_region 3227545..3227846 FT /rpt_family="Alu" FT repeat_region 3227859..3228148 FT /rpt_family="Alu" FT repeat_region 3228422..3228540 FT /rpt_family="L1" FT repeat_region 3229296..3229446 FT /rpt_family="Alu" FT repeat_region 3229624..3229700 FT /rpt_family="MIR" FT repeat_region 3229771..3230062 FT /rpt_family="Alu" FT repeat_region 3230312..3230395 FT /rpt_family="MaLR" FT repeat_region 3230396..3230698 FT /rpt_family="Alu" FT repeat_region 3230699..3231023 FT /rpt_family="MaLR" FT repeat_region 3231182..3231550 FT /rpt_family="MaLR" FT repeat_region 3231939..3232048 FT /rpt_family="MIR" FT repeat_region 3232986..3233492 FT /rpt_family="ERV1" FT repeat_region 3233524..3233563 FT /rpt_family="ERV1" FT repeat_region 3233696..3234205 FT /rpt_family="ERV1" FT repeat_region 3234258..3234437 FT /rpt_family="ERVL" FT repeat_region 3234424..3234591 FT /rpt_family="ERVL" FT repeat_region 3234802..3234953 FT /rpt_family="L2" FT repeat_region 3234954..3235236 FT /rpt_family="Alu" FT repeat_region 3235237..3235527 FT /rpt_family="L2" FT repeat_region 3235749..3235870 FT /rpt_family="MER1_type" FT repeat_region 3236194..3236263 FT /rpt_family="L2" FT repeat_region 3237350..3237454 FT /rpt_family="L1" FT repeat_region 3237837..3237957 FT /rpt_family="L1" FT repeat_region 3237952..3238858 FT /rpt_family="L1" FT repeat_region 3238859..3239155 FT /rpt_family="Alu" FT misc_feature 3238878..3239152 FT /note="CpG_island (%GC=59.6, o/e=0.81, #CpGs=21)" FT repeat_region 3239156..3239602 FT /rpt_family="L1" FT repeat_region 3239628..3240041 FT /rpt_family="MaLR" FT repeat_region 3240469..3240586 FT /rpt_family="MIR" FT repeat_region 3241167..3241544 FT /rpt_family="MaLR" FT repeat_region 3241595..3241681 FT /rpt_family="MIR" FT repeat_region 3242129..3242178 FT /rpt_family="L2" FT repeat_region 3242215..3242321 FT /rpt_family="MER1_type" FT repeat_region 3242323..3242463 FT /rpt_family="Alu" FT repeat_region 3242484..3242917 FT /rpt_family="MER1_type" FT repeat_region 3242918..3243224 FT /rpt_family="Alu" FT repeat_region 3243225..3243387 FT /rpt_family="MER1_type" FT repeat_region 3243414..3243449 FT /rpt_family="MER1_type" FT repeat_region 3243493..3243725 FT /rpt_family="MaLR" FT repeat_region 3243726..3244039 FT /rpt_family="Alu" FT repeat_region 3244040..3244196 FT /rpt_family="MaLR" FT repeat_region 3244400..3244498 FT /rpt_family="MER1_type" FT repeat_region 3244424..3244526 FT /rpt_family="MER1_type" FT repeat_region 3244528..3244735 FT /rpt_family="L2" FT repeat_region 3244981..3245018 FT /rpt_family="(TTTTC)n" FT repeat_region 3245030..3245343 FT /rpt_family="Alu" FT repeat_region 3245442..3245732 FT /rpt_family="Alu" FT repeat_region 3246153..3246327 FT /rpt_family="MIR" FT repeat_region 3246384..3246555 FT /rpt_family="MER1_type" FT repeat_region 3246765..3246855 FT /rpt_family="MER1_type" FT repeat_region 3246856..3246908 FT /rpt_family="(TG)n" FT repeat_region 3246909..3247032 FT /rpt_family="MER1_type" FT repeat_region 3247504..3247577 FT /rpt_family="A-rich" FT repeat_region 3247751..3247895 FT /rpt_family="Alu" FT repeat_region 3247896..3248195 FT /rpt_family="Alu" FT repeat_region 3248196..3248373 FT /rpt_family="Alu" FT repeat_region 3248583..3248966 FT /rpt_family="ERV1" FT repeat_region 3248967..3249278 FT /rpt_family="Alu" FT repeat_region 3249279..3249362 FT /rpt_family="ERV1" FT repeat_region 3249363..3249669 FT /rpt_family="L1" FT repeat_region 3249670..3249733 FT /rpt_family="ERV1" FT repeat_region 3249734..3250031 FT /rpt_family="Alu" FT repeat_region 3250032..3250240 FT /rpt_family="ERV1" FT repeat_region 3250542..3250847 FT /rpt_family="Alu" FT repeat_region 3251110..3251181 FT /rpt_family="ERV1" FT repeat_region 3251182..3251453 FT /rpt_family="Alu" FT repeat_region 3251454..3251767 FT /rpt_family="ERV1" FT repeat_region 3251782..3251848 FT /rpt_family="ERV1" FT repeat_region 3251849..3251891 FT /rpt_family="(CA)n" FT repeat_region 3251892..3251927 FT /rpt_family="ERV1" FT repeat_region 3251928..3252096 FT /rpt_family="Alu" FT repeat_region 3252097..3252397 FT /rpt_family="Alu" FT repeat_region 3252398..3252524 FT /rpt_family="ERV1" FT repeat_region 3252574..3252884 FT /rpt_family="Alu" FT repeat_region 3252891..3253093 FT /rpt_family="ERV1" FT repeat_region 3253094..3253400 FT /rpt_family="Alu" FT repeat_region 3253401..3253492 FT /rpt_family="ERV1" FT repeat_region 3253507..3253614 FT /rpt_family="ERV1" FT repeat_region 3253618..3253913 FT /rpt_family="Alu" FT repeat_region 3254016..3254311 FT /rpt_family="Alu" FT repeat_region 3254325..3254736 FT /rpt_family="ERV1" FT repeat_region 3254737..3255025 FT /rpt_family="Alu" FT repeat_region 3255037..3255082 FT /rpt_family="ERV1" FT repeat_region 3255344..3255526 FT /rpt_family="MIR" FT repeat_region 3256100..3256190 FT /rpt_family="MIR" FT repeat_region 3256179..3256411 FT /rpt_family="MIR" FT repeat_region 3256431..3256535 FT /rpt_family="MIR" FT repeat_region 3256578..3256862 FT /rpt_family="Alu" FT repeat_region 3257265..3257348 FT /rpt_family="MIR" FT repeat_region 3257349..3257663 FT /rpt_family="Alu" FT repeat_region 3257664..3257821 FT /rpt_family="MIR" FT repeat_region 3258774..3259062 FT /rpt_family="CR1" FT repeat_region 3259089..3259148 FT /rpt_family="Mariner" FT repeat_region 3259231..3259534 FT /rpt_family="L1" FT repeat_region 3259537..3260700 FT /rpt_family="Mariner" FT repeat_region 3260701..3260787 FT /rpt_family="L1" FT repeat_region 3261004..3261112 FT /rpt_family="L1" FT repeat_region 3261113..3261414 FT /rpt_family="Alu" FT repeat_region 3261415..3261956 FT /rpt_family="L1" FT repeat_region 3262087..3262127 FT /rpt_family="(TTTA)n" FT repeat_region 3262130..3262313 FT /rpt_family="Alu" FT repeat_region 3262314..3262698 FT /rpt_family="MaLR" FT repeat_region 3262699..3262802 FT /rpt_family="Alu" FT repeat_region 3262803..3263430 FT /rpt_family="L1" FT repeat_region 3263431..3263455 FT /rpt_family="(TG)n" FT repeat_region 3263456..3263600 FT /rpt_family="L1" FT repeat_region 3263594..3265367 FT /rpt_family="L1" FT repeat_region 3265380..3267063 FT /rpt_family="L1" FT repeat_region 3267088..3267108 FT /rpt_family="(T)n" FT repeat_region 3267109..3267320 FT /rpt_family="L1" FT repeat_region 3267321..3267374 FT /rpt_family="Alu" FT repeat_region 3267375..3267809 FT /rpt_family="L1" FT repeat_region 3267794..3268013 FT /rpt_family="L1" FT repeat_region 3268014..3268326 FT /rpt_family="Alu" FT repeat_region 3268327..3269201 FT /rpt_family="L1" FT repeat_region 3269202..3269568 FT /rpt_family="MaLR" FT repeat_region 3269569..3269759 FT /rpt_family="L1" FT repeat_region 3269760..3270185 FT /rpt_family="MaLR" FT repeat_region 3270189..3271164 FT /rpt_family="L1" FT repeat_region 3271170..3271191 FT /rpt_family="AT_rich" FT repeat_region 3271308..3271324 FT /rpt_family="Alu" FT repeat_region 3271325..3271356 FT /rpt_family="(TG)n" FT repeat_region 3271357..3271640 FT /rpt_family="Alu" FT repeat_region 3271764..3271926 FT /rpt_family="(TG)n" FT repeat_region 3273694..3273782 FT /rpt_family="G-rich" FT repeat_region 3274057..3274370 FT /rpt_family="Alu" FT repeat_region 3274547..3274638 FT /rpt_family="MER1_type" FT repeat_region 3274769..3275070 FT /rpt_family="L2" FT repeat_region 3275090..3275213 FT /rpt_family="(ATGGTG)n" FT repeat_region 3275221..3275399 FT /rpt_family="(TGG)n" FT repeat_region 3275680..3276214 FT /rpt_family="MaLR" FT repeat_region 3277724..3277821 FT /rpt_family="MIR" FT repeat_region 3277822..3278181 FT /rpt_family="MaLR" FT repeat_region 3278182..3278309 FT /rpt_family="MIR" FT repeat_region 3279316..3279461 FT /rpt_family="L1" FT repeat_region 3279462..3279775 FT /rpt_family="Alu" FT repeat_region 3279776..3279794 FT /rpt_family="L1" FT repeat_region 3279801..3280133 FT /rpt_family="Alu" FT repeat_region 3280135..3280439 FT /rpt_family="L1" FT repeat_region 3280934..3281241 FT /rpt_family="Alu" FT repeat_region 3282103..3282327 FT /rpt_family="L1" FT repeat_region 3282334..3282640 FT /rpt_family="Alu" FT repeat_region 3282643..3282728 FT /rpt_family="MIR" FT repeat_region 3283140..3283188 FT /rpt_family="MIR" FT repeat_region 3283189..3283476 FT /rpt_family="Alu" FT repeat_region 3283477..3283600 FT /rpt_family="MIR" FT repeat_region 3285036..3285352 FT /rpt_family="Alu" FT repeat_region 3286356..3286494 FT /rpt_family="L2" FT repeat_region 3286494..3286658 FT /rpt_family="L2" FT repeat_region 3286686..3286777 FT /rpt_family="L1" FT repeat_region 3286896..3287061 FT /rpt_family="L1" FT repeat_region 3287064..3287346 FT /rpt_family="Alu" FT repeat_region 3287405..3287497 FT /rpt_family="L1" FT repeat_region 3287498..3287709 FT /rpt_family="Alu" FT repeat_region 3287712..3288005 FT /rpt_family="Alu" FT repeat_region 3288313..3288583 FT /rpt_family="AcHobo" FT repeat_region 3288584..3288860 FT /rpt_family="Alu" FT repeat_region 3288861..3288901 FT /rpt_family="AcHobo" FT repeat_region 3288902..3289199 FT /rpt_family="Alu" FT repeat_region 3289200..3289275 FT /rpt_family="AcHobo" FT repeat_region 3289452..3289748 FT /rpt_family="Alu" FT repeat_region 3290075..3290376 FT /rpt_family="Alu" FT repeat_region 3291043..3291351 FT /rpt_family="Alu" FT repeat_region 3291718..3292018 FT /rpt_family="Alu" FT repeat_region 3292687..3293484 FT /rpt_family="L1" FT repeat_region 3293485..3293780 FT /rpt_family="Alu" FT repeat_region 3293781..3293882 FT /rpt_family="L1" FT repeat_region 3293905..3293982 FT /rpt_family="MER2_type" FT repeat_region 3293983..3294145 FT /rpt_family="ERV1" FT repeat_region 3294146..3294439 FT /rpt_family="Alu" FT repeat_region 3294440..3294911 FT /rpt_family="ERV1" FT repeat_region 3294912..3295292 FT /rpt_family="MER2_type" FT repeat_region 3295293..3295595 FT /rpt_family="Alu" FT repeat_region 3295596..3295797 FT /rpt_family="MER2_type" FT repeat_region 3295816..3295889 FT /rpt_family="(TATAA)n" FT repeat_region 3295990..3296069 FT /rpt_family="Alu" FT repeat_region 3296098..3296228 FT /rpt_family="Alu" FT repeat_region 3296229..3296527 FT /rpt_family="Alu" FT repeat_region 3296539..3296896 FT /rpt_family="ERV1" FT repeat_region 3296956..3297028 FT /rpt_family="ERV1" FT repeat_region 3297222..3297509 FT /rpt_family="Alu" FT repeat_region 3297513..3297544 FT /rpt_family="(CAAT)n" FT repeat_region 3297545..3297952 FT /rpt_family="MaLR" FT repeat_region 3297954..3298339 FT /rpt_family="L1" FT repeat_region 3298696..3298898 FT /rpt_family="Alu" FT repeat_region 3298899..3299239 FT /rpt_family="ERV1" FT repeat_region 3299242..3299329 FT /rpt_family="ERV1" FT repeat_region 3299330..3299435 FT /rpt_family="Alu" FT repeat_region 3299464..3300016 FT /rpt_family="ERV1" FT repeat_region 3300751..3300903 FT /rpt_family="L1" FT repeat_region 3300904..3301238 FT /rpt_family="ERV1" FT repeat_region 3301239..3301544 FT /rpt_family="Alu" FT repeat_region 3301545..3301806 FT /rpt_family="ERV1" FT repeat_region 3301807..3301975 FT /rpt_family="L1" FT repeat_region 3302308..3302792 FT /rpt_family="ERV1" FT repeat_region 3302811..3302833 FT /rpt_family="(TTC)n" FT repeat_region 3302836..3302999 FT /rpt_family="Alu" FT repeat_region 3303000..3303034 FT /rpt_family="(TTTG)n" FT repeat_region 3303035..3303166 FT /rpt_family="Alu" FT repeat_region 3303167..3303265 FT /rpt_family="Alu" FT repeat_region 3303268..3303319 FT /rpt_family="ERV1" FT repeat_region 3306166..3306455 FT /rpt_family="Alu" FT repeat_region 3306499..3306671 FT /rpt_family="Alu" FT repeat_region 3306675..3306983 FT /rpt_family="Alu" FT repeat_region 3306984..3307011 FT /rpt_family="(TA)n" FT repeat_region 3307012..3307310 FT /rpt_family="Alu" FT repeat_region 3307317..3307347 FT /rpt_family="AT_rich" FT repeat_region 3308352..3308646 FT /rpt_family="Alu" FT repeat_region 3309320..3309476 FT /rpt_family="Alu" FT repeat_region 3309493..3309605 FT /rpt_family="L1" FT repeat_region 3309826..3309925 FT /rpt_family="Alu" FT repeat_region 3309988..3310416 FT /rpt_family="(ATG)n" FT repeat_region 3310444..3310531 FT /rpt_family="(ATG)n" FT repeat_region 3310532..3310971 FT /rpt_family="ERVL" FT repeat_region 3310972..3311230 FT /rpt_family="(ATG)n" FT repeat_region 3311234..3311280 FT /rpt_family="(ATGGTG)n" FT repeat_region 3311286..3311507 FT /rpt_family="MIR" FT repeat_region 3311690..3311994 FT /rpt_family="Alu" FT repeat_region 3312207..3312394 FT /rpt_family="MIR" FT repeat_region 3313298..3313648 FT /rpt_family="MaLR" FT repeat_region 3313649..3313674 FT /rpt_family="(T)n" FT repeat_region 3314007..3314256 FT /rpt_family="L2" FT repeat_region 3314257..3314335 FT /rpt_family="MaLR" FT repeat_region 3314336..3314636 FT /rpt_family="Alu" FT repeat_region 3314637..3314917 FT /rpt_family="MaLR" FT repeat_region 3314918..3314987 FT /rpt_family="L2" FT repeat_region 3314988..3315274 FT /rpt_family="Alu" FT repeat_region 3315275..3315453 FT /rpt_family="L2" FT repeat_region 3315466..3315520 FT /rpt_family="MER1_type" FT repeat_region 3315740..3315873 FT /rpt_family="Alu" FT repeat_region 3315878..3316167 FT /rpt_family="Alu" FT repeat_region 3316178..3316412 FT /rpt_family="MER1_type" FT repeat_region 3316413..3316709 FT /rpt_family="Alu" FT repeat_region 3316710..3316819 FT /rpt_family="MER1_type" FT repeat_region 3316838..3316903 FT /rpt_family="MER1_type" FT repeat_region 3317082..3317601 FT /rpt_family="L1" FT repeat_region 3317602..3317891 FT /rpt_family="L1" FT repeat_region 3317904..3317972 FT /rpt_family="MER1_type" FT repeat_region 3317981..3318038 FT /rpt_family="L2" FT repeat_region 3318039..3318171 FT /rpt_family="MER1_type" FT repeat_region 3318172..3318191 FT /rpt_family="(TTG)n" FT repeat_region 3318194..3318482 FT /rpt_family="Alu" FT repeat_region 3318483..3318586 FT /rpt_family="MER1_type" FT repeat_region 3318587..3318813 FT /rpt_family="L2" FT repeat_region 3318831..3319011 FT /rpt_family="GA-rich" FT repeat_region 3319041..3319223 FT /rpt_family="GA-rich" FT repeat_region 3319760..3320074 FT /rpt_family="Alu" FT repeat_region 3320519..3320664 FT /rpt_family="L2" FT repeat_region 3320953..3321189 FT /rpt_family="Alu" FT repeat_region 3321473..3321559 FT /rpt_family="MIR" FT repeat_region 3321766..3321791 FT /rpt_family="AT_rich" FT repeat_region 3321792..3321912 FT /rpt_family="Alu" FT repeat_region 3322534..3322826 FT /rpt_family="Alu" FT repeat_region 3323497..3323802 FT /rpt_family="Alu" FT repeat_region 3323875..3323889 FT /rpt_family="L1" FT repeat_region 3323890..3324336 FT /rpt_family="L1" FT repeat_region 3324388..3324686 FT /rpt_family="Alu" FT repeat_region 3324687..3324878 FT /rpt_family="CR1" FT repeat_region 3324879..3325144 FT /rpt_family="Alu" FT repeat_region 3325145..3325298 FT /rpt_family="CR1" FT repeat_region 3325723..3325787 FT /rpt_family="MIR" FT repeat_region 3326174..3326447 FT /rpt_family="Alu" FT repeat_region 3326540..3326960 FT /rpt_family="MaLR" FT repeat_region 3327073..3327535 FT /rpt_family="L1" FT repeat_region 3327593..3327932 FT /rpt_family="L1" FT repeat_region 3328339..3328580 FT /rpt_family="MaLR" FT repeat_region 3328581..3328895 FT /rpt_family="Alu" FT repeat_region 3328896..3328972 FT /rpt_family="MaLR" FT repeat_region 3328973..3329255 FT /rpt_family="Alu" FT repeat_region 3329256..3329361 FT /rpt_family="MaLR" FT repeat_region 3329505..3329944 FT /rpt_family="MaLR" FT repeat_region 3329945..3329967 FT /rpt_family="(T)n" FT repeat_region 3329969..3330106 FT /rpt_family="MIR" FT repeat_region 3330094..3330168 FT /rpt_family="L2" FT repeat_region 3330179..3330301 FT /rpt_family="CR1" FT repeat_region 3330465..3330770 FT /rpt_family="Alu" FT repeat_region 3330822..3330985 FT /rpt_family="Alu" FT repeat_region 3330999..3331020 FT /rpt_family="AT_rich" FT repeat_region 3331097..3331244 FT /rpt_family="MIR" FT repeat_region 3331285..3331530 FT /rpt_family="L2" FT repeat_region 3331680..3331980 FT /rpt_family="Alu" FT repeat_region 3332127..3332426 FT /rpt_family="Alu" FT repeat_region 3332464..3332716 FT /rpt_family="L2" FT repeat_region 3332717..3333028 FT /rpt_family="Alu" FT repeat_region 3333029..3333152 FT /rpt_family="L2" FT repeat_region 3333171..3333397 FT /rpt_family="Alu" FT repeat_region 3333449..3333649 FT /rpt_family="L2" FT repeat_region 3333797..3333832 FT /rpt_family="MER1_type" FT repeat_region 3333833..3334143 FT /rpt_family="Alu" FT repeat_region 3334170..3334292 FT /rpt_family="MER1_type" FT repeat_region 3334947..3335026 FT /rpt_family="Alu" FT repeat_region 3335260..3335365 FT /rpt_family="L1" FT repeat_region 3335366..3335663 FT /rpt_family="Alu" FT repeat_region 3335664..3335759 FT /rpt_family="L1" FT repeat_region 3335842..3336138 FT /rpt_family="Alu" FT repeat_region 3336208..3336489 FT /rpt_family="Alu" FT repeat_region 3336829..3336983 FT /rpt_family="MER1_type" FT repeat_region 3337150..3337389 FT /rpt_family="GA-rich" FT repeat_region 3337726..3337868 FT /rpt_family="MIR" FT repeat_region 3337939..3338117 FT /rpt_family="Alu" FT repeat_region 3338118..3338147 FT /rpt_family="(TTTA)n" FT repeat_region 3338148..3338271 FT /rpt_family="Alu" FT repeat_region 3338619..3338732 FT /rpt_family="MIR" FT repeat_region 3338859..3339058 FT /rpt_family="Alu" FT repeat_region 3339061..3339111 FT /rpt_family="(TTC)n" FT repeat_region 3339112..3339242 FT /rpt_family="Alu" FT repeat_region 3339244..3339274 FT /rpt_family="MIR" FT misc_feature 3340355..3341733 FT /note="CpG_island (%GC=79.3, o/e=0.92, #CpGs=227)" FT repeat_region 3340777..3340884 FT /rpt_family="(CGGG)n" FT repeat_region 3340904..3340927 FT /rpt_family="(CGG)n" FT repeat_region 3341034..3341054 FT /rpt_family="GC_rich" FT repeat_region 3341106..3341149 FT /rpt_family="GC_rich" FT repeat_region 3341221..3341439 FT /rpt_family="GC_rich" FT repeat_region 3341523..3341564 FT /rpt_family="GC_rich" FT repeat_region 3344229..3344280 FT /rpt_family="MER1_type" FT repeat_region 3344320..3344363 FT /rpt_family="MER1_type" FT repeat_region 3344428..3344608 FT /rpt_family="MER1_type" FT repeat_region 3344830..3344948 FT /rpt_family="MER1_type" FT repeat_region 3344959..3344981 FT /rpt_family="AT_rich" FT repeat_region 3345458..3345647 FT /rpt_family="MIR" FT repeat_region 3347341..3347515 FT /rpt_family="MIR" FT repeat_region 3349525..3349597 FT /rpt_family="MaLR" FT repeat_region 3349598..3349622 FT /rpt_family="ERVL" FT repeat_region 3349938..3350384 FT /rpt_family="L2" FT repeat_region 3350385..3350641 FT /rpt_family="MIR" FT repeat_region 3350908..3351091 FT /rpt_family="L2" FT repeat_region 3351357..3352592 FT /rpt_family="L1" FT repeat_region 3352759..3353041 FT /rpt_family="Alu" FT repeat_region 3353301..3353571 FT /rpt_family="L1" FT repeat_region 3353617..3353734 FT /rpt_family="L2" FT repeat_region 3354960..3355073 FT /rpt_family="MIR" FT repeat_region 3355774..3355813 FT /rpt_family="AT_rich" FT repeat_region 3355823..3356161 FT /rpt_family="MER2_type" FT repeat_region 3356532..3356840 FT /rpt_family="Alu" FT repeat_region 3357900..3358123 FT /rpt_family="MIR" FT repeat_region 3361312..3361470 FT /rpt_family="CT-rich" FT repeat_region 3361468..3361494 FT /rpt_family="(TC)n" FT repeat_region 3361667..3362265 FT /rpt_family="L1" FT repeat_region 3362474..3362733 FT /rpt_family="Alu" FT repeat_region 3362876..3362955 FT /rpt_family="L2" FT repeat_region 3363082..3363385 FT /rpt_family="MaLR" FT repeat_region 3363872..3364033 FT /rpt_family="L1" FT repeat_region 3364384..3364404 FT /rpt_family="AT_rich" FT repeat_region 3365751..3365954 FT /rpt_family="L1" FT repeat_region 3366002..3366277 FT /rpt_family="L1" FT repeat_region 3366284..3366328 FT /rpt_family="AT_rich" FT repeat_region 3366366..3366457 FT /rpt_family="L1" FT repeat_region 3366655..3366963 FT /rpt_family="CR1" FT repeat_region 3367255..3367521 FT /rpt_family="MER2_type" FT repeat_region 3368134..3368162 FT /rpt_family="AT_rich" FT repeat_region 3368740..3368760 FT /rpt_family="AT_rich" FT repeat_region 3368979..3369333 FT /rpt_family="L1" FT repeat_region 3369334..3369648 FT /rpt_family="MER2_type" FT repeat_region 3369659..3369957 FT /rpt_family="L1" FT repeat_region 3369992..3370322 FT /rpt_family="MaLR" FT repeat_region 3370323..3370613 FT /rpt_family="Alu" FT repeat_region 3370617..3370918 FT /rpt_family="Alu" FT repeat_region 3370919..3370960 FT /rpt_family="MaLR" FT repeat_region 3370970..3371293 FT /rpt_family="L1" FT repeat_region 3374316..3374993 FT /rpt_family="L2" FT repeat_region 3375036..3375178 FT /rpt_family="L2" FT repeat_region 3375467..3375836 FT /rpt_family="L1" FT repeat_region 3375864..3376098 FT /rpt_family="L1" FT repeat_region 3376576..3377716 FT /rpt_family="L1" FT repeat_region 3378244..3378270 FT /rpt_family="(CAAA)n" FT repeat_region 3378322..3379235 FT /rpt_family="L1" FT repeat_region 3379259..3379731 FT /rpt_family="L1" FT repeat_region 3379823..3380006 FT /rpt_family="MER2_type" FT repeat_region 3380004..3380112 FT /rpt_family="MER2_type" FT repeat_region 3380113..3380414 FT /rpt_family="Alu" FT repeat_region 3380415..3380456 FT /rpt_family="MER2_type" FT repeat_region 3380472..3381938 FT /rpt_family="L1" FT repeat_region 3381939..3382239 FT /rpt_family="Alu" FT repeat_region 3382240..3383361 FT /rpt_family="L1" FT repeat_region 3383451..3383655 FT /rpt_family="L1" FT repeat_region 3383876..3384011 FT /rpt_family="L1" FT repeat_region 3386140..3386292 FT /rpt_family="Alu" FT repeat_region 3386313..3386345 FT /rpt_family="(TG)n" FT repeat_region 3386346..3386460 FT /rpt_family="(TA)n" FT repeat_region 3386468..3386602 FT /rpt_family="Alu" FT repeat_region 3386686..3386855 FT /rpt_family="L2" FT repeat_region 3387820..3387975 FT /rpt_family="MIR" FT repeat_region 3387982..3388338 FT /rpt_family="L1" FT repeat_region 3389236..3389533 FT /rpt_family="Alu" FT repeat_region 3391030..3391355 FT /rpt_family="L1" FT repeat_region 3391369..3391740 FT /rpt_family="L1" FT repeat_region 3391748..3391791 FT /rpt_family="AT_rich" FT repeat_region 3393617..3393907 FT /rpt_family="Alu" FT repeat_region 3394954..3395115 FT /rpt_family="Alu" FT repeat_region 3395904..3396024 FT /rpt_family="L1" FT repeat_region 3396408..3396707 FT /rpt_family="Alu" FT repeat_region 3396970..3397278 FT /rpt_family="Alu" FT repeat_region 3397644..3397953 FT /rpt_family="Alu" FT repeat_region 3398062..3398104 FT /rpt_family="(T)n" FT repeat_region 3398110..3398165 FT /rpt_family="ERV1" FT repeat_region 3399786..3399916 FT /rpt_family="L2" FT repeat_region 3400801..3400859 FT /rpt_family="Alu" FT repeat_region 3402172..3402202 FT /rpt_family="AT_rich" FT repeat_region 3402248..3402276 FT /rpt_family="AT_rich" FT repeat_region 3402550..3403159 FT /rpt_family="L1" FT repeat_region complement(3559123..3559282) FT /rpt_family="MIR" FT repeat_region complement(3557895..3559057) FT /rpt_family="L1" FT repeat_region complement(3555830..3555931) FT /rpt_family="(TA)n" FT repeat_region complement(3555777..3555825) FT /rpt_family="(TATATG)n" FT repeat_region complement(3554045..3554487) FT /rpt_family="MaLR" FT repeat_region complement(3553269..3553706) FT /rpt_family="L1" FT repeat_region complement(3552946..3553041) FT /rpt_family="L1" FT repeat_region complement(3552759..3552945) FT /rpt_family="MIR" FT repeat_region complement(3552492..3552736) FT /rpt_family="L1" FT repeat_region complement(3551444..3552345) FT /rpt_family="L1" FT repeat_region complement(3550605..3550786) FT /rpt_family="L2" FT repeat_region complement(3550057..3550562) FT /rpt_family="ERV1" FT repeat_region complement(3549491..3549681) FT /rpt_family="MER1_type" FT repeat_region complement(3548952..3549129) FT /rpt_family="MIR" FT repeat_region complement(3548700..3548750) FT /rpt_family="(CA)n" FT repeat_region complement(3547947..3548259) FT /rpt_family="Alu" FT repeat_region complement(3547343..3547709) FT /rpt_family="L2" FT repeat_region complement(3547231..3547325) FT /rpt_family="L2" FT repeat_region complement(3546646..3546989) FT /rpt_family="L1" FT repeat_region complement(3545522..3546430) FT /rpt_family="L1" FT repeat_region complement(3545241..3545521) FT /rpt_family="MER2_type" FT repeat_region complement(3545183..3545240) FT /rpt_family="L1" FT repeat_region complement(3544896..3545182) FT /rpt_family="Alu" FT repeat_region complement(3544768..3544895) FT /rpt_family="L1" FT repeat_region complement(3544426..3544595) FT /rpt_family="L1" FT repeat_region complement(3543926..3544417) FT /rpt_family="L1" FT repeat_region complement(3543882..3543925) FT /rpt_family="(CAA)n" FT repeat_region complement(3543846..3543881) FT /rpt_family="L1" FT repeat_region complement(3543815..3543845) FT /rpt_family="(CA)n" FT repeat_region complement(3543800..3543814) FT /rpt_family="L1" FT repeat_region complement(3543502..3543799) FT /rpt_family="Alu" FT repeat_region complement(3543329..3543501) FT /rpt_family="L1" FT repeat_region complement(3543034..3543328) FT /rpt_family="Alu" FT repeat_region complement(3543010..3543033) FT /rpt_family="L1" FT repeat_region complement(3542468..3542536) FT /rpt_family="MIR" FT repeat_region complement(3542324..3542422) FT /rpt_family="L1" FT repeat_region complement(3542291..3542323) FT /rpt_family="AT_rich" FT repeat_region complement(3541906..3542180) FT /rpt_family="Alu" FT repeat_region complement(3541855..3541888) FT /rpt_family="AT_rich" FT repeat_region complement(3541692..3541717) FT /rpt_family="AT_rich" FT repeat_region complement(3540547..3540925) FT /rpt_family="L1" FT repeat_region complement(3539788..3540504) FT /rpt_family="L1" FT repeat_region complement(3539000..3539182) FT /rpt_family="L1" FT repeat_region complement(3538212..3538489) FT /rpt_family="L2" FT repeat_region complement(3537975..3538166) FT /rpt_family="MIR" FT repeat_region complement(3535709..3535901) FT /rpt_family="MIR" FT repeat_region complement(3534882..3535190) FT /rpt_family="Alu" FT repeat_region complement(3534151..3534238) FT /rpt_family="L1" FT repeat_region complement(3532574..3532882) FT /rpt_family="Alu" FT repeat_region complement(3531915..3532155) FT /rpt_family="Alu" FT repeat_region complement(3531491..3531528) FT /rpt_family="AT_rich" FT repeat_region complement(3530881..3531053) FT /rpt_family="MER1_type" FT repeat_region complement(3530640..3530745) FT /rpt_family="MIR" FT repeat_region complement(3530051..3530109) FT /rpt_family="L2" FT repeat_region complement(3528537..3528568) FT /rpt_family="(CA)n" FT repeat_region complement(3528245..3528472) FT /rpt_family="MaLR" FT repeat_region complement(3527945..3528212) FT /rpt_family="L1" FT repeat_region complement(3527901..3527935) FT /rpt_family="A-rich" FT repeat_region complement(3527414..3527537) FT /rpt_family="MER1_type" FT repeat_region complement(3527092..3527413) FT /rpt_family="Alu" FT repeat_region complement(3527015..3527091) FT /rpt_family="MER1_type" FT repeat_region complement(3526652..3526815) FT /rpt_family="MER1_type" FT repeat_region complement(3525631..3526234) FT /rpt_family="L1" FT repeat_region complement(3524995..3525362) FT /rpt_family="L1" FT repeat_region complement(3524193..3525014) FT /rpt_family="L1" FT repeat_region complement(3524105..3524185) FT /rpt_family="MER2_type" FT repeat_region complement(3523890..3524104) FT /rpt_family="MER2_type" FT repeat_region complement(3523735..3523879) FT /rpt_family="MER2_type" FT repeat_region complement(3523550..3523721) FT /rpt_family="L1" FT repeat_region complement(3522719..3523452) FT /rpt_family="L1" FT repeat_region complement(3522481..3522558) FT /rpt_family="MIR" FT repeat_region complement(3522127..3522394) FT /rpt_family="L1" FT repeat_region complement(3521043..3521535) FT /rpt_family="ERVL" FT repeat_region complement(3520826..3520965) FT /rpt_family="MIR" FT repeat_region complement(3520521..3520763) FT /rpt_family="L1" FT repeat_region complement(3520388..3520518) FT /rpt_family="MaLR" FT repeat_region complement(3520186..3520387) FT /rpt_family="ERV1" FT repeat_region complement(3519893..3519988) FT /rpt_family="ERV1" FT repeat_region complement(3519599..3519892) FT /rpt_family="MaLR" FT repeat_region complement(3519509..3519598) FT /rpt_family="L1" FT repeat_region complement(3519214..3519508) FT /rpt_family="Alu" FT repeat_region complement(3519080..3519213) FT /rpt_family="L1" FT repeat_region complement(3518769..3519079) FT /rpt_family="Alu" FT repeat_region complement(3518232..3518768) FT /rpt_family="L1" FT repeat_region complement(3517681..3517926) FT /rpt_family="L1" FT repeat_region complement(3517134..3517445) FT /rpt_family="Alu" FT repeat_region complement(3516822..3517123) FT /rpt_family="Alu" FT repeat_region complement(3516701..3516759) FT /rpt_family="MaLR" FT repeat_region complement(3514623..3514930) FT /rpt_family="L2" FT repeat_region complement(3514329..3514622) FT /rpt_family="Alu" FT repeat_region complement(3514026..3514328) FT /rpt_family="L2" FT repeat_region complement(3513725..3514025) FT /rpt_family="Alu" FT repeat_region complement(3513165..3513249) FT /rpt_family="CR1" FT repeat_region complement(3512718..3512858) FT /rpt_family="MIR" FT repeat_region complement(3511962..3512074) FT /rpt_family="L2" FT repeat_region complement(3508790..3509078) FT /rpt_family="Alu" FT repeat_region complement(3507941..3508572) FT /rpt_family="ERV1" FT repeat_region complement(3507182..3507212) FT /rpt_family="AT_rich" FT repeat_region complement(3507060..3507095) FT /rpt_family="AT_rich" FT repeat_region complement(3506675..3506743) FT /rpt_family="L1" FT repeat_region complement(3506612..3506662) FT /rpt_family="(TG)n" FT repeat_region complement(3504323..3504364) FT /rpt_family="(TA)n" FT repeat_region complement(3503874..3504158) FT /rpt_family="Alu" FT repeat_region complement(3503022..3503187) FT /rpt_family="MIR" FT repeat_region complement(3502982..3503014) FT /rpt_family="(TTCA)n" FT repeat_region complement(3502900..3502922) FT /rpt_family="(CAAAAA)n" FT repeat_region complement(3501264..3502650) FT /rpt_family="L2" FT repeat_region complement(3501165..3501273) FT /rpt_family="MIR" FT repeat_region complement(3500720..3500830) FT /rpt_family="L1" FT repeat_region complement(3499065..3499509) FT /rpt_family="MaLR" FT repeat_region complement(3498280..3498767) FT /rpt_family="L1" FT repeat_region complement(3497033..3497951) FT /rpt_family="L1" FT repeat_region complement(3496683..3496973) FT /rpt_family="L1" FT repeat_region complement(3495556..3496694) FT /rpt_family="L1" FT repeat_region complement(3494730..3495515) FT /rpt_family="L1" FT repeat_region complement(3494065..3494724) FT /rpt_family="L1" FT repeat_region complement(3494021..3494062) FT /rpt_family="(CA)n" FT repeat_region complement(3493289..3493490) FT /rpt_family="Alu" FT repeat_region complement(3492959..3493286) FT /rpt_family="MaLR" FT repeat_region complement(3489926..3490694) FT /rpt_family="L2" FT repeat_region complement(3489384..3489685) FT /rpt_family="L2" FT repeat_region complement(3489211..3489321) FT /rpt_family="L1" FT repeat_region complement(3488236..3488354) FT /rpt_family="L1" FT repeat_region complement(3487636..3488033) FT /rpt_family="L1" FT repeat_region complement(3487332..3487635) FT /rpt_family="Alu" FT repeat_region complement(3487199..3487331) FT /rpt_family="L1" FT repeat_region complement(3485874..3486025) FT /rpt_family="MIR" FT repeat_region complement(3485307..3485793) FT /rpt_family="L1" FT repeat_region complement(3485128..3485276) FT /rpt_family="L1" FT repeat_region complement(3484169..3484219) FT /rpt_family="CR1" FT repeat_region complement(3483912..3484033) FT /rpt_family="L2" FT repeat_region complement(3482168..3482308) FT /rpt_family="MIR" FT repeat_region complement(3481053..3481407) FT /rpt_family="L1" FT repeat_region complement(3480633..3480976) FT /rpt_family="MER2_type" FT repeat_region complement(3480144..3480632) FT /rpt_family="MER2_type" FT repeat_region complement(3479820..3480148) FT /rpt_family="ERV1" FT repeat_region complement(3479662..3479811) FT /rpt_family="MER2_type" FT repeat_region complement(3479569..3479661) FT /rpt_family="L1" FT repeat_region complement(3478482..3478784) FT /rpt_family="Alu" FT repeat_region complement(3478216..3478298) FT /rpt_family="MIR" FT repeat_region complement(3477608..3477707) FT /rpt_family="MIR" FT repeat_region complement(3477122..3477380) FT /rpt_family="Alu" FT repeat_region complement(3475394..3475512) FT /rpt_family="L2" FT repeat_region complement(3475168..3475292) FT /rpt_family="Alu" FT repeat_region complement(3475129..3475167) FT /rpt_family="(TAA)n" FT repeat_region complement(3474954..3475128) FT /rpt_family="Alu" FT repeat_region complement(3474134..3474323) FT /rpt_family="MIR" FT repeat_region complement(3473111..3473182) FT /rpt_family="GA-rich" FT repeat_region complement(3471757..3471810) FT /rpt_family="(TA)n" FT repeat_region complement(3471290..3471421) FT /rpt_family="MIR" FT repeat_region complement(3470991..3471013) FT /rpt_family="(A)n" FT repeat_region complement(3470529..3470832) FT /rpt_family="Alu" FT repeat_region complement(3469234..3469512) FT /rpt_family="Alu" FT repeat_region complement(3468983..3469027) FT /rpt_family="MIR" FT repeat_region complement(3467173..3468017) FT /rpt_family="MER2_type" FT repeat_region complement(3466883..3467172) FT /rpt_family="Alu" FT repeat_region complement(3466656..3466882) FT /rpt_family="MER2_type" FT repeat_region complement(3466009..3466219) FT /rpt_family="MIR" FT repeat_region complement(3464248..3464538) FT /rpt_family="Alu" FT repeat_region complement(3463551..3463843) FT /rpt_family="Alu" FT repeat_region complement(3462492..3462564) FT /rpt_family="MIR" FT repeat_region complement(3462144..3462256) FT /rpt_family="Alu" FT repeat_region complement(3461520..3461604) FT /rpt_family="Alu" FT repeat_region complement(3460725..3461007) FT /rpt_family="Alu" FT repeat_region complement(3460379..3460593) FT /rpt_family="L1" FT repeat_region complement(3458781..3458950) FT /rpt_family="MIR" FT repeat_region complement(3458677..3458780) FT /rpt_family="MER2_type" FT repeat_region complement(3458445..3458552) FT /rpt_family="MER2_type" FT repeat_region complement(3457709..3457957) FT /rpt_family="Alu" FT repeat_region complement(3457478..3457542) FT /rpt_family="L2" FT repeat_region complement(3456523..3456828) FT /rpt_family="Alu" FT repeat_region complement(3455376..3455472) FT /rpt_family="L2" FT repeat_region complement(3455326..3455375) FT /rpt_family="(TA)n" FT repeat_region complement(3454220..3454765) FT /rpt_family="L1" FT repeat_region complement(3453617..3453893) FT /rpt_family="L2" FT repeat_region complement(3453347..3453616) FT /rpt_family="Alu" FT repeat_region complement(3453045..3453337) FT /rpt_family="Alu" FT repeat_region complement(3452535..3453044) FT /rpt_family="L2" FT repeat_region complement(3451930..3452341) FT /rpt_family="L1" FT repeat_region complement(3450211..3450518) FT /rpt_family="Alu" FT repeat_region complement(3450123..3450197) FT /rpt_family="MIR" FT repeat_region complement(3449816..3450116) FT /rpt_family="MER2_type" FT repeat_region complement(3449623..3449750) FT /rpt_family="MIR" FT repeat_region complement(3447679..3447976) FT /rpt_family="Alu" FT repeat_region complement(3447355..3447536) FT /rpt_family="L2" FT repeat_region complement(3445435..3445739) FT /rpt_family="Alu" FT repeat_region complement(3444781..3444820) FT /rpt_family="(TTTTTG)n" FT repeat_region complement(3443728..3443912) FT /rpt_family="MER2_type" FT repeat_region complement(3443549..3443734) FT /rpt_family="MER2_type" FT repeat_region complement(3443454..3443540) FT /rpt_family="(TA)n" FT repeat_region complement(3442574..3442865) FT /rpt_family="Alu" FT repeat_region complement(3441239..3441347) FT /rpt_family="MIR" FT repeat_region complement(3438675..3440038) FT /rpt_family="L1" FT repeat_region complement(3437407..3438675) FT /rpt_family="L1" FT repeat_region complement(3433841..3437373) FT /rpt_family="L1" FT repeat_region complement(3433264..3433819) FT /rpt_family="L1" FT repeat_region complement(3433121..3433248) FT /rpt_family="L1" FT repeat_region complement(3432904..3433121) FT /rpt_family="L1" FT repeat_region complement(3432594..3432903) FT /rpt_family="Alu" FT repeat_region complement(3432064..3432593) FT /rpt_family="L1" FT repeat_region complement(3431854..3432050) FT /rpt_family="L1" FT repeat_region complement(3431670..3431771) FT /rpt_family="L1" FT repeat_region complement(3431584..3431620) FT /rpt_family="(TA)n" FT repeat_region complement(3431268..3431560) FT /rpt_family="Alu" FT repeat_region complement(3430134..3430529) FT /rpt_family="MaLR" FT repeat_region complement(3429415..3429805) FT /rpt_family="MaLR" FT repeat_region complement(3429255..3429383) FT /rpt_family="Alu" FT repeat_region complement(3428790..3429249) FT /rpt_family="MaLR" FT repeat_region complement(3428419..3428715) FT /rpt_family="L2" FT repeat_region complement(3428051..3428159) FT /rpt_family="Alu" FT repeat_region complement(3427698..3427822) FT /rpt_family="MIR" FT repeat_region complement(3427433..3427650) FT /rpt_family="MIR" FT repeat_region complement(3427257..3427385) FT /rpt_family="L1" FT repeat_region complement(3426708..3426820) FT /rpt_family="Tip100" FT repeat_region complement(3425168..3425355) FT /rpt_family="L2" FT repeat_region complement(3425059..3425079) FT /rpt_family="AT_rich" FT repeat_region complement(3424715..3424871) FT /rpt_family="MIR" FT repeat_region complement(3424360..3424466) FT /rpt_family="(TATATG)n" FT repeat_region complement(3424040..3424186) FT /rpt_family="MER103" FT repeat_region complement(3422762..3423051) FT /rpt_family="Alu" FT repeat_region complement(3422152..3422190) FT /rpt_family="MIR" FT repeat_region complement(3421904..3422017) FT /rpt_family="MIR" FT repeat_region complement(3421773..3421902) FT /rpt_family="Alu" FT repeat_region complement(3421740..3421760) FT /rpt_family="AT_rich" FT repeat_region complement(3421631..3421739) FT /rpt_family="MIR" FT repeat_region complement(3420274..3420687) FT /rpt_family="MaLR" FT repeat_region complement(3419640..3419782) FT /rpt_family="L1" FT repeat_region complement(3419393..3419634) FT /rpt_family="MER2_type" FT repeat_region complement(3418816..3419138) FT /rpt_family="L2" FT repeat_region complement(3418165..3418228) FT /rpt_family="MIR" FT repeat_region complement(3417419..3417709) FT /rpt_family="Alu" FT repeat_region complement(3417386..3417418) FT /rpt_family="AT_rich" FT repeat_region complement(3416460..3416957) FT /rpt_family="L1" FT repeat_region complement(3416269..3416426) FT /rpt_family="L1" FT repeat_region complement(3415683..3415845) FT /rpt_family="Alu" FT repeat_region complement(3415044..3415580) FT /rpt_family="MaLR" FT repeat_region complement(3414127..3414662) FT /rpt_family="L2" FT repeat_region complement(3413007..3413579) FT /rpt_family="L1" FT repeat_region complement(3412724..3412967) FT /rpt_family="MER2_type" FT repeat_region complement(3412139..3412351) FT /rpt_family="MaLR" FT repeat_region complement(3412011..3412120) FT /rpt_family="L1" FT repeat_region complement(3409322..3409343) FT /rpt_family="AT_rich" FT repeat_region complement(3408979..3409134) FT /rpt_family="MER1_type" FT repeat_region complement(3408669..3408968) FT /rpt_family="Alu" FT repeat_region complement(3408377..3408471) FT /rpt_family="MIR" FT repeat_region complement(3406780..3406814) FT /rpt_family="(TAAA)n" FT repeat_region complement(3406366..3406671) FT /rpt_family="Alu" FT repeat_region complement(3406090..3406357) FT /rpt_family="L1" FT repeat_region complement(3405923..3406069) FT /rpt_family="L1" FT repeat_region complement(3405383..3405685) FT /rpt_family="Alu" FT repeat_region complement(3404916..3405243) FT /rpt_family="L1" FT repeat_region complement(3403503..3404747) FT /rpt_family="L1" FT repeat_region complement(3403160..3403502) FT /rpt_family="MER1_type" FT repeat_region complement(3403112..3403159) FT /rpt_family="L1" FT repeat_region complement(3645663..3646439) FT /rpt_family="L2" FT repeat_region complement(3644778..3644797) FT /rpt_family="(TG)n" FT repeat_region complement(3644534..3644765) FT /rpt_family="L1" FT repeat_region complement(3644222..3644533) FT /rpt_family="Alu" FT repeat_region complement(3643945..3644221) FT /rpt_family="L1" FT repeat_region complement(3640480..3641309) FT /rpt_family="L1" FT repeat_region complement(3640184..3640479) FT /rpt_family="Alu" FT repeat_region complement(3638033..3640183) FT /rpt_family="L1" FT repeat_region complement(3637375..3637990) FT /rpt_family="L1" FT repeat_region complement(3637228..3637374) FT /rpt_family="ERV1" FT repeat_region complement(3637049..3637227) FT /rpt_family="ERV1" FT repeat_region complement(3636925..3636984) FT /rpt_family="ERV1" FT repeat_region complement(3636621..3636924) FT /rpt_family="Alu" FT repeat_region complement(3636334..3636620) FT /rpt_family="ERV1" FT repeat_region complement(3636080..3636330) FT /rpt_family="L1" FT repeat_region complement(3635709..3635810) FT /rpt_family="MER2_type" FT repeat_region complement(3635545..3635706) FT /rpt_family="MIR" FT repeat_region complement(3635368..3635488) FT /rpt_family="Alu" FT repeat_region complement(3634929..3634958) FT /rpt_family="AT_rich" FT repeat_region complement(3633568..3634363) FT /rpt_family="L1" FT repeat_region complement(3633392..3633531) FT /rpt_family="MIR" FT repeat_region complement(3631474..3631515) FT /rpt_family="MER1_type" FT repeat_region complement(3630632..3630685) FT /rpt_family="MER1_type" FT repeat_region complement(3630411..3630631) FT /rpt_family="Alu" FT repeat_region complement(3630295..3630410) FT /rpt_family="MER1_type" FT repeat_region complement(3629933..3629953) FT /rpt_family="(A)n" FT repeat_region complement(3629133..3629476) FT /rpt_family="MaLR" FT repeat_region complement(3628729..3628762) FT /rpt_family="MIR" FT repeat_region complement(3627744..3627794) FT /rpt_family="MIR" FT repeat_region complement(3627453..3627571) FT /rpt_family="L2" FT repeat_region complement(3626961..3627390) FT /rpt_family="ERVL" FT repeat_region complement(3626933..3626960) FT /rpt_family="(CA)n" FT repeat_region complement(3626900..3626932) FT /rpt_family="ERVL" FT repeat_region complement(3626048..3626358) FT /rpt_family="Alu" FT repeat_region complement(3624364..3624655) FT /rpt_family="Alu" FT repeat_region complement(3623801..3623898) FT /rpt_family="MER103" FT repeat_region complement(3623186..3623308) FT /rpt_family="L2" FT repeat_region complement(3622142..3622329) FT /rpt_family="L1" FT repeat_region complement(3620627..3621631) FT /rpt_family="L1" FT repeat_region complement(3620319..3620626) FT /rpt_family="Alu" FT repeat_region complement(3618751..3620318) FT /rpt_family="L1" FT repeat_region complement(3617729..3618720) FT /rpt_family="ERVK" FT repeat_region complement(3617248..3617289) FT /rpt_family="L2" FT repeat_region complement(3616903..3617076) FT /rpt_family="MIR" FT repeat_region complement(3615478..3615498) FT /rpt_family="AT_rich" FT repeat_region complement(3614734..3615095) FT /rpt_family="MaLR" FT repeat_region complement(3613745..3614047) FT /rpt_family="Alu" FT repeat_region complement(3613558..3613604) FT /rpt_family="L2" FT repeat_region complement(3613490..3613510) FT /rpt_family="AT_rich" FT repeat_region complement(3612286..3612655) FT /rpt_family="L2" FT repeat_region complement(3611746..3611847) FT /rpt_family="L2" FT repeat_region complement(3611378..3611457) FT /rpt_family="L2" FT repeat_region complement(3610929..3611235) FT /rpt_family="Alu" FT repeat_region complement(3609797..3610125) FT /rpt_family="MER1_type" FT repeat_region complement(3608681..3608716) FT /rpt_family="MIR" FT repeat_region complement(3607433..3607752) FT /rpt_family="Alu" FT repeat_region complement(3606909..3607004) FT /rpt_family="MIR" FT repeat_region complement(3606389..3606631) FT /rpt_family="L1" FT repeat_region complement(3605851..3606156) FT /rpt_family="Alu" FT repeat_region complement(3605556..3605721) FT /rpt_family="L1" FT repeat_region complement(3605224..3605555) FT /rpt_family="MER2_type" FT repeat_region complement(3604960..3605223) FT /rpt_family="L1" FT repeat_region complement(3604134..3604497) FT /rpt_family="L1" FT repeat_region complement(3603991..3604125) FT /rpt_family="Alu" FT repeat_region complement(3603087..3603982) FT /rpt_family="L1" FT repeat_region complement(3602266..3602359) FT /rpt_family="L1" FT repeat_region complement(3601217..3601258) FT /rpt_family="L2" FT repeat_region complement(3599982..3600678) FT /rpt_family="L2" FT repeat_region complement(3599918..3599954) FT /rpt_family="L2" FT repeat_region complement(3599460..3599565) FT /rpt_family="L2" FT repeat_region complement(3597428..3597475) FT /rpt_family="MIR" FT repeat_region complement(3597059..3597385) FT /rpt_family="L1" FT repeat_region complement(3596624..3597058) FT /rpt_family="L1" FT repeat_region complement(3596448..3596624) FT /rpt_family="L1" FT repeat_region complement(3596170..3596447) FT /rpt_family="Alu" FT repeat_region complement(3594337..3596169) FT /rpt_family="L1" FT repeat_region complement(3594120..3594338) FT /rpt_family="L1" FT repeat_region complement(3593683..3594129) FT /rpt_family="L1" FT repeat_region complement(3593460..3593684) FT /rpt_family="L1" FT repeat_region complement(3593246..3593413) FT /rpt_family="L1" FT repeat_region complement(3592954..3593240) FT /rpt_family="L1" FT repeat_region complement(3592790..3592896) FT /rpt_family="MIR" FT repeat_region complement(3592607..3592753) FT /rpt_family="L1" FT repeat_region complement(3591664..3591972) FT /rpt_family="Alu" FT repeat_region complement(3591327..3591487) FT /rpt_family="Alu" FT repeat_region complement(3590717..3590737) FT /rpt_family="AT_rich" FT repeat_region complement(3589715..3589828) FT /rpt_family="(TATATG)n" FT repeat_region complement(3588139..3588311) FT /rpt_family="L1" FT repeat_region complement(3587869..3587995) FT /rpt_family="L1" FT repeat_region complement(3585865..3586033) FT /rpt_family="MIR" FT repeat_region complement(3585708..3585864) FT /rpt_family="MER1_type" FT repeat_region complement(3584356..3584740) FT /rpt_family="MaLR" FT repeat_region complement(3584033..3584217) FT /rpt_family="MIR" FT repeat_region complement(3582244..3582289) FT /rpt_family="AT_rich" FT repeat_region complement(3582132..3582198) FT /rpt_family="L2" FT repeat_region complement(3581600..3581694) FT /rpt_family="L1" FT repeat_region complement(3581283..3581373) FT /rpt_family="L2" FT repeat_region complement(3579757..3580054) FT /rpt_family="Alu" FT repeat_region complement(3579200..3579313) FT /rpt_family="L2" FT repeat_region complement(3578967..3578994) FT /rpt_family="(TCTA)n" FT repeat_region complement(3577316..3577638) FT /rpt_family="L1" FT repeat_region complement(3576952..3577047) FT /rpt_family="MIR" FT repeat_region complement(3576617..3576872) FT /rpt_family="L1" FT repeat_region complement(3576033..3576353) FT /rpt_family="Alu" FT repeat_region complement(3575694..3575997) FT /rpt_family="Alu" FT repeat_region complement(3575594..3575651) FT /rpt_family="AT_rich" FT repeat_region complement(3575089..3575278) FT /rpt_family="MIR" FT repeat_region complement(3574632..3574926) FT /rpt_family="Alu" FT repeat_region complement(3574314..3574631) FT /rpt_family="ERV1" FT repeat_region complement(3574253..3574313) FT /rpt_family="L1" FT repeat_region complement(3573538..3574252) FT /rpt_family="L1" FT repeat_region complement(3573424..3573537) FT /rpt_family="L1" FT repeat_region complement(3573213..3573405) FT /rpt_family="L1" FT repeat_region complement(3572927..3573026) FT /rpt_family="CR1" FT repeat_region complement(3572072..3572235) FT /rpt_family="MIR" FT repeat_region complement(3571035..3571065) FT /rpt_family="AT_rich" FT repeat_region complement(3569910..3569986) FT /rpt_family="CR1" FT repeat_region complement(3569648..3569769) FT /rpt_family="L1" FT repeat_region complement(3569440..3569597) FT /rpt_family="L1" FT repeat_region complement(3569207..3569412) FT /rpt_family="L1" FT repeat_region complement(3569181..3569206) FT /rpt_family="(CAA)n" FT repeat_region complement(3568657..3569180) FT /rpt_family="L1" FT repeat_region complement(3567988..3568486) FT /rpt_family="L2" FT repeat_region complement(3566808..3567207) FT /rpt_family="L2" FT repeat_region complement(3565584..3565883) FT /rpt_family="Alu" FT repeat_region complement(3564567..3564872) FT /rpt_family="MER2_type" FT repeat_region complement(3563709..3564496) FT /rpt_family="L2" FT repeat_region complement(3562892..3563000) FT /rpt_family="L2" FT repeat_region complement(3562124..3562228) FT /rpt_family="L2" FT repeat_region complement(3560476..3561044) FT /rpt_family="MaLR" FT repeat_region complement(3738574..3739835) FT /rpt_family="L1" FT repeat_region complement(3738198..3738572) FT /rpt_family="MaLR" FT repeat_region complement(3737472..3738173) FT /rpt_family="L1" FT repeat_region complement(3736358..3736382) FT /rpt_family="AT_rich" FT repeat_region complement(3736199..3736233) FT /rpt_family="(CA)n" FT repeat_region complement(3735144..3735237) FT /rpt_family="L1" FT repeat_region complement(3734311..3734439) FT /rpt_family="MER1_type" FT repeat_region complement(3733767..3733833) FT /rpt_family="MIR" FT repeat_region complement(3733030..3733279) FT /rpt_family="L1" FT repeat_region complement(3732515..3732536) FT /rpt_family="AT_rich" FT repeat_region complement(3732004..3732349) FT /rpt_family="L1" FT repeat_region complement(3731975..3732003) FT /rpt_family="(CA)n" FT repeat_region complement(3731840..3731974) FT /rpt_family="L1" FT repeat_region complement(3731625..3731771) FT /rpt_family="L2" FT repeat_region complement(3729249..3729407) FT /rpt_family="MIR" FT repeat_region complement(3728584..3728822) FT /rpt_family="MER1_type" FT repeat_region complement(3728184..3728355) FT /rpt_family="MIR" FT repeat_region complement(3727913..3728124) FT /rpt_family="MIR" FT repeat_region complement(3727061..3727573) FT /rpt_family="L1" FT repeat_region complement(3726875..3727058) FT /rpt_family="Alu" FT repeat_region complement(3726807..3726874) FT /rpt_family="Alu" FT repeat_region complement(3726747..3726806) FT /rpt_family="L1" FT repeat_region complement(3726689..3726732) FT /rpt_family="(TG)n" FT repeat_region complement(3726244..3726684) FT /rpt_family="ERVL" FT repeat_region complement(3726151..3726242) FT /rpt_family="L1" FT repeat_region complement(3726008..3726071) FT /rpt_family="L1" FT repeat_region complement(3725705..3726007) FT /rpt_family="Alu" FT repeat_region complement(3725350..3725704) FT /rpt_family="L1" FT repeat_region complement(3724148..3725344) FT /rpt_family="L1" FT repeat_region complement(3723287..3723381) FT /rpt_family="L1" FT repeat_region complement(3723152..3723196) FT /rpt_family="L2" FT repeat_region complement(3722794..3722943) FT /rpt_family="L2" FT repeat_region complement(3722423..3722665) FT /rpt_family="Alu" FT repeat_region complement(3721785..3721965) FT /rpt_family="MIR" FT repeat_region complement(3721478..3721688) FT /rpt_family="MER2_type" FT repeat_region complement(3721191..3721379) FT /rpt_family="L2" FT repeat_region complement(3720774..3721177) FT /rpt_family="L1" FT repeat_region complement(3720461..3720773) FT /rpt_family="Alu" FT repeat_region complement(3720339..3720460) FT /rpt_family="L1" FT repeat_region complement(3719215..3720273) FT /rpt_family="L1" FT repeat_region complement(3718917..3719214) FT /rpt_family="Alu" FT misc_feature complement(3718964..3719186) FT /note="CpG_island (%GC=61.0, o/e=0.95, #CpGs=18)" FT repeat_region complement(3718442..3718916) FT /rpt_family="L1" FT repeat_region complement(3717522..3718434) FT /rpt_family="L1" FT repeat_region complement(3717365..3717511) FT /rpt_family="L1" FT repeat_region complement(3716937..3717292) FT /rpt_family="MaLR" FT repeat_region complement(3716828..3716865) FT /rpt_family="(CA)n" FT repeat_region complement(3716601..3716776) FT /rpt_family="L2" FT repeat_region complement(3716258..3716599) FT /rpt_family="L1" FT repeat_region complement(3715955..3716256) FT /rpt_family="Alu" FT repeat_region complement(3715806..3715943) FT /rpt_family="Alu" FT repeat_region complement(3715654..3715806) FT /rpt_family="Alu" FT repeat_region complement(3715453..3715650) FT /rpt_family="L1" FT repeat_region complement(3715224..3715451) FT /rpt_family="Alu" FT repeat_region complement(3715192..3715220) FT /rpt_family="(CAAA)n" FT repeat_region complement(3714714..3715190) FT /rpt_family="L2" FT repeat_region complement(3714473..3714582) FT /rpt_family="L2" FT repeat_region complement(3714282..3714456) FT /rpt_family="MER1_type" FT repeat_region complement(3713781..3714281) FT /rpt_family="L2" FT repeat_region complement(3713553..3713573) FT /rpt_family="AT_rich" FT repeat_region complement(3712366..3712427) FT /rpt_family="(TA)n" FT repeat_region complement(3712310..3712362) FT /rpt_family="AT_rich" FT repeat_region complement(3712215..3712303) FT /rpt_family="(TA)n" FT repeat_region complement(3710844..3710962) FT /rpt_family="MIR" FT repeat_region complement(3710502..3710560) FT /rpt_family="L2" FT repeat_region complement(3710385..3710433) FT /rpt_family="AcHobo" FT repeat_region complement(3709988..3710265) FT /rpt_family="MIR" FT repeat_region complement(3709001..3709990) FT /rpt_family="L2" FT repeat_region complement(3708650..3708670) FT /rpt_family="L1" FT repeat_region complement(3708441..3708649) FT /rpt_family="MaLR" FT repeat_region complement(3708126..3708440) FT /rpt_family="Alu" FT repeat_region complement(3707763..3708125) FT /rpt_family="MaLR" FT repeat_region complement(3707654..3707762) FT /rpt_family="L1" FT repeat_region complement(3707104..3707644) FT /rpt_family="L1" FT repeat_region complement(3706233..3706323) FT /rpt_family="L2" FT repeat_region complement(3705642..3706099) FT /rpt_family="L2" FT repeat_region complement(3705070..3705183) FT /rpt_family="L2" FT repeat_region complement(3704091..3704389) FT /rpt_family="Alu" FT repeat_region complement(3703236..3703333) FT /rpt_family="AcHobo" FT repeat_region complement(3702606..3702671) FT /rpt_family="(CATA)n" FT repeat_region complement(3702361..3702602) FT /rpt_family="MER2_type" FT repeat_region complement(3701674..3701696) FT /rpt_family="(A)n" FT repeat_region complement(3701344..3701584) FT /rpt_family="MIR" FT repeat_region complement(3700106..3700139) FT /rpt_family="(TC)n" FT repeat_region complement(3699007..3699956) FT /rpt_family="L2" FT repeat_region complement(3698550..3698689) FT /rpt_family="L1" FT repeat_region complement(3698239..3698549) FT /rpt_family="Alu" FT repeat_region complement(3698122..3698238) FT /rpt_family="L1" FT repeat_region complement(3698002..3698090) FT /rpt_family="L2" FT repeat_region complement(3696372..3696678) FT /rpt_family="Alu" FT repeat_region complement(3695403..3695499) FT /rpt_family="MIR" FT repeat_region complement(3695279..3695340) FT /rpt_family="L2" FT repeat_region complement(3695081..3695151) FT /rpt_family="(TA)n" FT repeat_region complement(3694785..3695077) FT /rpt_family="Alu" FT repeat_region complement(3692982..3693346) FT /rpt_family="L2" FT repeat_region complement(3691725..3692611) FT /rpt_family="L2" FT repeat_region complement(3691287..3691400) FT /rpt_family="L1" FT repeat_region complement(3691035..3691225) FT /rpt_family="L1" FT repeat_region complement(3690105..3690995) FT /rpt_family="L1" FT repeat_region complement(3689847..3690097) FT /rpt_family="L1" FT repeat_region complement(3689700..3689845) FT /rpt_family="Alu" FT repeat_region complement(3689446..3689554) FT /rpt_family="L2" FT repeat_region complement(3689212..3689358) FT /rpt_family="MIR" FT repeat_region complement(3688902..3689204) FT /rpt_family="L1" FT repeat_region complement(3688642..3688719) FT /rpt_family="L2" FT repeat_region complement(3688434..3688579) FT /rpt_family="MIR" FT repeat_region complement(3688350..3688371) FT /rpt_family="AT_rich" FT repeat_region complement(3687073..3687355) FT /rpt_family="Alu" FT repeat_region complement(3686949..3687018) FT /rpt_family="L2" FT repeat_region complement(3686883..3686903) FT /rpt_family="AT_rich" FT repeat_region complement(3686737..3686882) FT /rpt_family="Alu" FT repeat_region complement(3686455..3686735) FT /rpt_family="L1" FT repeat_region complement(3686370..3686440) FT /rpt_family="L2" FT repeat_region complement(3686063..3686256) FT /rpt_family="MIR" FT repeat_region complement(3685486..3685788) FT /rpt_family="Alu" FT repeat_region complement(3685140..3685236) FT /rpt_family="L1" FT repeat_region complement(3685075..3685102) FT /rpt_family="L2" FT repeat_region complement(3684123..3684431) FT /rpt_family="Alu" FT repeat_region complement(3683876..3683898) FT /rpt_family="(TA)n" FT repeat_region complement(3683551..3683825) FT /rpt_family="Alu" FT repeat_region complement(3683488..3683548) FT /rpt_family="(TTA)n" FT repeat_region complement(3680316..3680612) FT /rpt_family="Alu" FT repeat_region complement(3679497..3679778) FT /rpt_family="Alu" FT repeat_region complement(3679413..3679495) FT /rpt_family="(TA)n" FT repeat_region complement(3677857..3678426) FT /rpt_family="L1" FT repeat_region complement(3677724..3677853) FT /rpt_family="L2" FT repeat_region complement(3676745..3677028) FT /rpt_family="Alu" FT repeat_region complement(3676707..3676744) FT /rpt_family="(CA)n" FT repeat_region complement(3676686..3676707) FT /rpt_family="(TC)n" FT repeat_region complement(3676659..3676706) FT /rpt_family="Alu" FT repeat_region complement(3675692..3676641) FT /rpt_family="L1" FT repeat_region complement(3675338..3675554) FT /rpt_family="Alu" FT repeat_region complement(3671513..3671536) FT /rpt_family="AT_rich" FT repeat_region complement(3670570..3670865) FT /rpt_family="Alu" FT repeat_region complement(3670281..3670472) FT /rpt_family="L1" FT repeat_region complement(3670125..3670280) FT /rpt_family="Alu" FT repeat_region complement(3669873..3670097) FT /rpt_family="L1" FT repeat_region complement(3668962..3669860) FT /rpt_family="L1" FT repeat_region complement(3668643..3668961) FT /rpt_family="Alu" FT repeat_region complement(3668321..3668642) FT /rpt_family="L1" FT repeat_region complement(3668094..3668319) FT /rpt_family="ERVL" FT repeat_region complement(3667980..3668023) FT /rpt_family="Alu" FT repeat_region complement(3667663..3667695) FT /rpt_family="L2" FT repeat_region complement(3666884..3667376) FT /rpt_family="ERVL" FT repeat_region complement(3666560..3666860) FT /rpt_family="Alu" FT repeat_region complement(3665562..3665869) FT /rpt_family="Alu" FT repeat_region complement(3665098..3665323) FT /rpt_family="ERVL" FT repeat_region complement(3664396..3664682) FT /rpt_family="Alu" FT repeat_region complement(3664368..3664389) FT /rpt_family="AT_rich" FT repeat_region complement(3663837..3664130) FT /rpt_family="Alu" FT repeat_region complement(3662874..3663172) FT /rpt_family="Alu" FT repeat_region complement(3662135..3662244) FT /rpt_family="MER1_type" FT repeat_region complement(3661828..3662134) FT /rpt_family="Alu" FT repeat_region complement(3661808..3661827) FT /rpt_family="MER1_type" FT repeat_region complement(3661490..3661807) FT /rpt_family="MER2_type" FT repeat_region complement(3661384..3661489) FT /rpt_family="MER1_type" FT repeat_region complement(3661187..3661381) FT /rpt_family="MER1_type" FT repeat_region complement(3660881..3660998) FT /rpt_family="MIR" FT repeat_region complement(3660227..3660417) FT /rpt_family="MER1_type" FT repeat_region complement(3659933..3660226) FT /rpt_family="Alu" FT repeat_region complement(3659889..3659916) FT /rpt_family="AT_rich" FT repeat_region complement(3659366..3659427) FT /rpt_family="L2" FT repeat_region complement(3658680..3658699) FT /rpt_family="(CAAAA)n" FT repeat_region complement(3657793..3658175) FT /rpt_family="L1" FT repeat_region complement(3657666..3657779) FT /rpt_family="MIR" FT repeat_region complement(3657136..3657516) FT /rpt_family="MaLR" FT repeat_region complement(3656856..3656941) FT /rpt_family="L2" FT repeat_region complement(3656611..3656835) FT /rpt_family="MIR" FT repeat_region complement(3655839..3655864) FT /rpt_family="(ATG)n" FT repeat_region complement(3655501..3655817) FT /rpt_family="Alu" FT repeat_region complement(3655271..3655479) FT /rpt_family="L2" FT repeat_region complement(3655164..3655265) FT /rpt_family="L2" FT repeat_region complement(3653772..3653812) FT /rpt_family="L1" FT repeat_region complement(3653169..3653771) FT /rpt_family="L1" FT repeat_region complement(3653055..3653168) FT /rpt_family="L1" FT repeat_region complement(3651528..3651880) FT /rpt_family="L1" FT repeat_region complement(3651370..3651526) FT /rpt_family="L1" FT repeat_region complement(3651148..3651374) FT /rpt_family="L1" FT repeat_region complement(3650974..3651024) FT /rpt_family="GA-rich" FT repeat_region complement(3650769..3650790) FT /rpt_family="AT_rich" FT repeat_region complement(3649634..3649678) FT /rpt_family="MIR" FT repeat_region complement(3649352..3649631) FT /rpt_family="Alu" FT repeat_region complement(3649026..3649331) FT /rpt_family="Alu" FT repeat_region complement(3648923..3649025) FT /rpt_family="MIR" FT repeat_region complement(3647525..3648922) FT /rpt_family="MER1_type" FT repeat_region complement(3647429..3647524) FT /rpt_family="MIR" FT repeat_region complement(3647027..3647189) FT /rpt_family="L2" FT repeat_region complement(3888302..3888601) FT /rpt_family="Alu" FT repeat_region complement(3888046..3888204) FT /rpt_family="MER1_type" FT repeat_region complement(3887260..3887888) FT /rpt_family="MER1_type" FT repeat_region complement(3884846..3885144) FT /rpt_family="Alu" FT repeat_region complement(3883608..3883903) FT /rpt_family="Alu" FT repeat_region complement(3883391..3883447) FT /rpt_family="MIR" FT repeat_region complement(3881563..3881842) FT /rpt_family="ERVL" FT repeat_region complement(3881493..3881532) FT /rpt_family="ERVL" FT repeat_region complement(3881190..3881492) FT /rpt_family="Alu" FT repeat_region complement(3880827..3881189) FT /rpt_family="ERVL" FT repeat_region complement(3880377..3880543) FT /rpt_family="MER1_type" FT repeat_region complement(3880266..3880317) FT /rpt_family="MER1_type" FT repeat_region complement(3880106..3880263) FT /rpt_family="MER1_type" FT repeat_region complement(3880018..3880098) FT /rpt_family="MER1_type" FT repeat_region complement(3878933..3879819) FT /rpt_family="MER1_type" FT repeat_region complement(3878674..3878942) FT /rpt_family="MER1_type" FT repeat_region complement(3877955..3878116) FT /rpt_family="L2" FT repeat_region complement(3877785..3877845) FT /rpt_family="MER1_type" FT repeat_region complement(3877301..3877468) FT /rpt_family="MER1_type" FT repeat_region complement(3876901..3877015) FT /rpt_family="MER1_type" FT repeat_region complement(3876432..3876778) FT /rpt_family="MaLR" FT repeat_region complement(3876053..3876180) FT /rpt_family="L2" FT repeat_region complement(3875308..3875436) FT /rpt_family="L2" FT repeat_region complement(3874332..3874458) FT /rpt_family="L2" FT repeat_region complement(3873883..3873971) FT /rpt_family="L2" FT repeat_region complement(3871741..3871859) FT /rpt_family="MIR" FT repeat_region complement(3871683..3871711) FT /rpt_family="AT_rich" FT repeat_region complement(3871407..3871682) FT /rpt_family="Alu" FT repeat_region complement(3870120..3870428) FT /rpt_family="Alu" FT repeat_region complement(3869059..3869199) FT /rpt_family="MIR" FT repeat_region complement(3868653..3868923) FT /rpt_family="MER1_type" FT repeat_region complement(3868279..3868584) FT /rpt_family="Alu" FT repeat_region complement(3867936..3868218) FT /rpt_family="MER1_type" FT repeat_region complement(3867632..3867935) FT /rpt_family="Alu" FT repeat_region complement(3867345..3867615) FT /rpt_family="MaLR" FT repeat_region complement(3867117..3867262) FT /rpt_family="MER1_type" FT repeat_region complement(3866855..3867107) FT /rpt_family="MER1_type" FT repeat_region complement(3865920..3866506) FT /rpt_family="MER1_type" FT repeat_region complement(3864951..3864972) FT /rpt_family="(T)n" FT repeat_region complement(3863568..3863606) FT /rpt_family="(A)n" FT repeat_region complement(3862120..3862425) FT /rpt_family="Alu" FT repeat_region complement(3860312..3860426) FT /rpt_family="MIR" FT repeat_region complement(3859782..3860079) FT /rpt_family="Alu" FT repeat_region complement(3858253..3858416) FT /rpt_family="MaLR" FT repeat_region complement(3858025..3858146) FT /rpt_family="L1" FT repeat_region complement(3855365..3856312) FT /rpt_family="L1" FT repeat_region complement(3851910..3851998) FT /rpt_family="L2" FT repeat_region complement(3850829..3850863) FT /rpt_family="MIR" FT repeat_region complement(3850221..3850243) FT /rpt_family="AT_rich" FT repeat_region complement(3848631..3849051) FT /rpt_family="MaLR" FT repeat_region complement(3847489..3847734) FT /rpt_family="MIR" FT repeat_region complement(3847428..3847499) FT /rpt_family="MIR" FT repeat_region complement(3847184..3847240) FT /rpt_family="(TCTCTG)n" FT repeat_region complement(3846010..3846053) FT /rpt_family="MaLR" FT repeat_region complement(3845709..3845946) FT /rpt_family="MaLR" FT repeat_region complement(3845001..3845212) FT /rpt_family="L1" FT repeat_region complement(3844795..3845004) FT /rpt_family="L1" FT repeat_region complement(3844509..3844794) FT /rpt_family="L1" FT repeat_region complement(3843695..3844508) FT /rpt_family="L1" FT repeat_region complement(3843370..3843694) FT /rpt_family="Alu" FT repeat_region complement(3843240..3843369) FT /rpt_family="L1" FT repeat_region complement(3842932..3843239) FT /rpt_family="Alu" FT repeat_region complement(3842180..3842931) FT /rpt_family="L1" FT repeat_region complement(3841878..3842179) FT /rpt_family="Alu" FT repeat_region complement(3841653..3841877) FT /rpt_family="L1" FT repeat_region complement(3841311..3841435) FT /rpt_family="L2" FT repeat_region complement(3839982..3840301) FT /rpt_family="Alu" FT repeat_region complement(3839055..3839355) FT /rpt_family="Alu" FT repeat_region complement(3838463..3838718) FT /rpt_family="L1" FT repeat_region complement(3838316..3838462) FT /rpt_family="MaLR" FT repeat_region complement(3838149..3838238) FT /rpt_family="L1" FT repeat_region complement(3837844..3838148) FT /rpt_family="Alu" FT repeat_region complement(3837543..3837843) FT /rpt_family="L1" FT repeat_region complement(3837091..3837127) FT /rpt_family="(TG)n" FT repeat_region complement(3836940..3836995) FT /rpt_family="A-rich" FT repeat_region complement(3836626..3836914) FT /rpt_family="Alu" FT repeat_region complement(3836133..3836269) FT /rpt_family="L2" FT repeat_region complement(3835760..3835997) FT /rpt_family="CR1" FT repeat_region complement(3834610..3834785) FT /rpt_family="MIR" FT repeat_region complement(3834028..3834415) FT /rpt_family="MaLR" FT repeat_region complement(3832246..3832374) FT /rpt_family="(TGGA)n" FT repeat_region complement(3831474..3831788) FT /rpt_family="Alu" FT repeat_region complement(3830575..3830787) FT /rpt_family="MIR" FT repeat_region complement(3830159..3830434) FT /rpt_family="Alu" FT repeat_region complement(3829954..3830095) FT /rpt_family="ERVL" FT repeat_region complement(3829906..3829954) FT /rpt_family="ERVL" FT repeat_region complement(3828788..3829079) FT /rpt_family="Alu" FT repeat_region complement(3828198..3828383) FT /rpt_family="MER1_type" FT repeat_region complement(3826779..3826819) FT /rpt_family="(TG)n" FT repeat_region complement(3823850..3825123) FT /rpt_family="L1" FT repeat_region complement(3823720..3823849) FT /rpt_family="Alu" FT repeat_region complement(3822487..3823719) FT /rpt_family="L1" FT repeat_region complement(3822319..3822484) FT /rpt_family="MER2_type" FT repeat_region complement(3822083..3822308) FT /rpt_family="L1" FT repeat_region complement(3821683..3822082) FT /rpt_family="MaLR" FT repeat_region complement(3820451..3821682) FT /rpt_family="L1" FT repeat_region complement(3819605..3820374) FT /rpt_family="L1" FT repeat_region complement(3819285..3819593) FT /rpt_family="Alu" FT misc_feature complement(3819286..3819566) FT /note="CpG_island (%GC=62.6, o/e=0.81, #CpGs=22)" FT repeat_region complement(3819082..3819103) FT /rpt_family="AT_rich" FT repeat_region complement(3817004..3817151) FT /rpt_family="MIR" FT repeat_region complement(3816162..3816225) FT /rpt_family="MIR" FT repeat_region complement(3815198..3815507) FT /rpt_family="Alu" FT misc_feature complement(3815240..3815504) FT /note="CpG_island (%GC=61.1, o/e=0.80, #CpGs=20)" FT repeat_region complement(3815049..3815074) FT /rpt_family="AT_rich" FT repeat_region complement(3814902..3814980) FT /rpt_family="Mariner" FT repeat_region complement(3813565..3813868) FT /rpt_family="Alu" FT repeat_region complement(3811364..3811747) FT /rpt_family="L1" FT repeat_region complement(3810635..3811095) FT /rpt_family="MaLR" FT repeat_region complement(3810212..3810594) FT /rpt_family="L1" FT repeat_region complement(3809793..3810212) FT /rpt_family="L1" FT repeat_region complement(3809665..3809794) FT /rpt_family="L1" FT repeat_region complement(3809602..3809657) FT /rpt_family="L1" FT repeat_region complement(3809565..3809601) FT /rpt_family="(CA)n" FT repeat_region complement(3809533..3809564) FT /rpt_family="L1" FT repeat_region complement(3809307..3809493) FT /rpt_family="L1" FT repeat_region complement(3809241..3809301) FT /rpt_family="L1" FT repeat_region complement(3808811..3809240) FT /rpt_family="MaLR" FT repeat_region complement(3808700..3808810) FT /rpt_family="L1" FT repeat_region complement(3807535..3807727) FT /rpt_family="MIR" FT repeat_region complement(3807152..3807385) FT /rpt_family="MIR" FT repeat_region complement(3806007..3806242) FT /rpt_family="MIR" FT repeat_region complement(3805271..3805532) FT /rpt_family="MER1_type" FT repeat_region complement(3805037..3805145) FT /rpt_family="L1" FT repeat_region complement(3804765..3804928) FT /rpt_family="L1" FT repeat_region complement(3804444..3804764) FT /rpt_family="MER1_type" FT repeat_region complement(3804340..3804447) FT /rpt_family="MER1_type" FT repeat_region complement(3804036..3804339) FT /rpt_family="Alu" FT repeat_region complement(3803930..3804035) FT /rpt_family="MER1_type" FT repeat_region complement(3803498..3803654) FT /rpt_family="L1" FT repeat_region complement(3802971..3803083) FT /rpt_family="L1" FT repeat_region complement(3802887..3802968) FT /rpt_family="L1" FT repeat_region complement(3801872..3802302) FT /rpt_family="MER1_type" FT repeat_region complement(3800997..3801199) FT /rpt_family="Alu" FT repeat_region complement(3800893..3800912) FT /rpt_family="(A)n" FT repeat_region complement(3800352..3800726) FT /rpt_family="L1" FT repeat_region complement(3799523..3800351) FT /rpt_family="Ricksha" FT repeat_region complement(3799247..3799522) FT /rpt_family="Alu" FT repeat_region complement(3799217..3799246) FT /rpt_family="(TAA)n" FT repeat_region complement(3799185..3799216) FT /rpt_family="Alu" FT repeat_region complement(3798906..3799184) FT /rpt_family="Ricksha" FT repeat_region complement(3798825..3798906) FT /rpt_family="Ricksha" FT repeat_region complement(3798163..3798796) FT /rpt_family="L1" FT repeat_region complement(3798085..3798162) FT /rpt_family="Mariner" FT repeat_region complement(3797796..3798084) FT /rpt_family="L1" FT repeat_region complement(3797682..3797793) FT /rpt_family="MaLR" FT repeat_region complement(3797169..3797680) FT /rpt_family="ERV1" FT repeat_region complement(3796920..3797168) FT /rpt_family="Alu" FT repeat_region complement(3796638..3796919) FT /rpt_family="ERV1" FT repeat_region complement(3796213..3796632) FT /rpt_family="L1" FT repeat_region complement(3796088..3796194) FT /rpt_family="L1" FT repeat_region complement(3795466..3795526) FT /rpt_family="L1" FT repeat_region complement(3795215..3795492) FT /rpt_family="L1" FT repeat_region complement(3794646..3795021) FT /rpt_family="ERV1" FT repeat_region complement(3790041..3790402) FT /rpt_family="ERV1" FT repeat_region complement(3788936..3789230) FT /rpt_family="Alu" FT repeat_region complement(3788772..3788935) FT /rpt_family="Alu" FT repeat_region complement(3787712..3787830) FT /rpt_family="L1" FT repeat_region complement(3787331..3787353) FT /rpt_family="(CA)n" FT repeat_region complement(3787128..3787214) FT /rpt_family="L2" FT repeat_region complement(3785705..3786748) FT /rpt_family="MER2_type" FT repeat_region complement(3785517..3785704) FT /rpt_family="MIR" FT repeat_region complement(3785347..3785482) FT /rpt_family="L1" FT repeat_region complement(3784967..3785341) FT /rpt_family="L1" FT repeat_region complement(3784162..3784514) FT /rpt_family="Alu" FT repeat_region complement(3783721..3784040) FT /rpt_family="L2" FT repeat_region complement(3783266..3783319) FT /rpt_family="MIR" FT repeat_region complement(3781863..3782439) FT /rpt_family="ERV1" FT repeat_region complement(3781620..3781645) FT /rpt_family="(TA)n" FT repeat_region complement(3781429..3781460) FT /rpt_family="(TG)n" FT repeat_region complement(3778591..3780516) FT /rpt_family="L1" FT repeat_region complement(3777704..3778583) FT /rpt_family="L1" FT repeat_region complement(3777041..3777710) FT /rpt_family="L1" FT repeat_region complement(3776269..3776758) FT /rpt_family="L1" FT repeat_region complement(3775928..3776203) FT /rpt_family="Alu" FT repeat_region complement(3774794..3775849) FT /rpt_family="L1" FT repeat_region complement(3773498..3773648) FT /rpt_family="MER1_type" FT repeat_region complement(3773475..3773621) FT /rpt_family="MER1_type" FT repeat_region complement(3773211..3773317) FT /rpt_family="L2" FT repeat_region complement(3771411..3771720) FT /rpt_family="Alu" FT repeat_region complement(3770641..3770940) FT /rpt_family="MaLR" FT repeat_region complement(3769468..3769502) FT /rpt_family="U2" FT repeat_region complement(3769018..3769196) FT /rpt_family="MER1_type" FT repeat_region complement(3768245..3768533) FT /rpt_family="Alu" FT repeat_region complement(3767458..3767888) FT /rpt_family="L1" FT repeat_region complement(3767127..3767422) FT /rpt_family="Alu" FT repeat_region complement(3763923..3764057) FT /rpt_family="Alu" FT repeat_region complement(3763624..3763896) FT /rpt_family="Alu" FT repeat_region complement(3763576..3763623) FT /rpt_family="(TC)n" FT repeat_region complement(3763320..3763575) FT /rpt_family="(TATATG)n" FT repeat_region complement(3763291..3763319) FT /rpt_family="(CA)n" FT repeat_region complement(3761568..3761806) FT /rpt_family="Alu" FT repeat_region complement(3759926..3761082) FT /rpt_family="L1" FT repeat_region complement(3759771..3759921) FT /rpt_family="Alu" FT repeat_region complement(3759638..3759770) FT /rpt_family="L1" FT repeat_region complement(3759331..3759637) FT /rpt_family="Alu" FT repeat_region complement(3758222..3759330) FT /rpt_family="L1" FT repeat_region complement(3757850..3758221) FT /rpt_family="Alu" FT repeat_region complement(3756800..3757849) FT /rpt_family="L1" FT repeat_region complement(3756422..3756806) FT /rpt_family="L1" FT repeat_region complement(3756124..3756421) FT /rpt_family="Alu" FT repeat_region complement(3756028..3756123) FT /rpt_family="L1" FT repeat_region complement(3755135..3755990) FT /rpt_family="L1" FT repeat_region complement(3754042..3754120) FT /rpt_family="MIR" FT repeat_region complement(3751703..3752229) FT /rpt_family="MER1_type" FT repeat_region complement(3751553..3751697) FT /rpt_family="MIR" FT repeat_region complement(3750942..3751467) FT /rpt_family="L2" FT repeat_region complement(3749133..3749327) FT /rpt_family="L1" FT repeat_region complement(3748943..3749107) FT /rpt_family="L1" FT repeat_region complement(3748423..3748946) FT /rpt_family="L1" FT repeat_region complement(3748320..3748420) FT /rpt_family="MaLR" FT repeat_region complement(3747582..3747947) FT /rpt_family="MaLR" FT repeat_region complement(3746030..3746333) FT /rpt_family="Alu" FT repeat_region complement(3745058..3745139) FT /rpt_family="(TAAAA)n" FT repeat_region complement(3743544..3743976) FT /rpt_family="L1" FT repeat_region complement(3742714..3743366) FT /rpt_family="L1" FT repeat_region complement(3742678..3742713) FT /rpt_family="Alu" FT repeat_region complement(3742441..3742677) FT /rpt_family="L1" FT repeat_region complement(3741257..3741960) FT /rpt_family="L1" FT repeat_region complement(3741084..3741252) FT /rpt_family="Alu" FT repeat_region complement(3740691..3741046) FT /rpt_family="L1" FT repeat_region complement(3740391..3740567) FT /rpt_family="L1" FT repeat_region complement(3739636..3740384) FT /rpt_family="L1" FT repeat_region complement(3987884..3988135) FT /rpt_family="Alu" FT repeat_region complement(3987407..3987642) FT /rpt_family="L1" FT repeat_region complement(3987228..3987347) FT /rpt_family="(TA)n" FT repeat_region complement(3987163..3987201) FT /rpt_family="(CA)n" FT repeat_region complement(3987004..3987146) FT /rpt_family="L1" FT repeat_region complement(3986835..3986978) FT /rpt_family="L1" FT repeat_region complement(3986526..3986720) FT /rpt_family="L1" FT repeat_region complement(3986113..3986248) FT /rpt_family="Alu" FT repeat_region complement(3985807..3986108) FT /rpt_family="Alu" FT repeat_region complement(3985562..3985786) FT /rpt_family="L1" FT repeat_region complement(3985246..3985561) FT /rpt_family="Alu" FT repeat_region complement(3984964..3985245) FT /rpt_family="L1" FT repeat_region complement(3984622..3984763) FT /rpt_family="Alu" FT repeat_region complement(3983861..3983952) FT /rpt_family="MIR" FT repeat_region complement(3982981..3983047) FT /rpt_family="GA-rich" FT repeat_region complement(3981537..3981837) FT /rpt_family="Alu" FT repeat_region complement(3980439..3980475) FT /rpt_family="AT_rich" FT repeat_region complement(3980193..3980438) FT /rpt_family="Alu" FT repeat_region complement(3977993..3978292) FT /rpt_family="Alu" FT repeat_region complement(3977470..3977768) FT /rpt_family="Alu" FT repeat_region complement(3976847..3977041) FT /rpt_family="L2" FT repeat_region complement(3976232..3976349) FT /rpt_family="L1" FT repeat_region complement(3975932..3976231) FT /rpt_family="Alu" FT repeat_region complement(3974862..3975931) FT /rpt_family="L1" FT repeat_region complement(3974376..3974651) FT /rpt_family="ERVL" FT repeat_region complement(3972756..3973044) FT /rpt_family="Alu" FT repeat_region complement(3970262..3970454) FT /rpt_family="Alu" FT repeat_region complement(3969942..3970079) FT /rpt_family="MER1_type" FT repeat_region complement(3969758..3969842) FT /rpt_family="MER1_type" FT repeat_region complement(3969602..3969626) FT /rpt_family="AT_rich" FT repeat_region complement(3969414..3969585) FT /rpt_family="MaLR" FT repeat_region complement(3968326..3968528) FT /rpt_family="MIR" FT repeat_region complement(3966991..3967202) FT /rpt_family="MIR" FT repeat_region complement(3966379..3966489) FT /rpt_family="MIR" FT repeat_region complement(3966219..3966303) FT /rpt_family="Alu" FT repeat_region complement(3966092..3966226) FT /rpt_family="Alu" FT repeat_region complement(3965952..3965990) FT /rpt_family="L2" FT repeat_region complement(3963123..3963283) FT /rpt_family="MER1_type" FT repeat_region complement(3962384..3962566) FT /rpt_family="L1" FT repeat_region complement(3961917..3962068) FT /rpt_family="MER1_type" FT repeat_region complement(3961316..3961602) FT /rpt_family="Alu" FT repeat_region complement(3960689..3961156) FT /rpt_family="L1" FT repeat_region complement(3958579..3958724) FT /rpt_family="(TAA)n" FT repeat_region complement(3957836..3958355) FT /rpt_family="MER1_type" FT repeat_region complement(3956456..3956516) FT /rpt_family="(TCTA)n" FT repeat_region complement(3955602..3956080) FT /rpt_family="ERV1" FT repeat_region complement(3954946..3955318) FT /rpt_family="MaLR" FT repeat_region complement(3953520..3953609) FT /rpt_family="MIR" FT repeat_region complement(3952925..3953224) FT /rpt_family="Alu" FT misc_feature complement(3952988..3953221) FT /note="CpG_island (%GC=58.1, o/e=0.85, #CpGs=17)" FT repeat_region complement(3950947..3951285) FT /rpt_family="MaLR" FT repeat_region complement(3948740..3948955) FT /rpt_family="MaLR" FT repeat_region complement(3947701..3947766) FT /rpt_family="L2" FT repeat_region complement(3946782..3947302) FT /rpt_family="L1" FT repeat_region complement(3946250..3946561) FT /rpt_family="Alu" FT repeat_region complement(3946005..3946032) FT /rpt_family="(CA)n" FT repeat_region complement(3945556..3945928) FT /rpt_family="L1" FT repeat_region complement(3945265..3945555) FT /rpt_family="Alu" FT repeat_region complement(3945202..3945264) FT /rpt_family="L1" FT repeat_region complement(3945026..3945190) FT /rpt_family="L1" FT repeat_region complement(3944967..3945022) FT /rpt_family="L1" FT repeat_region complement(3944742..3944954) FT /rpt_family="L1" FT repeat_region complement(3944647..3944717) FT /rpt_family="L1" FT repeat_region complement(3944344..3944641) FT /rpt_family="Alu" FT repeat_region complement(3944048..3944334) FT /rpt_family="Alu" FT repeat_region complement(3943760..3944018) FT /rpt_family="L1" FT repeat_region complement(3943347..3943759) FT /rpt_family="MaLR" FT repeat_region complement(3943078..3943346) FT /rpt_family="L1" FT repeat_region complement(3942765..3943077) FT /rpt_family="Alu" FT repeat_region complement(3942465..3942764) FT /rpt_family="L1" FT repeat_region complement(3941106..3942443) FT /rpt_family="L1" FT repeat_region complement(3940811..3941105) FT /rpt_family="Alu" FT repeat_region complement(3940244..3940810) FT /rpt_family="L1" FT repeat_region complement(3939856..3939884) FT /rpt_family="AT_rich" FT repeat_region complement(3938989..3939155) FT /rpt_family="MIR" FT repeat_region complement(3937461..3937582) FT /rpt_family="A-rich" FT repeat_region complement(3937378..3937398) FT /rpt_family="(CA)n" FT repeat_region complement(3936829..3937283) FT /rpt_family="L1" FT repeat_region complement(3936470..3936828) FT /rpt_family="MaLR" FT repeat_region complement(3936449..3936469) FT /rpt_family="L1" FT repeat_region complement(3935968..3936430) FT /rpt_family="L1" FT repeat_region complement(3935770..3935944) FT /rpt_family="L1" FT repeat_region complement(3935273..3935766) FT /rpt_family="L1" FT repeat_region complement(3934978..3935212) FT /rpt_family="MaLR" FT repeat_region complement(3934324..3934612) FT /rpt_family="Alu" FT repeat_region complement(3932891..3933085) FT /rpt_family="MIR" FT repeat_region complement(3932628..3932791) FT /rpt_family="MIR" FT repeat_region complement(3931841..3932132) FT /rpt_family="MaLR" FT repeat_region complement(3931725..3931831) FT /rpt_family="MaLR" FT repeat_region complement(3930295..3930567) FT /rpt_family="Alu" FT repeat_region complement(3929867..3930156) FT /rpt_family="MER1_type" FT repeat_region complement(3929674..3929825) FT /rpt_family="MIR" FT repeat_region complement(3929583..3929645) FT /rpt_family="ERVL" FT repeat_region complement(3929143..3929439) FT /rpt_family="Alu" FT repeat_region complement(3926687..3927024) FT /rpt_family="MaLR" FT repeat_region complement(3926266..3926553) FT /rpt_family="Alu" FT repeat_region complement(3926045..3926109) FT /rpt_family="MIR" FT repeat_region complement(3925570..3925981) FT /rpt_family="ERVL" FT repeat_region complement(3924228..3924274) FT /rpt_family="L2" FT repeat_region complement(3924101..3924183) FT /rpt_family="MIR" FT repeat_region complement(3923732..3923876) FT /rpt_family="Alu" FT repeat_region complement(3923677..3923731) FT /rpt_family="(CAAA)n" FT repeat_region complement(3923409..3923619) FT /rpt_family="L2" FT repeat_region complement(3923313..3923350) FT /rpt_family="(GGGA)n" FT repeat_region complement(3921555..3921914) FT /rpt_family="MaLR" FT repeat_region complement(3920741..3921361) FT /rpt_family="L1" FT repeat_region complement(3920176..3920201) FT /rpt_family="(A)n" FT repeat_region complement(3918473..3918585) FT /rpt_family="L1" FT repeat_region complement(3918242..3918313) FT /rpt_family="MIR" FT repeat_region complement(3917871..3918174) FT /rpt_family="Alu" FT repeat_region complement(3917447..3917728) FT /rpt_family="L1" FT repeat_region complement(3917237..3917353) FT /rpt_family="L1" FT repeat_region complement(3916170..3916192) FT /rpt_family="AT_rich" FT repeat_region complement(3914664..3914980) FT /rpt_family="L1" FT repeat_region complement(3913079..3914163) FT /rpt_family="L1" FT repeat_region complement(3913057..3913078) FT /rpt_family="(CAAAA)n" FT repeat_region complement(3912373..3913056) FT /rpt_family="L1" FT repeat_region complement(3911481..3912366) FT /rpt_family="L1" FT repeat_region complement(3911079..3911480) FT /rpt_family="MaLR" FT repeat_region complement(3910586..3911078) FT /rpt_family="L1" FT repeat_region complement(3910210..3910580) FT /rpt_family="L1" FT repeat_region complement(3908776..3909087) FT /rpt_family="Alu" FT repeat_region complement(3908692..3908737) FT /rpt_family="MER1_type" FT repeat_region complement(3907024..3907371) FT /rpt_family="MaLR" FT repeat_region complement(3905858..3906049) FT /rpt_family="L2" FT repeat_region complement(3905134..3905429) FT /rpt_family="Alu" FT repeat_region complement(3903912..3904013) FT /rpt_family="L1" FT repeat_region complement(3903034..3903738) FT /rpt_family="L1" FT repeat_region complement(3902395..3902719) FT /rpt_family="MER1_type" FT repeat_region complement(3901808..3901964) FT /rpt_family="MER1_type" FT repeat_region complement(3900236..3900665) FT /rpt_family="ERV1" FT repeat_region complement(3899818..3900235) FT /rpt_family="L1" FT repeat_region complement(3899556..3899817) FT /rpt_family="Alu" FT repeat_region complement(3899532..3899555) FT /rpt_family="L1" FT repeat_region complement(3899035..3899206) FT /rpt_family="MaLR" FT repeat_region complement(3898794..3898909) FT /rpt_family="MaLR" FT repeat_region complement(3898486..3898793) FT /rpt_family="Alu" FT repeat_region complement(3898431..3898485) FT /rpt_family="MaLR" FT repeat_region complement(3898189..3898308) FT /rpt_family="L1" FT repeat_region complement(3897903..3898029) FT /rpt_family="Alu" FT repeat_region complement(3897718..3897902) FT /rpt_family="L1" FT repeat_region complement(3897341..3897706) FT /rpt_family="L1" FT repeat_region complement(3897033..3897340) FT /rpt_family="Alu" FT repeat_region complement(3896695..3897032) FT /rpt_family="L1" FT repeat_region complement(3896520..3896587) FT /rpt_family="L1" FT repeat_region complement(3896141..3896429) FT /rpt_family="Alu" FT repeat_region complement(3896114..3896134) FT /rpt_family="(T)n" FT repeat_region complement(3895097..3895300) FT /rpt_family="L1" FT repeat_region complement(3894871..3895051) FT /rpt_family="L1" FT repeat_region complement(3893830..3894063) FT /rpt_family="MIR" FT repeat_region complement(3893630..3893684) FT /rpt_family="MER2_type" FT repeat_region complement(3893341..3893629) FT /rpt_family="Alu" FT repeat_region complement(3893148..3893340) FT /rpt_family="MER2_type" FT repeat_region complement(3893095..3893123) FT /rpt_family="AT_rich" FT repeat_region complement(3892692..3892829) FT /rpt_family="MER2_type" FT repeat_region complement(3892098..3892408) FT /rpt_family="Alu" FT repeat_region complement(3890013..3890652) FT /rpt_family="L1" FT repeat_region complement(3889769..3889981) FT /rpt_family="MIR" FT repeat_region complement(4114519..4114549) FT /rpt_family="(TA)n" FT repeat_region complement(4114486..4114517) FT /rpt_family="(GA)n" FT repeat_region complement(4114211..4114485) FT /rpt_family="Alu" FT repeat_region complement(4114032..4114133) FT /rpt_family="MIR" FT repeat_region complement(4113401..4114005) FT /rpt_family="ERV1" FT repeat_region complement(4110648..4110956) FT /rpt_family="Alu" FT repeat_region complement(4110343..4110607) FT /rpt_family="Alu" FT repeat_region complement(4109625..4110156) FT /rpt_family="MER1_type" FT repeat_region complement(4108347..4108653) FT /rpt_family="Alu" FT repeat_region complement(4108096..4108176) FT /rpt_family="MIR" FT repeat_region complement(4107878..4108016) FT /rpt_family="MIR" FT repeat_region complement(4105327..4105361) FT /rpt_family="(A)n" FT repeat_region complement(4101760..4101786) FT /rpt_family="(TTA)n" FT repeat_region complement(4100998..4101759) FT /rpt_family="L1" FT repeat_region complement(4100042..4101000) FT /rpt_family="L1" FT repeat_region complement(4099510..4099812) FT /rpt_family="Alu" FT repeat_region complement(4094219..4095731) FT /rpt_family="L1" FT repeat_region complement(4093878..4094215) FT /rpt_family="L1" FT repeat_region complement(4093564..4093868) FT /rpt_family="Alu" FT repeat_region complement(4092447..4092740) FT /rpt_family="Alu" FT repeat_region complement(4091973..4092420) FT /rpt_family="L1" FT repeat_region complement(4090484..4090977) FT /rpt_family="L1" FT repeat_region complement(4090325..4090345) FT /rpt_family="AT_rich" FT repeat_region complement(4087317..4087502) FT /rpt_family="L1" FT repeat_region complement(4086723..4087124) FT /rpt_family="L1" FT repeat_region complement(4086525..4086733) FT /rpt_family="L1" FT repeat_region complement(4086453..4086524) FT /rpt_family="Alu" FT repeat_region complement(4085881..4086452) FT /rpt_family="L1" FT repeat_region complement(4085578..4085880) FT /rpt_family="Alu" FT repeat_region complement(4085178..4085577) FT /rpt_family="L1" FT repeat_region complement(4084874..4085177) FT /rpt_family="Alu" FT repeat_region complement(4084400..4084873) FT /rpt_family="L1" FT repeat_region complement(4084074..4084376) FT /rpt_family="Alu" FT repeat_region complement(4083650..4084072) FT /rpt_family="MaLR" FT repeat_region complement(4083580..4083635) FT /rpt_family="A-rich" FT repeat_region complement(4081448..4081743) FT /rpt_family="Alu" FT repeat_region complement(4080925..4081381) FT /rpt_family="L1" FT repeat_region complement(4080048..4080711) FT /rpt_family="ERV1" FT repeat_region complement(4079623..4080047) FT /rpt_family="ERV1" FT repeat_region complement(4079012..4079056) FT /rpt_family="AT_rich" FT repeat_region complement(4078677..4078944) FT /rpt_family="L1" FT repeat_region complement(4077607..4077932) FT /rpt_family="ERVL" FT repeat_region complement(4076968..4077267) FT /rpt_family="Alu" FT repeat_region complement(4076212..4076542) FT /rpt_family="MaLR" FT repeat_region complement(4075344..4075587) FT /rpt_family="L1" FT repeat_region complement(4074620..4074916) FT /rpt_family="Alu" FT repeat_region complement(4074489..4074546) FT /rpt_family="L1" FT repeat_region complement(4074213..4074488) FT /rpt_family="L1" FT repeat_region complement(4073490..4074109) FT /rpt_family="L1" FT repeat_region complement(4071749..4073490) FT /rpt_family="L1" FT misc_feature complement(4072876..4073062) FT /note="unresolved homopolymeric repeat" FT unsure complement(4072876..4073062) FT /note="unresolved simple sequence repeat" FT repeat_region complement(4071406..4071676) FT /rpt_family="Alu" FT repeat_region complement(4071041..4071404) FT /rpt_family="L1" FT repeat_region complement(4070926..4070946) FT /rpt_family="AT_rich" FT repeat_region complement(4070674..4070856) FT /rpt_family="(TATATG)n" FT repeat_region complement(4070520..4070571) FT /rpt_family="L2" FT repeat_region complement(4069194..4070034) FT /rpt_family="CR1" FT repeat_region complement(4069147..4069186) FT /rpt_family="(TGAA)n" FT repeat_region complement(4068832..4069142) FT /rpt_family="Alu" FT repeat_region complement(4067713..4067881) FT /rpt_family="MER1_type" FT repeat_region complement(4067585..4067681) FT /rpt_family="CT-rich" FT repeat_region complement(4065189..4065346) FT /rpt_family="L2" FT repeat_region complement(4064692..4064847) FT /rpt_family="MER1_type" FT repeat_region complement(4064649..4064686) FT /rpt_family="(TG)n" FT repeat_region complement(4064453..4064475) FT /rpt_family="(CAAAAA)n" FT repeat_region complement(4064281..4064444) FT /rpt_family="MIR" FT repeat_region complement(4062394..4062705) FT /rpt_family="Alu" FT repeat_region complement(4061026..4061372) FT /rpt_family="MaLR" FT repeat_region complement(4060356..4060542) FT /rpt_family="MIR" FT repeat_region complement(4058340..4058517) FT /rpt_family="L2" FT repeat_region complement(4054743..4054874) FT /rpt_family="MIR" FT repeat_region complement(4054278..4054299) FT /rpt_family="AT_rich" FT repeat_region complement(4052645..4052797) FT /rpt_family="MER1_type" FT repeat_region complement(4052193..4052508) FT /rpt_family="Alu" FT repeat_region complement(4051930..4052053) FT /rpt_family="MER1_type" FT repeat_region complement(4050413..4050508) FT /rpt_family="MIR" FT repeat_region complement(4048444..4048777) FT /rpt_family="L1" FT repeat_region complement(4047938..4048443) FT /rpt_family="ERV1" FT repeat_region complement(4047526..4047937) FT /rpt_family="L1" FT repeat_region complement(4047226..4047517) FT /rpt_family="Alu" FT repeat_region complement(4046762..4046869) FT /rpt_family="ERVL" FT repeat_region complement(4045382..4045717) FT /rpt_family="Alu" FT repeat_region complement(4045185..4045283) FT /rpt_family="MIR" FT repeat_region complement(4045021..4045069) FT /rpt_family="(CA)n" FT repeat_region complement(4044672..4044952) FT /rpt_family="Alu" FT repeat_region complement(4044382..4044528) FT /rpt_family="L1" FT repeat_region complement(4044058..4044198) FT /rpt_family="L1" FT repeat_region complement(4043778..4043861) FT /rpt_family="L2" FT repeat_region complement(4043277..4043316) FT /rpt_family="L1" FT repeat_region complement(4043257..4043276) FT /rpt_family="(ATGTG)n" FT repeat_region complement(4043150..4043256) FT /rpt_family="L1" FT repeat_region complement(4042932..4043148) FT /rpt_family="L1" FT repeat_region complement(4042404..4042468) FT /rpt_family="AcHobo" FT repeat_region complement(4042288..4042337) FT /rpt_family="(TATATG)n" FT repeat_region complement(4038758..4038784) FT /rpt_family="(TG)n" FT repeat_region complement(4036787..4037944) FT /rpt_family="ERV1" FT repeat_region complement(4036576..4036777) FT /rpt_family="L1" FT repeat_region complement(4036061..4036570) FT /rpt_family="L1" FT repeat_region complement(4035477..4036033) FT /rpt_family="L1" FT repeat_region complement(4034738..4034932) FT /rpt_family="L2" FT repeat_region complement(4033992..4034298) FT /rpt_family="Alu" FT repeat_region complement(4033527..4033973) FT /rpt_family="L2" FT repeat_region complement(4033148..4033178) FT /rpt_family="AT_rich" FT repeat_region complement(4032377..4032764) FT /rpt_family="ERV1" FT repeat_region complement(4030932..4031203) FT /rpt_family="L2" FT repeat_region complement(4029496..4029627) FT /rpt_family="MIR" FT repeat_region complement(4028740..4029082) FT /rpt_family="MaLR" FT repeat_region complement(4028398..4028685) FT /rpt_family="Alu" FT repeat_region complement(4027556..4028157) FT /rpt_family="L2" FT repeat_region complement(4026211..4026512) FT /rpt_family="Alu" FT repeat_region complement(4025139..4025280) FT /rpt_family="Alu" FT repeat_region complement(4024623..4024800) FT /rpt_family="ERV1" FT repeat_region complement(4022191..4022488) FT /rpt_family="Alu" FT repeat_region complement(4020294..4020599) FT /rpt_family="Alu" FT repeat_region complement(4019077..4019146) FT /rpt_family="L2" FT repeat_region complement(4018740..4018856) FT /rpt_family="MIR" FT repeat_region complement(4013853..4013912) FT /rpt_family="L1" FT repeat_region complement(4013532..4013845) FT /rpt_family="Alu" FT repeat_region complement(4011707..4012010) FT /rpt_family="Alu" FT repeat_region complement(4010600..4010715) FT /rpt_family="MIR" FT repeat_region complement(4010123..4010204) FT /rpt_family="T2_type" FT repeat_region complement(4008450..4008806) FT /rpt_family="MaLR" FT repeat_region complement(4008276..4008445) FT /rpt_family="L1" FT repeat_region complement(4007515..4007588) FT /rpt_family="L2" FT repeat_region complement(4007201..4007514) FT /rpt_family="MER1_type" FT repeat_region complement(4006314..4006607) FT /rpt_family="Alu" FT repeat_region complement(4005191..4005291) FT /rpt_family="L2" FT repeat_region complement(4004936..4005034) FT /rpt_family="MIR" FT repeat_region complement(4004672..4004875) FT /rpt_family="MER1_type" FT repeat_region complement(4001744..4001873) FT /rpt_family="MIR" FT repeat_region complement(4001556..4001735) FT /rpt_family="(TG)n" FT repeat_region complement(4001442..4001552) FT /rpt_family="(TATATG)n" FT repeat_region complement(3999173..3999448) FT /rpt_family="L1" FT repeat_region complement(3999067..3999407) FT /rpt_family="L1" FT repeat_region complement(3998794..3998863) FT /rpt_family="MIR" FT repeat_region complement(3996663..3997134) FT /rpt_family="L1" FT repeat_region complement(3994787..3995190) FT /rpt_family="MaLR" FT repeat_region complement(3994348..3994455) FT /rpt_family="MIR" FT repeat_region complement(3994179..3994303) FT /rpt_family="G-rich" FT repeat_region complement(3993955..3994163) FT /rpt_family="(GGGGA)n" FT repeat_region complement(3993853..3993950) FT /rpt_family="G-rich" FT repeat_region complement(3992226..3992263) FT /rpt_family="AT_rich" FT repeat_region complement(3991931..3992225) FT /rpt_family="Alu" FT repeat_region complement(3990424..3990501) FT /rpt_family="MER2_type" FT repeat_region complement(3990346..3990423) FT /rpt_family="MER2_type" FT repeat_region complement(3990236..3990309) FT /rpt_family="MER2_type" FT repeat_region complement(3990004..3990228) FT /rpt_family="MER2_type" FT repeat_region complement(3987936..3988193) FT /rpt_family="Alu" FT repeat_region 4115279..4115583 FT /rpt_family="Alu" FT repeat_region 4115911..4116172 FT /rpt_family="Alu" FT repeat_region 4116180..4116218 FT /rpt_family="(CATA)n" FT repeat_region 4117149..4117517 FT /rpt_family="MaLR" FT repeat_region 4119589..4119700 FT /rpt_family="L2" FT repeat_region 4120256..4120316 FT /rpt_family="L1" FT repeat_region 4120317..4120499 FT /rpt_family="L1" FT repeat_region 4120500..4120602 FT /rpt_family="L1" FT repeat_region 4120852..4121020 FT /rpt_family="MaLR" FT repeat_region 4121049..4121349 FT /rpt_family="Alu" FT repeat_region 4121358..4121529 FT /rpt_family="L1" FT repeat_region 4121569..4121828 FT /rpt_family="L1" FT repeat_region 4121888..4122196 FT /rpt_family="Alu" FT repeat_region 4122228..4122254 FT /rpt_family="L1" FT repeat_region 4122255..4122551 FT /rpt_family="Alu" FT repeat_region 4122552..4122696 FT /rpt_family="L1" FT repeat_region 4122720..4122949 FT /rpt_family="L1" FT repeat_region 4123057..4123123 FT /rpt_family="L1" FT repeat_region 4123157..4123494 FT /rpt_family="CT-rich" FT repeat_region 4123601..4123891 FT /rpt_family="L1" FT repeat_region 4123925..4124020 FT /rpt_family="L1" FT repeat_region 4124055..4124265 FT /rpt_family="L1" FT repeat_region 4124295..4124365 FT /rpt_family="(TTATG)n" FT repeat_region 4124380..4124696 FT /rpt_family="Alu" FT repeat_region 4125184..4125486 FT /rpt_family="Alu" FT repeat_region 4125515..4125903 FT /rpt_family="L1" FT repeat_region 4125910..4126465 FT /rpt_family="MaLR" FT repeat_region 4126479..4126645 FT /rpt_family="L1" FT repeat_region 4126679..4127064 FT /rpt_family="L1" FT repeat_region 4127094..4127133 FT /rpt_family="(CA)n" FT repeat_region 4127352..4127514 FT /rpt_family="MIR" FT repeat_region 4127617..4127786 FT /rpt_family="MIR" FT repeat_region 4127800..4127955 FT /rpt_family="L1" FT repeat_region 4128136..4128299 FT /rpt_family="L1" FT repeat_region 4129460..4130602 FT /rpt_family="L1" FT repeat_region 4130963..4131273 FT /rpt_family="Alu" FT repeat_region 4131662..4131813 FT /rpt_family="MIR" FT repeat_region 4133091..4133115 FT /rpt_family="(A)n" FT repeat_region 4133681..4133993 FT /rpt_family="Alu" FT repeat_region 4134288..4135176 FT /rpt_family="ERV1" FT repeat_region 4135177..4135220 FT /rpt_family="(TTTA)n" FT repeat_region 4135223..4135505 FT /rpt_family="Alu" FT repeat_region 4135506..4135629 FT /rpt_family="ERV1" FT repeat_region 4136936..4137072 FT /rpt_family="L2" FT repeat_region 4138125..4138183 FT /rpt_family="L2" FT repeat_region 4138294..4138604 FT /rpt_family="Alu" FT repeat_region 4138847..4139319 FT /rpt_family="ERVL" FT unsure 4139247..4139584 FT /note="unresolved simple sequence repeat" FT repeat_region 4140084..4140383 FT /rpt_family="MaLR" FT repeat_region 4140782..4141077 FT /rpt_family="Alu" FT repeat_region 4142577..4142608 FT /rpt_family="(A)n" FT repeat_region 4142640..4142931 FT /rpt_family="Alu" FT repeat_region 4143464..4143678 FT /rpt_family="MER1_type" FT repeat_region 4143698..4143992 FT /rpt_family="Alu" FT repeat_region 4144036..4144319 FT /rpt_family="ERV1" FT repeat_region 4144337..4144598 FT /rpt_family="Alu" FT repeat_region 4144608..4144914 FT /rpt_family="Alu" FT repeat_region 4144928..4145236 FT /rpt_family="Alu" FT repeat_region 4145924..4146227 FT /rpt_family="Alu" FT misc_feature 4146207..4146430 FT /note="CpG_island (%GC=65.2, o/e=0.76, #CpGs=19)" FT repeat_region 4146745..4146797 FT /rpt_family="(GGGTG)n" FT repeat_region 4147531..4147596 FT /rpt_family="MIR" FT repeat_region 4148294..4148869 FT /rpt_family="L1" FT repeat_region 4148988..4149139 FT /rpt_family="CR1" FT repeat_region 4149873..4149992 FT /rpt_family="MIR" FT repeat_region 4151499..4151611 FT /rpt_family="MIR" FT repeat_region 4151644..4151991 FT /rpt_family="ERV1" FT repeat_region 4151992..4152079 FT /rpt_family="ERV1" FT repeat_region 4152391..4152668 FT /rpt_family="Alu" FT repeat_region 4152682..4152768 FT /rpt_family="Alu" FT misc_feature 4153646..4153898 FT /note="CpG_island (%GC=63.2, o/e=1.00, #CpGs=21)" FT repeat_region 4154279..4154442 FT /rpt_family="MaLR" FT repeat_region 4156782..4156818 FT /rpt_family="L1" FT repeat_region 4156819..4157120 FT /rpt_family="Alu" FT repeat_region 4157121..4157236 FT /rpt_family="L1" FT repeat_region 4157678..4158740 FT /rpt_family="L1" FT repeat_region 4158800..4159104 FT /rpt_family="Alu" FT repeat_region 4159275..4160151 FT /rpt_family="L1" FT repeat_region 4159938..4160162 FT /rpt_family="L1" FT repeat_region 4160257..4160547 FT /rpt_family="Alu" FT repeat_region 4160908..4161273 FT /rpt_family="MaLR" FT repeat_region 4163831..4164292 FT /rpt_family="MaLR" FT repeat_region 4164459..4165169 FT /rpt_family="(TGGA)n" FT repeat_region 4166072..4166327 FT /rpt_family="Alu" FT repeat_region 4166439..4166561 FT /rpt_family="MIR" FT repeat_region 4167358..4167527 FT /rpt_family="MIR" FT repeat_region 4168228..4168388 FT /rpt_family="(GGGTG)n" FT repeat_region 4168438..4168598 FT /rpt_family="(GGGTG)n" FT repeat_region 4168810..4168971 FT /rpt_family="(GGGTG)n" FT misc_feature 4169482..4169753 FT /note="CpG_island (%GC=65.8, o/e=0.92, #CpGs=24)" FT repeat_region 4170069..4170130 FT /rpt_family="MER2_type" FT repeat_region 4172072..4172377 FT /rpt_family="Alu" FT repeat_region 4172944..4173099 FT /rpt_family="L2" FT repeat_region 4174811..4175120 FT /rpt_family="L1" FT repeat_region 4175198..4175410 FT /rpt_family="MIR" FT repeat_region 4176776..4176929 FT /rpt_family="Alu" FT repeat_region 4178096..4178409 FT /rpt_family="Alu" FT repeat_region 4178423..4178445 FT /rpt_family="(GAAAA)n" FT repeat_region 4178529..4178905 FT /rpt_family="ERVL" FT repeat_region 4179002..4179076 FT /rpt_family="ERV1" FT repeat_region 4179080..4179389 FT /rpt_family="(TG)n" FT repeat_region 4180452..4180569 FT /rpt_family="Alu" FT repeat_region 4180570..4180597 FT /rpt_family="AT_rich" FT repeat_region 4181390..4181686 FT /rpt_family="Alu" FT repeat_region 4181945..4182258 FT /rpt_family="Alu" FT repeat_region 4182260..4182394 FT /rpt_family="Alu" FT repeat_region 4183093..4183247 FT /rpt_family="MIR" FT repeat_region 4186472..4186582 FT /rpt_family="MIR" FT repeat_region 4186813..4187012 FT /rpt_family="Alu" FT repeat_region 4187014..4187191 FT /rpt_family="Alu" FT repeat_region 4187484..4187542 FT /rpt_family="L2" FT repeat_region 4188408..4188716 FT /rpt_family="Alu" FT repeat_region 4190532..4190678 FT /rpt_family="MIR" FT repeat_region 4191334..4191447 FT /rpt_family="MIR" FT repeat_region 4191641..4191772 FT /rpt_family="MIR" FT repeat_region 4192490..4192631 FT /rpt_family="L2" FT repeat_region 4192936..4193232 FT /rpt_family="Alu" FT repeat_region 4193342..4193612 FT /rpt_family="Alu" FT repeat_region 4194224..4194429 FT /rpt_family="MIR" FT repeat_region 4195219..4195274 FT /rpt_family="(TAAA)n" FT repeat_region 4195386..4195521 FT /rpt_family="L2" FT repeat_region 4195669..4195825 FT /rpt_family="MIR" FT repeat_region 4195931..4196089 FT /rpt_family="L1" FT repeat_region 4196876..4197138 FT /rpt_family="GA-rich" FT repeat_region 4197352..4197457 FT /rpt_family="MIR" FT repeat_region 4199329..4199389 FT /rpt_family="MER2_type" FT repeat_region 4199520..4199607 FT /rpt_family="MER2_type" FT repeat_region 4199607..4199674 FT /rpt_family="MER2_type" FT repeat_region 4201671..4201759 FT /rpt_family="ERV1" FT repeat_region 4201970..4201990 FT /rpt_family="(TGG)n" FT repeat_region 4201990..4202331 FT /rpt_family="Alu" FT repeat_region 4202369..4202484 FT /rpt_family="ERV1" FT repeat_region 4204673..4204705 FT /rpt_family="(TTTTG)n" FT repeat_region 4204739..4205013 FT /rpt_family="Alu" FT repeat_region 4205150..4205421 FT /rpt_family="Alu" FT repeat_region 4205427..4205712 FT /rpt_family="Alu" FT repeat_region 4206761..4207067 FT /rpt_family="Alu" FT repeat_region 4209853..4210095 FT /rpt_family="Alu" FT repeat_region 4211015..4211062 FT /rpt_family="MER53" FT repeat_region 4212213..4212668 FT /rpt_family="MaLR" FT repeat_region 4213697..4213757 FT /rpt_family="ERV1" FT repeat_region 4215783..4216100 FT /rpt_family="Alu" FT repeat_region 4216105..4216510 FT /rpt_family="L1" FT repeat_region 4217261..4217833 FT /rpt_family="MER1_type" FT repeat_region 4219808..4219993 FT /rpt_family="(CCCCAG)n" FT repeat_region 4220008..4220193 FT /rpt_family="(CCCCAG)n" FT repeat_region 4220215..4220576 FT /rpt_family="MaLR" FT repeat_region 4220586..4221055 FT /rpt_family="L1" FT repeat_region 4221552..4221817 FT /rpt_family="Alu" FT repeat_region 4222496..4222985 FT /rpt_family="ERV1" FT repeat_region 4222986..4223295 FT /rpt_family="Alu" FT repeat_region 4223296..4223461 FT /rpt_family="ERV1" FT repeat_region 4223922..4223991 FT /rpt_family="MIR" FT repeat_region 4224024..4224068 FT /rpt_family="MIR" FT repeat_region 4224093..4224148 FT /rpt_family="L2" FT repeat_region 4224153..4224246 FT /rpt_family="MIR" FT repeat_region 4224352..4224585 FT /rpt_family="MaLR" FT repeat_region 4225252..4225437 FT /rpt_family="L2" FT repeat_region 4225474..4225517 FT /rpt_family="GA-rich" FT repeat_region 4226941..4227086 FT /rpt_family="L1" FT repeat_region 4227270..4227489 FT /rpt_family="ERV1" FT repeat_region 4227490..4227814 FT /rpt_family="MaLR" FT repeat_region 4227815..4228075 FT /rpt_family="ERV1" FT repeat_region 4228312..4228341 FT /rpt_family="(A)n" FT repeat_region 4228657..4228765 FT /rpt_family="L1" FT repeat_region 4229200..4229331 FT /rpt_family="Alu" FT repeat_region 4229334..4229441 FT /rpt_family="Alu" FT repeat_region 4230630..4230759 FT /rpt_family="L2" FT repeat_region 4231767..4231888 FT /rpt_family="MER2_type" FT repeat_region 4231881..4231900 FT /rpt_family="MER2_type" FT repeat_region 4231901..4232206 FT /rpt_family="Alu" FT repeat_region 4232207..4232386 FT /rpt_family="MER2_type" FT repeat_region 4232433..4232584 FT /rpt_family="L1" FT repeat_region 4232587..4232639 FT /rpt_family="ERVL" FT repeat_region 4232647..4233014 FT /rpt_family="L1" FT repeat_region 4233016..4233085 FT /rpt_family="ERVL" FT repeat_region 4233086..4233783 FT /rpt_family="ERVL" FT repeat_region 4233784..4233845 FT /rpt_family="ERVL" FT repeat_region 4233847..4233909 FT /rpt_family="(TATG)n" FT repeat_region 4233910..4234093 FT /rpt_family="L1" FT repeat_region 4234102..4234510 FT /rpt_family="ERVL" FT repeat_region 4234515..4234598 FT /rpt_family="L1" FT repeat_region 4234711..4234904 FT /rpt_family="L1" FT repeat_region 4235115..4235247 FT /rpt_family="L2" FT repeat_region 4235247..4235386 FT /rpt_family="MIR" FT repeat_region 4235576..4235701 FT /rpt_family="MER1_type" FT repeat_region 4236814..4237130 FT /rpt_family="Alu" FT repeat_region 4238115..4238321 FT /rpt_family="MER1_type" FT repeat_region 4238434..4238746 FT /rpt_family="Alu" FT repeat_region 4239549..4239724 FT /rpt_family="Alu" FT repeat_region 4239986..4240460 FT /rpt_family="MaLR" FT repeat_region 4240461..4240623 FT /rpt_family="MER1_type" FT repeat_region 4241085..4241130 FT /rpt_family="AT_rich" FT repeat_region 4243134..4243176 FT /rpt_family="AT_rich" FT repeat_region 4244957..4245274 FT /rpt_family="MER1_type" FT repeat_region 4246061..4246159 FT /rpt_family="MER1_type" FT repeat_region 4248043..4248141 FT /rpt_family="L2" FT repeat_region 4250404..4250537 FT /rpt_family="L2" FT repeat_region 4251230..4251540 FT /rpt_family="Alu" FT repeat_region 4251781..4251887 FT /rpt_family="MER1_type" FT repeat_region 4251892..4252082 FT /rpt_family="Tc2" FT repeat_region 4252637..4252763 FT /rpt_family="Alu" FT repeat_region 4252764..4253067 FT /rpt_family="Alu" FT repeat_region 4253068..4253228 FT /rpt_family="Alu" FT repeat_region 4253582..4253823 FT /rpt_family="MIR" FT repeat_region 4254975..4255210 FT /rpt_family="MaLR" FT repeat_region 4255257..4255347 FT /rpt_family="MaLR" FT repeat_region 4255491..4255662 FT /rpt_family="MIR" FT repeat_region 4257413..4257440 FT /rpt_family="AT_rich" FT repeat_region 4257756..4258035 FT /rpt_family="Alu" FT repeat_region 4258424..4258570 FT /rpt_family="MER103" FT repeat_region 4258779..4258799 FT /rpt_family="AT_rich" FT repeat_region 4258941..4259294 FT /rpt_family="MaLR" FT repeat_region 4259421..4259469 FT /rpt_family="C-rich" FT repeat_region 4260398..4260701 FT /rpt_family="Alu" FT repeat_region 4260707..4260760 FT /rpt_family="MIR" FT repeat_region 4261926..4262226 FT /rpt_family="Alu" FT repeat_region 4262672..4262730 FT /rpt_family="Alu" FT repeat_region 4262832..4262950 FT /rpt_family="MER1_type" FT repeat_region 4262951..4263418 FT /rpt_family="MaLR" FT repeat_region 4263419..4263594 FT /rpt_family="MER1_type" FT repeat_region 4263803..4264233 FT /rpt_family="MaLR" FT repeat_region 4264235..4264350 FT /rpt_family="MER1_type" FT repeat_region 4264351..4264644 FT /rpt_family="Alu" FT repeat_region 4264770..4264946 FT /rpt_family="L1" FT repeat_region 4268173..4268469 FT /rpt_family="Alu" FT repeat_region 4269433..4269523 FT /rpt_family="MIR" FT repeat_region 4269601..4269671 FT /rpt_family="(TGGA)n" FT repeat_region 4269672..4269716 FT /rpt_family="(GGAA)n" FT repeat_region 4269717..4270009 FT /rpt_family="(TGGA)n" FT repeat_region 4270014..4270135 FT /rpt_family="GA-rich" FT repeat_region 4270177..4270354 FT /rpt_family="(TGGA)n" FT repeat_region 4270914..4271235 FT /rpt_family="Alu" FT repeat_region 4271675..4271695 FT /rpt_family="(T)n" FT repeat_region 4271741..4271978 FT /rpt_family="MIR" FT repeat_region 4271985..4272059 FT /rpt_family="(T)n" FT repeat_region 4272091..4272394 FT /rpt_family="Alu" FT repeat_region 4272504..4272526 FT /rpt_family="AT_rich" FT repeat_region 4272595..4272766 FT /rpt_family="L1" FT repeat_region 4274270..4274416 FT /rpt_family="MER1_type" FT repeat_region 4274802..4275095 FT /rpt_family="Alu" FT repeat_region 4276528..4276823 FT /rpt_family="Alu" FT repeat_region 4276828..4276862 FT /rpt_family="(TTTTG)n" FT repeat_region 4277722..4278011 FT /rpt_family="Alu" FT repeat_region 4278051..4278190 FT /rpt_family="Alu" FT repeat_region 4278191..4278479 FT /rpt_family="Alu" FT repeat_region 4278480..4278507 FT /rpt_family="Alu" FT repeat_region 4278827..4279091 FT /rpt_family="L1" FT repeat_region 4279165..4279299 FT /rpt_family="Alu" FT repeat_region 4280252..4280502 FT /rpt_family="L2" FT repeat_region 4280744..4280878 FT /rpt_family="L1" FT repeat_region 4280922..4280954 FT /rpt_family="AT_rich" FT repeat_region 4280985..4281116 FT /rpt_family="Alu" FT repeat_region 4283043..4283408 FT /rpt_family="MaLR" FT repeat_region 4284192..4284792 FT /rpt_family="MaLR" FT repeat_region 4287765..4287825 FT /rpt_family="(CATATA)n" FT repeat_region 4287830..4287987 FT /rpt_family="(CATA)n" FT repeat_region 4288015..4288188 FT /rpt_family="(CATA)n" FT repeat_region 4288204..4288361 FT /rpt_family="(CA)n" FT repeat_region 4288366..4288658 FT /rpt_family="(CATA)n" FT repeat_region 4288713..4288782 FT /rpt_family="GA-rich" FT repeat_region 4289485..4289826 FT /rpt_family="L1" FT repeat_region 4289982..4290276 FT /rpt_family="Alu" FT repeat_region 4290405..4290844 FT /rpt_family="L1" FT repeat_region 4290845..4291452 FT /rpt_family="ERV1" FT repeat_region 4291453..4291490 FT /rpt_family="L1" FT repeat_region 4291506..4291688 FT /rpt_family="L1" FT repeat_region 4291689..4292170 FT /rpt_family="L1" FT repeat_region 4292171..4293485 FT /rpt_family="L1" FT repeat_region 4293467..4293752 FT /rpt_family="L1" FT repeat_region 4293763..4295546 FT /rpt_family="L1" FT repeat_region 4295547..4295851 FT /rpt_family="Alu" FT repeat_region 4295852..4295956 FT /rpt_family="L1" FT repeat_region 4297194..4297280 FT /rpt_family="MIR" FT repeat_region 4297391..4297540 FT /rpt_family="MaLR" FT repeat_region 4298789..4299084 FT /rpt_family="Alu" FT repeat_region 4299104..4299425 FT /rpt_family="MER2_type" FT repeat_region 4299537..4299596 FT /rpt_family="MIR" FT repeat_region 4301177..4301300 FT /rpt_family="MER1_type" FT repeat_region 4301651..4301923 FT /rpt_family="Alu" FT repeat_region 4302379..4302569 FT /rpt_family="C-rich" FT repeat_region 4302650..4302828 FT /rpt_family="C-rich" FT misc_feature 4303080..4305062 FT /note="CpG_island (%GC=66.8, o/e=0.87, #CpGs=136)" FT repeat_region 4306807..4306964 FT /rpt_family="CT-rich" FT repeat_region 4309168..4309317 FT /rpt_family="Alu" FT repeat_region 4309468..4309599 FT /rpt_family="MER1_type" FT repeat_region 4309871..4310117 FT /rpt_family="MIR" FT repeat_region 4312103..4312408 FT /rpt_family="Alu" FT repeat_region 4313758..4313804 FT /rpt_family="(TG)n" FT repeat_region 4313893..4314148 FT /rpt_family="ERVL" FT repeat_region 4314344..4314623 FT /rpt_family="L1" FT repeat_region 4314626..4314934 FT /rpt_family="Alu" FT repeat_region 4315163..4315277 FT /rpt_family="L1" FT repeat_region 4315282..4315600 FT /rpt_family="Alu" FT repeat_region 4315741..4316042 FT /rpt_family="Alu" FT repeat_region 4316252..4316308 FT /rpt_family="MIR" FT repeat_region 4316309..4316363 FT /rpt_family="CT-rich" FT repeat_region 4316364..4316672 FT /rpt_family="Alu" FT repeat_region 4317038..4317348 FT /rpt_family="Alu" FT repeat_region 4318560..4318883 FT /rpt_family="Alu" FT repeat_region 4318897..4319207 FT /rpt_family="L1" FT repeat_region 4319218..4319679 FT /rpt_family="L1" FT repeat_region 4319680..4319981 FT /rpt_family="Alu" FT repeat_region 4319982..4320064 FT /rpt_family="L1" FT repeat_region 4320065..4320430 FT /rpt_family="MaLR" FT repeat_region 4320431..4320495 FT /rpt_family="L1" FT repeat_region 4320548..4320677 FT /rpt_family="L1" FT repeat_region 4320678..4320717 FT /rpt_family="(TA)n" FT repeat_region 4320718..4320892 FT /rpt_family="L1" FT repeat_region 4320893..4320963 FT /rpt_family="Alu" FT repeat_region 4320960..4321173 FT /rpt_family="MaLR" FT repeat_region 4321534..4321777 FT /rpt_family="ERV1" FT repeat_region 4321778..4322070 FT /rpt_family="Alu" FT repeat_region 4322071..4322361 FT /rpt_family="ERV1" FT repeat_region 4322873..4323198 FT /rpt_family="Alu" FT repeat_region 4323654..4323863 FT /rpt_family="Alu" FT repeat_region 4323866..4323941 FT /rpt_family="Alu" FT repeat_region 4323942..4324247 FT /rpt_family="Alu" FT repeat_region 4324351..4324454 FT /rpt_family="L2" FT repeat_region 4324937..4325229 FT /rpt_family="Alu" FT repeat_region 4325475..4325496 FT /rpt_family="AT_rich" FT repeat_region 4325539..4325613 FT /rpt_family="L1" FT repeat_region 4325628..4326697 FT /rpt_family="L1" FT repeat_region 4326698..4327002 FT /rpt_family="Alu" FT repeat_region 4327003..4327783 FT /rpt_family="L1" FT repeat_region 4327784..4328024 FT /rpt_family="L1" FT repeat_region 4328025..4329622 FT /rpt_family="L1" FT repeat_region 4329626..4329872 FT /rpt_family="L1" FT repeat_region 4330426..4330770 FT /rpt_family="MaLR" FT repeat_region 4331835..4331901 FT /rpt_family="L2" FT repeat_region 4332421..4332587 FT /rpt_family="L2" FT repeat_region 4332588..4332878 FT /rpt_family="Alu" FT repeat_region 4332879..4333003 FT /rpt_family="L2" FT repeat_region 4333004..4333592 FT /rpt_family="L1" FT repeat_region 4333777..4334153 FT /rpt_family="MaLR" FT repeat_region 4334195..4334334 FT /rpt_family="MER2_type" FT repeat_region 4334321..4334795 FT /rpt_family="MER2_type" FT repeat_region 4334796..4335151 FT /rpt_family="MaLR" FT repeat_region 4335152..4335215 FT /rpt_family="MER2_type" FT repeat_region 4335630..4336453 FT /rpt_family="L1" FT repeat_region 4337747..4337919 FT /rpt_family="L1" FT repeat_region 4338271..4338566 FT /rpt_family="Alu" FT repeat_region 4338581..4338878 FT /rpt_family="Alu" FT repeat_region 4338879..4338933 FT /rpt_family="Alu" FT repeat_region 4339438..4339727 FT /rpt_family="Alu" FT repeat_region 4339852..4340154 FT /rpt_family="Alu" FT repeat_region 4340289..4340388 FT /rpt_family="MER1_type" FT repeat_region 4340411..4340720 FT /rpt_family="Alu" FT repeat_region 4341093..4341118 FT /rpt_family="AT_rich" FT repeat_region 4341120..4341384 FT /rpt_family="Alu" FT repeat_region 4341658..4341958 FT /rpt_family="Alu" FT repeat_region 4342402..4342679 FT /rpt_family="Alu" FT repeat_region 4343347..4343641 FT /rpt_family="Alu" FT repeat_region 4343653..4343947 FT /rpt_family="L1" FT repeat_region 4343974..4344004 FT /rpt_family="(TTCA)n" FT repeat_region 4344017..4344325 FT /rpt_family="Alu" FT repeat_region 4344511..4344582 FT /rpt_family="ERV1" FT repeat_region 4344583..4344895 FT /rpt_family="Alu" FT repeat_region 4344896..4345145 FT /rpt_family="ERV1" FT repeat_region 4345670..4345981 FT /rpt_family="Alu" FT repeat_region 4346276..4346739 FT /rpt_family="L1" FT repeat_region 4346740..4347035 FT /rpt_family="Alu" FT repeat_region 4347036..4347052 FT /rpt_family="L1" FT misc_feature 4347708..4348017 FT /note="CpG_island (%GC=64.2, o/e=0.81, #CpGs=25)" FT repeat_region 4348114..4348445 FT /rpt_family="MaLR" FT repeat_region 4348515..4348755 FT /rpt_family="Alu" FT repeat_region 4348758..4349060 FT /rpt_family="Alu" FT repeat_region 4349474..4349980 FT /rpt_family="ERVL" FT repeat_region 4350170..4350335 FT /rpt_family="Alu" FT repeat_region 4350336..4350636 FT /rpt_family="Alu" FT repeat_region 4350637..4350773 FT /rpt_family="Alu" FT repeat_region 4351526..4351627 FT /rpt_family="ERVL" FT repeat_region 4351635..4352031 FT /rpt_family="MaLR" FT repeat_region 4352032..4352115 FT /rpt_family="L1" FT repeat_region 4352116..4352150 FT /rpt_family="MaLR" FT repeat_region 4352233..4352365 FT /rpt_family="Alu" FT repeat_region 4352554..4352585 FT /rpt_family="Alu" FT repeat_region 4354131..4354321 FT /rpt_family="Alu" FT repeat_region 4354329..4354437 FT /rpt_family="Alu" FT repeat_region 4354444..4354547 FT /rpt_family="L1" FT repeat_region 4354846..4355271 FT /rpt_family="L1" FT repeat_region 4355276..4355418 FT /rpt_family="Alu" FT repeat_region 4355419..4355787 FT /rpt_family="MaLR" FT repeat_region 4355834..4355893 FT /rpt_family="MIR" FT repeat_region 4356162..4356347 FT /rpt_family="Alu" FT repeat_region 4356377..4356652 FT /rpt_family="L1" FT repeat_region 4356911..4357463 FT /rpt_family="L1" FT repeat_region 4357479..4357515 FT /rpt_family="L2" FT repeat_region 4357516..4357829 FT /rpt_family="Alu" FT repeat_region 4360003..4361002 FT /rpt_family="L1" FT repeat_region 4361003..4361272 FT /rpt_family="Alu" FT repeat_region 4361273..4361807 FT /rpt_family="L1" FT repeat_region 4361808..4362104 FT /rpt_family="Alu" FT repeat_region 4362105..4362257 FT /rpt_family="L1" FT repeat_region 4362256..4363122 FT /rpt_family="L1" FT repeat_region 4363103..4363183 FT /rpt_family="L1" FT repeat_region 4363190..4363348 FT /rpt_family="Alu" FT repeat_region 4363349..4363651 FT /rpt_family="Alu" FT repeat_region 4363659..4363775 FT /rpt_family="L1" FT repeat_region 4363776..4364098 FT /rpt_family="Alu" FT repeat_region 4364099..4364441 FT /rpt_family="L1" FT repeat_region 4364442..4364741 FT /rpt_family="Alu" FT repeat_region 4364742..4365041 FT /rpt_family="Alu" FT repeat_region 4365042..4365128 FT /rpt_family="L1" FT repeat_region 4365129..4365437 FT /rpt_family="Alu" FT repeat_region 4365438..4366103 FT /rpt_family="L1" FT repeat_region 4366104..4366430 FT /rpt_family="L1" FT repeat_region 4366437..4366570 FT /rpt_family="MaLR" FT repeat_region 4366778..4367558 FT /rpt_family="L1" FT repeat_region 4368012..4368310 FT /rpt_family="Alu" FT repeat_region 4368488..4368577 FT /rpt_family="MaLR" FT repeat_region 4368578..4368869 FT /rpt_family="Alu" FT repeat_region 4368880..4368923 FT /rpt_family="Alu" FT repeat_region 4368943..4369162 FT /rpt_family="MaLR" FT repeat_region 4369164..4369207 FT /rpt_family="(TTTA)n" FT repeat_region 4369224..4369278 FT /rpt_family="MaLR" FT repeat_region 4369280..4369307 FT /rpt_family="(TTTA)n" FT repeat_region 4369324..4369417 FT /rpt_family="MaLR" FT repeat_region 4369412..4369461 FT /rpt_family="MaLR" FT repeat_region 4369462..4369650 FT /rpt_family="Alu" FT repeat_region 4369651..4369670 FT /rpt_family="(TTTA)n" FT repeat_region 4369671..4369786 FT /rpt_family="Alu" FT repeat_region 4369787..4369855 FT /rpt_family="MaLR" FT repeat_region 4370328..4370561 FT /rpt_family="ERV1" FT repeat_region 4370845..4370977 FT /rpt_family="Alu" FT repeat_region 4370981..4371274 FT /rpt_family="Alu" FT repeat_region 4371827..4372278 FT /rpt_family="L1" FT repeat_region 4372279..4372427 FT /rpt_family="L1" FT repeat_region 4372879..4373172 FT /rpt_family="Alu" FT repeat_region 4373428..4373972 FT /rpt_family="ERV1" FT repeat_region 4374096..4374390 FT /rpt_family="Alu" FT repeat_region 4374399..4374424 FT /rpt_family="(TTTA)n" FT repeat_region 4374428..4374718 FT /rpt_family="Alu" FT repeat_region 4374831..4375069 FT /rpt_family="MER2_type" FT repeat_region 4375070..4375395 FT /rpt_family="ERV1" FT repeat_region 4375396..4375424 FT /rpt_family="(CAAAA)n" FT repeat_region 4375425..4375687 FT /rpt_family="ERV1" FT repeat_region 4375688..4375911 FT /rpt_family="MER2_type" FT repeat_region 4375912..4376554 FT /rpt_family="ERV1" FT repeat_region 4376555..4376624 FT /rpt_family="MER2_type" FT repeat_region 4376961..4377342 FT /rpt_family="MaLR" FT repeat_region 4377910..4378064 FT /rpt_family="MaLR" FT repeat_region 4378065..4378501 FT /rpt_family="ERVK" FT repeat_region 4378502..4378591 FT /rpt_family="MaLR" FT repeat_region 4378622..4378935 FT /rpt_family="MaLR" FT repeat_region 4378948..4378976 FT /rpt_family="MaLR" FT repeat_region 4378977..4379315 FT /rpt_family="MaLR" FT repeat_region 4379316..4379423 FT /rpt_family="MaLR" FT repeat_region 4379425..4379838 FT /rpt_family="L2" FT repeat_region 4379847..4379932 FT /rpt_family="L1" FT repeat_region 4380344..4380516 FT /rpt_family="MaLR" FT repeat_region 4380517..4380816 FT /rpt_family="Alu" FT repeat_region 4380817..4380836 FT /rpt_family="(T)n" FT repeat_region 4380846..4380896 FT /rpt_family="ERVL" FT repeat_region 4380902..4380928 FT /rpt_family="(TTTTTG)n" FT repeat_region 4380943..4381457 FT /rpt_family="ERVL" FT repeat_region 4381458..4381567 FT /rpt_family="Alu" FT repeat_region 4381572..4381656 FT /rpt_family="MaLR" FT repeat_region 4381790..4382053 FT /rpt_family="Alu" FT repeat_region 4382633..4382736 FT /rpt_family="(TTCC)n" FT repeat_region 4382737..4382838 FT /rpt_family="L1" FT repeat_region 4382857..4383162 FT /rpt_family="MaLR" FT repeat_region 4383204..4383317 FT /rpt_family="MIR" FT repeat_region 4384710..4384743 FT /rpt_family="(T)n" FT repeat_region 4384754..4385145 FT /rpt_family="MaLR" FT repeat_region 4385252..4385351 FT /rpt_family="ERV1" FT repeat_region 4385840..4386136 FT /rpt_family="Alu" FT repeat_region 4386553..4386887 FT /rpt_family="L1" FT repeat_region 4387230..4387533 FT /rpt_family="Alu" FT repeat_region 4387644..4387909 FT /rpt_family="L1" FT repeat_region 4387926..4388095 FT /rpt_family="Alu" FT repeat_region 4388394..4388425 FT /rpt_family="(TTTTG)n" FT repeat_region 4388428..4388676 FT /rpt_family="Alu" FT repeat_region 4388744..4388835 FT /rpt_family="L1" FT repeat_region 4388884..4389235 FT /rpt_family="L1" FT repeat_region 4389236..4389535 FT /rpt_family="Alu" FT repeat_region 4389639..4389917 FT /rpt_family="Alu" FT repeat_region 4390092..4390115 FT /rpt_family="AT_rich" FT repeat_region 4390219..4390524 FT /rpt_family="Alu" FT repeat_region 4390945..4391255 FT /rpt_family="Alu" FT repeat_region 4391407..4391506 FT /rpt_family="L1" FT repeat_region 4391660..4393281 FT /rpt_family="L1" FT repeat_region 4393271..4393470 FT /rpt_family="L1" FT repeat_region 4393471..4393767 FT /rpt_family="Alu" FT repeat_region 4393768..4394194 FT /rpt_family="L1" FT repeat_region 4394252..4394668 FT /rpt_family="L2" FT repeat_region 4394786..4394971 FT /rpt_family="L2" FT repeat_region 4394972..4395320 FT /rpt_family="MaLR" FT repeat_region 4395321..4395628 FT /rpt_family="Alu" FT repeat_region 4395629..4395697 FT /rpt_family="MaLR" FT repeat_region 4395698..4395748 FT /rpt_family="L2" FT repeat_region 4395759..4396106 FT /rpt_family="L1" FT repeat_region 4396113..4396496 FT /rpt_family="MaLR" FT repeat_region 4396497..4396902 FT /rpt_family="L1" FT repeat_region 4396907..4396947 FT /rpt_family="L2" FT repeat_region 4396948..4397251 FT /rpt_family="Alu" FT repeat_region 4397252..4397365 FT /rpt_family="L2" FT repeat_region 4397769..4398204 FT /rpt_family="ERVL" FT repeat_region 4398339..4398490 FT /rpt_family="Alu" FT repeat_region 4398506..4398536 FT /rpt_family="AT_rich" FT repeat_region 4399281..4399528 FT /rpt_family="L1" FT repeat_region 4399903..4400014 FT /rpt_family="ERV1" FT repeat_region 4400026..4400161 FT /rpt_family="ERV1" FT repeat_region 4400169..4400498 FT /rpt_family="ERV1" FT repeat_region 4400526..4401034 FT /rpt_family="MER1_type" FT repeat_region 4401059..4401242 FT /rpt_family="MaLR" FT repeat_region 4401243..4401509 FT /rpt_family="Alu" FT repeat_region 4401510..4401755 FT /rpt_family="MaLR" FT repeat_region 4401764..4402119 FT /rpt_family="L2" FT repeat_region 4402120..4402386 FT /rpt_family="Alu" FT repeat_region 4402387..4402996 FT /rpt_family="L2" FT repeat_region 4403325..4403469 FT /rpt_family="MaLR" FT repeat_region 4404058..4404207 FT /rpt_family="MaLR" FT repeat_region 4404272..4404455 FT /rpt_family="L1" FT repeat_region 4404459..4404810 FT /rpt_family="ERV1" FT repeat_region 4404819..4405134 FT /rpt_family="Alu" FT repeat_region 4405475..4405783 FT /rpt_family="Alu" FT repeat_region 4406353..4406650 FT /rpt_family="Alu" FT repeat_region 4406681..4406813 FT /rpt_family="Alu" FT repeat_region 4407245..4407536 FT /rpt_family="MaLR" FT repeat_region 4408533..4408753 FT /rpt_family="MER1_type" FT repeat_region 4408768..4409066 FT /rpt_family="Alu" FT repeat_region 4409112..4409400 FT /rpt_family="Alu" FT repeat_region 4409965..4410118 FT /rpt_family="ERVL" FT repeat_region 4410547..4410933 FT /rpt_family="ERVL" FT repeat_region 4411342..4411426 FT /rpt_family="L1" FT repeat_region 4411427..4411466 FT /rpt_family="L1" FT repeat_region 4411570..4411650 FT /rpt_family="CR1" FT repeat_region 4412788..4412860 FT /rpt_family="MaLR" FT repeat_region 4412944..4413073 FT /rpt_family="Alu" FT repeat_region 4413114..4413301 FT /rpt_family="MaLR" FT repeat_region 4413302..4413675 FT /rpt_family="MER2_type" FT repeat_region 4413676..4413960 FT /rpt_family="Alu" FT repeat_region 4413961..4414112 FT /rpt_family="MER2_type" FT repeat_region 4414660..4415047 FT /rpt_family="ERVL" FT repeat_region 4415089..4415261 FT /rpt_family="ERV1" FT repeat_region 4415262..4415558 FT /rpt_family="Alu" FT repeat_region 4415559..4415641 FT /rpt_family="ERV1" FT repeat_region 4415642..4416007 FT /rpt_family="MaLR" FT repeat_region 4416008..4416339 FT /rpt_family="ERV1" FT repeat_region 4416448..4416685 FT /rpt_family="MaLR" FT repeat_region 4416696..4416862 FT /rpt_family="Alu" FT repeat_region 4416870..4417103 FT /rpt_family="MaLR" FT repeat_region 4417862..4418336 FT /rpt_family="MaLR" FT repeat_region 4419048..4419162 FT /rpt_family="MIR" FT repeat_region 4421155..4421214 FT /rpt_family="(TAGA)n" FT repeat_region 4421319..4421480 FT /rpt_family="ERV1" FT repeat_region 4421483..4421637 FT /rpt_family="MaLR" FT repeat_region 4421808..4422111 FT /rpt_family="Alu" FT repeat_region 4422170..4422197 FT /rpt_family="(TTTTC)n" FT repeat_region 4423649..4423719 FT /rpt_family="(TATG)n" FT repeat_region 4423724..4424006 FT /rpt_family="Alu" FT repeat_region 4424121..4424202 FT /rpt_family="L1" FT repeat_region 4424516..4424607 FT /rpt_family="L1" FT repeat_region 4424608..4424899 FT /rpt_family="Alu" FT repeat_region 4424900..4425088 FT /rpt_family="L1" FT repeat_region 4425213..4425314 FT /rpt_family="L2" FT repeat_region 4425315..4425504 FT /rpt_family="MaLR" FT repeat_region 4425505..4425808 FT /rpt_family="Alu" FT repeat_region 4425809..4425970 FT /rpt_family="MaLR" FT repeat_region 4425998..4426153 FT /rpt_family="L2" FT repeat_region 4426329..4426438 FT /rpt_family="L1" FT repeat_region 4426445..4426747 FT /rpt_family="Alu" FT repeat_region 4426810..4426988 FT /rpt_family="L1" FT repeat_region 4426989..4427279 FT /rpt_family="Alu" FT repeat_region 4427280..4427330 FT /rpt_family="L1" FT repeat_region 4427332..4427406 FT /rpt_family="ERV1" FT repeat_region 4427407..4427688 FT /rpt_family="Alu" FT repeat_region 4427689..4428077 FT /rpt_family="ERV1" FT repeat_region 4428103..4428782 FT /rpt_family="L1" FT repeat_region 4428783..4429076 FT /rpt_family="Alu" FT repeat_region 4429077..4429222 FT /rpt_family="L1" FT repeat_region 4429234..4430031 FT /rpt_family="SVA" FT repeat_region 4430053..4430203 FT /rpt_family="L1" FT repeat_region 4430205..4430505 FT /rpt_family="ERV1" FT repeat_region 4430531..4431008 FT /rpt_family="Alu" FT repeat_region 4431009..4431068 FT /rpt_family="(GGAA)n" FT repeat_region 4431072..4431200 FT /rpt_family="L1" FT repeat_region 4431361..4431673 FT /rpt_family="Alu" FT repeat_region 4431812..4432024 FT /rpt_family="L1" FT repeat_region 4432025..4432329 FT /rpt_family="Alu" FT repeat_region 4432330..4432349 FT /rpt_family="L1" FT repeat_region 4432350..4432888 FT /rpt_family="L1" FT repeat_region 4432889..4433005 FT /rpt_family="L1" FT repeat_region 4433341..4433641 FT /rpt_family="Alu" FT repeat_region 4433831..4433977 FT /rpt_family="(TCTA)n" FT repeat_region 4433994..4434173 FT /rpt_family="(TCTA)n" FT repeat_region 4434222..4434388 FT /rpt_family="(TCTA)n" FT repeat_region 4434395..4434890 FT /rpt_family="AcHobo" FT repeat_region 4434891..4435248 FT /rpt_family="MaLR" FT repeat_region 4435249..4436384 FT /rpt_family="AcHobo" FT repeat_region 4436385..4436677 FT /rpt_family="Alu" FT repeat_region 4436678..4437942 FT /rpt_family="AcHobo" FT repeat_region 4438531..4438828 FT /rpt_family="Alu" FT repeat_region 4439229..4439504 FT /rpt_family="ERVL" FT repeat_region 4439617..4440040 FT /rpt_family="L1" FT repeat_region 4440104..4440139 FT /rpt_family="(TG)n" FT repeat_region 4440752..4440852 FT /rpt_family="ERVL" FT repeat_region 4440858..4440967 FT /rpt_family="ERV1" FT repeat_region 4441016..4441078 FT /rpt_family="ERV1" FT repeat_region 4441170..4441206 FT /rpt_family="(TTTTG)n" FT repeat_region 4441288..4441664 FT /rpt_family="MaLR" FT repeat_region 4441670..4442148 FT /rpt_family="ERVL" FT repeat_region 4442221..4442765 FT /rpt_family="ERVL" FT repeat_region 4442802..4442971 FT /rpt_family="MaLR" FT repeat_region 4442974..4443073 FT /rpt_family="(GA)n" FT repeat_region 4443074..4443259 FT /rpt_family="MaLR" FT repeat_region 4443442..4443524 FT /rpt_family="Mariner" FT repeat_region 4443779..4443998 FT /rpt_family="L1" FT repeat_region 4444211..4444305 FT /rpt_family="L2" FT repeat_region 4444356..4444407 FT /rpt_family="GA-rich" FT repeat_region 4444408..4444570 FT /rpt_family="MaLR" FT repeat_region 4444571..4444930 FT /rpt_family="MaLR" FT repeat_region 4444931..4445197 FT /rpt_family="MaLR" FT repeat_region 4445210..4445734 FT /rpt_family="GA-rich" FT repeat_region 4446379..4446561 FT /rpt_family="MER1_type" FT repeat_region 4446748..4446913 FT /rpt_family="(TTATA)n" FT repeat_region 4446909..4446998 FT /rpt_family="(TATATG)n" FT repeat_region 4446937..4447063 FT /rpt_family="(TA)n" FT repeat_region 4447423..4447940 FT /rpt_family="L1" FT misc_feature 4447532..4447599 FT /note="unresolved homopolymeric repeat" FT unsure 4447532..4447599 FT /note="unresolved simple sequence repeat" FT repeat_region 4447961..4448237 FT /rpt_family="Alu" FT repeat_region 4448247..4448440 FT /rpt_family="L1" FT repeat_region 4448441..4448736 FT /rpt_family="Alu" FT repeat_region 4448737..4448807 FT /rpt_family="L1" FT repeat_region 4449252..4449292 FT /rpt_family="MaLR" FT repeat_region 4449293..4449601 FT /rpt_family="Alu" FT repeat_region 4449602..4449622 FT /rpt_family="MaLR" FT repeat_region 4449649..4450038 FT /rpt_family="MaLR" FT repeat_region 4450236..4450292 FT /rpt_family="MaLR" FT repeat_region 4450293..4450589 FT /rpt_family="Alu" FT repeat_region 4450590..4450755 FT /rpt_family="MaLR" FT repeat_region 4450750..4450919 FT /rpt_family="MER1_type" FT repeat_region 4450943..4451119 FT /rpt_family="MaLR" FT repeat_region 4451120..4451420 FT /rpt_family="Alu" FT repeat_region 4451421..4451589 FT /rpt_family="MaLR" FT repeat_region 4451621..4451933 FT /rpt_family="Alu" FT repeat_region 4451943..4452478 FT /rpt_family="MaLR" FT repeat_region 4452475..4452905 FT /rpt_family="ERV1" FT repeat_region 4453104..4453389 FT /rpt_family="Alu" FT repeat_region 4453544..4453838 FT /rpt_family="Alu" FT repeat_region 4454071..4454372 FT /rpt_family="Alu" FT repeat_region 4454379..4454489 FT /rpt_family="ERV1" FT repeat_region 4454490..4454808 FT /rpt_family="Alu" FT repeat_region 4454809..4455126 FT /rpt_family="ERV1" FT repeat_region 4455169..4455280 FT /rpt_family="L2" FT repeat_region 4455293..4455594 FT /rpt_family="Alu" FT repeat_region 4456213..4456327 FT /rpt_family="CR1" FT repeat_region 4456428..4456917 FT /rpt_family="L2" FT repeat_region 4457363..4457404 FT /rpt_family="(TG)n" FT repeat_region 4457407..4457511 FT /rpt_family="MIR" FT repeat_region 4457630..4457695 FT /rpt_family="ERVL" FT repeat_region 4457791..4458294 FT /rpt_family="ERVL" FT repeat_region 4459133..4459272 FT /rpt_family="L1" FT repeat_region 4459273..4459584 FT /rpt_family="Alu" FT repeat_region 4459585..4459953 FT /rpt_family="L1" FT repeat_region 4459954..4460252 FT /rpt_family="Alu" FT repeat_region 4460253..4460361 FT /rpt_family="L1" FT repeat_region 4460362..4460766 FT /rpt_family="MaLR" FT repeat_region 4460767..4461587 FT /rpt_family="L1" FT repeat_region 4461611..4462599 FT /rpt_family="L1" FT repeat_region 4462643..4462938 FT /rpt_family="Alu" FT repeat_region 4463074..4463382 FT /rpt_family="ERV1" FT repeat_region 4463529..4463681 FT /rpt_family="L1" FT repeat_region 4463684..4463764 FT /rpt_family="ERV1" FT repeat_region 4463765..4464067 FT /rpt_family="Alu" FT repeat_region 4464068..4464248 FT /rpt_family="ERV1" FT repeat_region 4464249..4464556 FT /rpt_family="Alu" FT repeat_region 4464557..4464727 FT /rpt_family="ERV1" FT repeat_region 4464733..4464845 FT /rpt_family="Alu" FT repeat_region 4464857..4464887 FT /rpt_family="ERV1" FT repeat_region 4464890..4465381 FT /rpt_family="L1" FT repeat_region 4465382..4465675 FT /rpt_family="Alu" FT repeat_region 4465676..4465759 FT /rpt_family="L1" FT repeat_region 4465835..4466085 FT /rpt_family="Alu" FT repeat_region 4466086..4466139 FT /rpt_family="L1" FT repeat_region 4466129..4466231 FT /rpt_family="L1" FT repeat_region 4466399..4466692 FT /rpt_family="Alu" FT repeat_region 4466794..4467081 FT /rpt_family="ERVL" FT repeat_region 4467428..4467738 FT /rpt_family="Alu" FT repeat_region 4469314..4470597 FT /rpt_family="L1" FT repeat_region 4470598..4470949 FT /rpt_family="MaLR" FT repeat_region 4470950..4471307 FT /rpt_family="L1" FT repeat_region 4471318..4472025 FT /rpt_family="MER2_type" FT repeat_region 4472026..4472053 FT /rpt_family="L1" FT repeat_region 4472055..4472353 FT /rpt_family="Alu" FT repeat_region 4472370..4472489 FT /rpt_family="Alu" FT repeat_region 4472490..4472597 FT /rpt_family="L1" FT repeat_region 4472809..4473121 FT /rpt_family="Alu" FT repeat_region 4473132..4473267 FT /rpt_family="Alu" FT repeat_region 4474893..4475099 FT /rpt_family="ERVL" FT repeat_region 4475100..4475695 FT /rpt_family="ERV1" FT repeat_region 4475696..4475826 FT /rpt_family="ERVL" FT repeat_region 4478376..4478545 FT /rpt_family="(TAGA)n" FT repeat_region 4478561..4478845 FT /rpt_family="(TAGA)n" FT repeat_region 4478868..4478999 FT /rpt_family="MER1_type" FT repeat_region 4479316..4479926 FT /rpt_family="MER1_type" FT repeat_region 4482237..4482360 FT /rpt_family="MER1_type" FT repeat_region 4482410..4482708 FT /rpt_family="L1" FT repeat_region 4482709..4482986 FT /rpt_family="L1" FT repeat_region 4482987..4483057 FT /rpt_family="L1" FT repeat_region 4483062..4483229 FT /rpt_family="(TTACG)n" FT repeat_region 4483264..4483366 FT /rpt_family="(CATA)n" FT repeat_region 4483385..4483501 FT /rpt_family="L1" FT repeat_region 4483512..4483968 FT /rpt_family="L2" FT repeat_region 4483969..4484600 FT /rpt_family="ERV1" FT repeat_region 4484601..4485419 FT /rpt_family="L2" FT repeat_region 4485441..4485509 FT /rpt_family="ERV1" FT repeat_region 4485511..4485584 FT /rpt_family="(CA)n" FT repeat_region 4485592..4485643 FT /rpt_family="ERV1" FT repeat_region 4485646..4485776 FT /rpt_family="(CATA)n" FT repeat_region 4486116..4486332 FT /rpt_family="MER1_type" FT repeat_region 4486333..4486597 FT /rpt_family="Alu" FT repeat_region 4486598..4486658 FT /rpt_family="MER1_type" FT repeat_region 4486661..4486746 FT /rpt_family="MIR" FT repeat_region 4487489..4487913 FT /rpt_family="L2" FT repeat_region 4488062..4488382 FT /rpt_family="Alu" FT repeat_region 4488529..4488734 FT /rpt_family="L1" FT repeat_region 4488751..4489096 FT /rpt_family="ERVL" FT repeat_region 4489097..4489391 FT /rpt_family="Alu" FT repeat_region 4489392..4489502 FT /rpt_family="ERVL" FT repeat_region 4489536..4489616 FT /rpt_family="ERVL" FT repeat_region 4489672..4489804 FT /rpt_family="L1" FT repeat_region 4489805..4490103 FT /rpt_family="Alu" FT repeat_region 4490104..4490481 FT /rpt_family="L1" FT repeat_region 4490517..4490820 FT /rpt_family="Alu" FT repeat_region 4491127..4491425 FT /rpt_family="Alu" FT repeat_region 4491309..4491425 FT /rpt_family="Alu" FT repeat_region 4491444..4491741 FT /rpt_family="Alu" FT repeat_region 4492687..4492873 FT /rpt_family="(TAGA)n" FT repeat_region 4492926..4492968 FT /rpt_family="GA-rich" FT repeat_region 4492993..4493036 FT /rpt_family="(TAGA)n" FT repeat_region 4493066..4493141 FT /rpt_family="(TAGA)n" FT repeat_region 4493193..4493283 FT /rpt_family="(TAGA)n" FT repeat_region 4493284..4493351 FT /rpt_family="L1" FT repeat_region 4493678..4493976 FT /rpt_family="Alu" FT repeat_region 4494409..4494711 FT /rpt_family="Alu" FT repeat_region 4494834..4494895 FT /rpt_family="ERVL" FT repeat_region 4495439..4495753 FT /rpt_family="MER2_type" FT repeat_region 4495969..4496269 FT /rpt_family="Alu" FT repeat_region 4496271..4496472 FT /rpt_family="MER1_type" FT repeat_region 4496508..4496620 FT /rpt_family="L2" FT repeat_region 4496622..4496858 FT /rpt_family="Alu" FT repeat_region 4496859..4497158 FT /rpt_family="Alu" FT repeat_region 4497159..4497253 FT /rpt_family="Alu" FT repeat_region 4497257..4497414 FT /rpt_family="Alu" FT repeat_region 4497760..4497838 FT /rpt_family="ERVL" FT repeat_region 4498013..4498150 FT /rpt_family="MaLR" FT repeat_region 4498207..4498256 FT /rpt_family="(CA)n" FT repeat_region 4498271..4498445 FT /rpt_family="L1" FT repeat_region 4498462..4498756 FT /rpt_family="Alu" FT repeat_region 4498776..4498827 FT /rpt_family="(GGAA)n" FT repeat_region 4499202..4499281 FT /rpt_family="AT_rich" FT repeat_region 4499333..4499371 FT /rpt_family="L1" FT repeat_region 4499372..4499673 FT /rpt_family="Alu" FT repeat_region 4499674..4499962 FT /rpt_family="L1" FT repeat_region 4499979..4500094 FT /rpt_family="L1" FT repeat_region 4500095..4500368 FT /rpt_family="Alu" FT repeat_region 4500369..4500459 FT /rpt_family="L1" FT repeat_region 4500608..4500913 FT /rpt_family="L1" FT repeat_region 4501950..4502251 FT /rpt_family="Alu" FT repeat_region 4502368..4502677 FT /rpt_family="Alu" FT repeat_region 4502755..4503045 FT /rpt_family="L1" FT repeat_region 4503062..4503252 FT /rpt_family="L1" FT repeat_region 4503856..4503886 FT /rpt_family="MaLR" FT repeat_region 4504588..4504892 FT /rpt_family="Alu" FT repeat_region 4505844..4506198 FT /rpt_family="Alu" FT repeat_region 4506220..4506366 FT /rpt_family="MER1_type" FT repeat_region 4506381..4506466 FT /rpt_family="ERVL" FT repeat_region 4506581..4506620 FT /rpt_family="MaLR" FT repeat_region 4506621..4506891 FT /rpt_family="Alu" FT repeat_region 4506892..4507034 FT /rpt_family="MaLR" FT repeat_region 4507180..4507303 FT /rpt_family="L1" FT repeat_region 4507376..4507675 FT /rpt_family="Alu" FT repeat_region 4507803..4507955 FT /rpt_family="MER1_type" FT repeat_region 4508103..4508461 FT /rpt_family="MaLR" FT repeat_region 4508465..4508502 FT /rpt_family="(TATAA)n" FT repeat_region 4508553..4508835 FT /rpt_family="Alu" FT repeat_region 4509832..4510138 FT /rpt_family="L2" FT repeat_region 4510152..4510443 FT /rpt_family="Alu" FT repeat_region 4510484..4510790 FT /rpt_family="Alu" FT repeat_region 4510795..4511061 FT /rpt_family="L1" FT repeat_region 4511119..4511436 FT /rpt_family="Alu" FT repeat_region 4511486..4511781 FT /rpt_family="Alu" FT repeat_region 4511875..4512158 FT /rpt_family="Alu" FT repeat_region 4512636..4513049 FT /rpt_family="ERVL" FT repeat_region 4513174..4513395 FT /rpt_family="GA-rich" FT repeat_region 4513403..4513544 FT /rpt_family="Alu" FT repeat_region 4513791..4514086 FT /rpt_family="Alu" FT repeat_region 4514180..4514243 FT /rpt_family="CT-rich" FT repeat_region 4514244..4514429 FT /rpt_family="Alu" FT repeat_region 4514430..4514450 FT /rpt_family="(TTTG)n" FT repeat_region 4514451..4514567 FT /rpt_family="Alu" FT repeat_region 4514568..4514635 FT /rpt_family="CT-rich" FT repeat_region 4514802..4515035 FT /rpt_family="L1" FT repeat_region 4515298..4515343 FT /rpt_family="(TAAA)n" FT repeat_region 4515353..4515658 FT /rpt_family="Alu" FT repeat_region 4516013..4516205 FT /rpt_family="L1" FT repeat_region 4516210..4516516 FT /rpt_family="Alu" FT repeat_region 4516524..4516669 FT /rpt_family="GA-rich" FT repeat_region 4516671..4516698 FT /rpt_family="L1" FT repeat_region 4516699..4517006 FT /rpt_family="Alu" FT repeat_region 4517007..4517143 FT /rpt_family="L1" FT repeat_region 4517144..4517456 FT /rpt_family="Alu" FT repeat_region 4517629..4517804 FT /rpt_family="Alu" FT repeat_region 4517837..4518217 FT /rpt_family="MaLR" FT repeat_region 4518259..4518545 FT /rpt_family="Alu" FT repeat_region 4518561..4518741 FT /rpt_family="L1" FT repeat_region 4518748..4518829 FT /rpt_family="(TA)n" FT repeat_region 4518854..4519031 FT /rpt_family="Alu" FT repeat_region 4519032..4519271 FT /rpt_family="ERV" FT repeat_region 4519294..4519387 FT /rpt_family="MIR" FT repeat_region 4519444..4519662 FT /rpt_family="MER1_type" FT repeat_region 4519945..4520258 FT /rpt_family="Alu" FT repeat_region 4520260..4520569 FT /rpt_family="L1" FT repeat_region 4520570..4520694 FT /rpt_family="ERV" FT repeat_region 4520698..4520738 FT /rpt_family="L1" FT repeat_region 4520754..4521074 FT /rpt_family="MaLR" FT repeat_region 4521075..4521554 FT /rpt_family="L1" FT repeat_region 4521555..4521578 FT /rpt_family="MaLR" FT repeat_region 4521579..4521883 FT /rpt_family="Alu" FT repeat_region 4521884..4521932 FT /rpt_family="MaLR" FT repeat_region 4521933..4521997 FT /rpt_family="L1" FT repeat_region 4522438..4522554 FT /rpt_family="Alu" FT repeat_region 4522555..4522866 FT /rpt_family="Alu" FT repeat_region 4522907..4522927 FT /rpt_family="(TAAA)n" FT repeat_region 4523154..4523431 FT /rpt_family="MaLR" FT repeat_region 4523523..4523601 FT /rpt_family="GA-rich" FT repeat_region 4523602..4523811 FT /rpt_family="ERV1" FT repeat_region 4523799..4523923 FT /rpt_family="ERV1" FT repeat_region 4523935..4523994 FT /rpt_family="GA-rich" FT repeat_region 4524009..4524179 FT /rpt_family="GA-rich" FT repeat_region 4524210..4524526 FT /rpt_family="GA-rich" FT repeat_region 4524547..4524673 FT /rpt_family="GA-rich" FT repeat_region 4525159..4525237 FT /rpt_family="CR1" FT repeat_region 4525292..4525597 FT /rpt_family="Alu" FT repeat_region 4525620..4525954 FT /rpt_family="Alu" FT repeat_region 4526321..4526496 FT /rpt_family="MER1_type" FT repeat_region 4526686..4526774 FT /rpt_family="MIR" FT repeat_region 4526942..4526977 FT /rpt_family="(TC)n" FT repeat_region 4526978..4527137 FT /rpt_family="Alu" FT repeat_region 4527138..4527441 FT /rpt_family="Alu" FT repeat_region 4527442..4527577 FT /rpt_family="Alu" FT repeat_region 4527949..4528076 FT /rpt_family="L1" FT repeat_region 4528077..4528399 FT /rpt_family="Alu" FT repeat_region 4528400..4528933 FT /rpt_family="L1" FT repeat_region 4528934..4529399 FT /rpt_family="L1" FT repeat_region 4529400..4529703 FT /rpt_family="Alu" FT repeat_region 4529704..4529756 FT /rpt_family="L1" FT repeat_region 4529764..4530050 FT /rpt_family="Alu" FT repeat_region 4530555..4530862 FT /rpt_family="Alu" FT repeat_region 4531168..4531462 FT /rpt_family="Alu" FT repeat_region 4531685..4532103 FT /rpt_family="L1" FT repeat_region 4532104..4532372 FT /rpt_family="Alu" FT repeat_region 4532373..4532509 FT /rpt_family="L1" FT repeat_region 4532510..4532813 FT /rpt_family="Alu" FT repeat_region 4532814..4533305 FT /rpt_family="L1" FT repeat_region 4533306..4533474 FT /rpt_family="MaLR" FT repeat_region 4533475..4533778 FT /rpt_family="Alu" FT repeat_region 4533779..4533999 FT /rpt_family="MaLR" FT repeat_region 4534000..4534175 FT /rpt_family="L1" FT misc_feature 4534174..4534444 FT /note="CpG_island (%GC=61.6, o/e=0.78, #CpGs=21)" FT repeat_region 4534176..4534480 FT /rpt_family="Alu" FT repeat_region 4534481..4534627 FT /rpt_family="L1" FT repeat_region 4534653..4534925 FT /rpt_family="L1" FT repeat_region 4534962..4535209 FT /rpt_family="Alu" FT repeat_region 4535486..4535575 FT /rpt_family="MER1_type" FT misc_feature 4536583..4536934 FT /note="CpG_island (%GC=71.6, o/e=0.58, #CpGs=28)" FT repeat_region 4537122..4537232 FT /rpt_family="MER1_type" FT repeat_region 4537234..4537623 FT /rpt_family="L1" FT repeat_region 4538022..4538331 FT /rpt_family="Alu" FT repeat_region 4538464..4538640 FT /rpt_family="L2" FT repeat_region 4538641..4538937 FT /rpt_family="Alu" FT repeat_region 4538938..4539007 FT /rpt_family="L2" FT repeat_region 4539069..4539370 FT /rpt_family="Alu" FT repeat_region 4539656..4540193 FT /rpt_family="ERV1" FT repeat_region 4540694..4540995 FT /rpt_family="Alu" FT repeat_region 4541016..4541496 FT /rpt_family="L1" FT repeat_region 4541499..4541534 FT /rpt_family="MaLR" FT repeat_region 4541538..4541586 FT /rpt_family="Alu" FT repeat_region 4541587..4541916 FT /rpt_family="MaLR" FT repeat_region 4541945..4542127 FT /rpt_family="L1" FT repeat_region 4542128..4542156 FT /rpt_family="(CAAAA)n" FT repeat_region 4542157..4542199 FT /rpt_family="L1" FT repeat_region 4542230..4542534 FT /rpt_family="Alu" FT repeat_region 4542584..4542899 FT /rpt_family="Alu" FT repeat_region 4542900..4542969 FT /rpt_family="L1" FT repeat_region 4542970..4543015 FT /rpt_family="(CA)n" FT repeat_region 4543016..4543223 FT /rpt_family="L1" FT repeat_region 4543611..4543638 FT /rpt_family="L1" FT repeat_region 4543639..4543879 FT /rpt_family="Alu" FT repeat_region 4543880..4543990 FT /rpt_family="L1" FT repeat_region 4544731..4544893 FT /rpt_family="Alu" FT repeat_region 4544963..4545256 FT /rpt_family="Alu" FT repeat_region 4545555..4545689 FT /rpt_family="MER1_type" FT repeat_region 4545709..4546015 FT /rpt_family="Alu" FT repeat_region 4546121..4546232 FT /rpt_family="L1" FT repeat_region 4546262..4546565 FT /rpt_family="Alu" FT repeat_region 4547394..4548050 FT /rpt_family="L1" FT repeat_region 4548899..4548976 FT /rpt_family="L1" FT repeat_region 4548979..4549288 FT /rpt_family="Alu" FT repeat_region 4549289..4549443 FT /rpt_family="Alu" FT repeat_region 4549444..4549842 FT /rpt_family="L1" FT repeat_region 4549888..4550196 FT /rpt_family="Alu" FT repeat_region 4550353..4550469 FT /rpt_family="Alu" FT repeat_region 4550795..4550815 FT /rpt_family="AT_rich" FT repeat_region 4552064..4552240 FT /rpt_family="ERVL" FT repeat_region 4552241..4552554 FT /rpt_family="Alu" FT repeat_region 4552555..4552713 FT /rpt_family="ERVL" FT repeat_region 4552714..4552737 FT /rpt_family="(TC)n" FT repeat_region 4552738..4552795 FT /rpt_family="ERVL" FT repeat_region 4553613..4553910 FT /rpt_family="Alu" FT repeat_region 4554293..4554660 FT /rpt_family="MaLR" FT repeat_region 4555086..4555131 FT /rpt_family="CR1" FT repeat_region 4555346..4557721 FT /rpt_family="L1" FT repeat_region 4557722..4558002 FT /rpt_family="Alu" FT misc_feature 4557774..4557980 FT /note="CpG_island (%GC=59.9, o/e=0.88, #CpGs=15)" FT repeat_region 4558003..4558444 FT /rpt_family="L1" FT repeat_region 4558448..4558495 FT /rpt_family="(TTTTA)n" FT repeat_region 4558542..4558719 FT /rpt_family="Alu" FT repeat_region 4558800..4558907 FT /rpt_family="L2" FT repeat_region 4559555..4559821 FT /rpt_family="Alu" FT repeat_region 4560072..4560203 FT /rpt_family="L2" FT repeat_region 4560509..4560719 FT /rpt_family="MIR" FT repeat_region 4560988..4561260 FT /rpt_family="MaLR" FT repeat_region 4561275..4561666 FT /rpt_family="MaLR" FT repeat_region 4561707..4561826 FT /rpt_family="MIR" FT repeat_region 4561854..4561881 FT /rpt_family="(CAT)n" FT repeat_region 4562069..4562326 FT /rpt_family="Alu" FT repeat_region 4562550..4562859 FT /rpt_family="Alu" FT repeat_region 4563461..4563640 FT /rpt_family="GA-rich" FT repeat_region 4564173..4564472 FT /rpt_family="Alu" FT repeat_region 4564478..4564535 FT /rpt_family="MaLR" FT repeat_region 4564536..4564847 FT /rpt_family="Alu" FT repeat_region 4564848..4565146 FT /rpt_family="MaLR" FT repeat_region 4565147..4565456 FT /rpt_family="Alu" FT repeat_region 4565457..4565517 FT /rpt_family="MaLR" FT repeat_region 4565918..4566211 FT /rpt_family="Alu" FT repeat_region 4566262..4566558 FT /rpt_family="Alu" FT repeat_region 4566655..4566815 FT /rpt_family="L2" FT repeat_region 4566900..4567029 FT /rpt_family="Alu" FT repeat_region 4567036..4567145 FT /rpt_family="Alu" FT repeat_region 4567146..4567432 FT /rpt_family="Alu" FT repeat_region 4567433..4567609 FT /rpt_family="Alu" FT repeat_region 4567759..4568062 FT /rpt_family="ERVL" FT repeat_region 4568065..4568199 FT /rpt_family="Alu" FT repeat_region 4568200..4568364 FT /rpt_family="ERVL" FT repeat_region 4568365..4568623 FT /rpt_family="Alu" FT repeat_region 4568624..4568706 FT /rpt_family="ERVL" FT repeat_region 4568713..4568755 FT /rpt_family="L2" FT repeat_region 4568787..4568879 FT /rpt_family="MIR" FT repeat_region 4569021..4569269 FT /rpt_family="MaLR" FT repeat_region 4569267..4569580 FT /rpt_family="MaLR" FT repeat_region 4569581..4570408 FT /rpt_family="L1" FT repeat_region 4570409..4570682 FT /rpt_family="Alu" FT repeat_region 4570428..4570682 FT /rpt_family="Alu" FT repeat_region 4570683..4570725 FT /rpt_family="L1" FT repeat_region 4570726..4571370 FT /rpt_family="ERV1" FT repeat_region 4571371..4571434 FT /rpt_family="L1" FT repeat_region 4571527..4571823 FT /rpt_family="Alu" FT repeat_region 4571943..4572212 FT /rpt_family="Alu" FT repeat_region 4572713..4572761 FT /rpt_family="MaLR" FT repeat_region 4572762..4573090 FT /rpt_family="Alu" FT repeat_region 4573091..4573195 FT /rpt_family="MaLR" FT repeat_region 4573196..4573535 FT /rpt_family="MaLR" FT repeat_region 4573536..4573808 FT /rpt_family="MaLR" FT repeat_region 4574052..4574370 FT /rpt_family="Alu" FT repeat_region 4574633..4574699 FT /rpt_family="MER2_type" FT repeat_region 4574703..4574816 FT /rpt_family="Alu" FT repeat_region 4574953..4574990 FT /rpt_family="(CAATA)n" FT repeat_region 4575007..4575313 FT /rpt_family="Alu" FT repeat_region 4575584..4575737 FT /rpt_family="MER2_type" FT repeat_region 4576252..4576444 FT /rpt_family="Alu" FT repeat_region 4576449..4576749 FT /rpt_family="Alu" FT repeat_region 4576968..4577067 FT /rpt_family="L2" FT repeat_region 4577159..4577222 FT /rpt_family="MIR" FT repeat_region 4577455..4577549 FT /rpt_family="MIR" FT repeat_region 4577729..4577803 FT /rpt_family="L1" FT repeat_region 4577804..4578104 FT /rpt_family="Alu" FT repeat_region 4578105..4578175 FT /rpt_family="L1" FT repeat_region 4578200..4578494 FT /rpt_family="Alu" FT repeat_region 4578566..4578662 FT /rpt_family="ERV1" FT repeat_region 4578663..4578957 FT /rpt_family="Alu" FT repeat_region 4578960..4579244 FT /rpt_family="Alu" FT repeat_region 4579245..4579278 FT /rpt_family="(TTAA)n" FT repeat_region 4579286..4579862 FT /rpt_family="ERV1" FT repeat_region 4579956..4580049 FT /rpt_family="L1" FT repeat_region 4580052..4580342 FT /rpt_family="Alu" FT repeat_region 4580416..4580622 FT /rpt_family="L1" FT repeat_region 4580630..4580771 FT /rpt_family="MER1_type" FT repeat_region 4580865..4581148 FT /rpt_family="Alu" FT repeat_region 4581213..4581369 FT /rpt_family="L1" FT repeat_region 4581370..4581727 FT /rpt_family="MaLR" FT repeat_region 4581728..4581759 FT /rpt_family="L1" FT repeat_region 4581778..4581949 FT /rpt_family="Alu" FT repeat_region 4582412..4582903 FT /rpt_family="MaLR" FT repeat_region 4583357..4583529 FT /rpt_family="L2" FT repeat_region 4583631..4583914 FT /rpt_family="Alu" FT repeat_region 4584067..4584136 FT /rpt_family="MER1_type" FT repeat_region 4584252..4584637 FT /rpt_family="L1" FT repeat_region 4584680..4584847 FT /rpt_family="(TA)n" FT repeat_region 4584848..4584889 FT /rpt_family="AT_rich" FT repeat_region 4584890..4585482 FT /rpt_family="L1" FT repeat_region 4585500..4585558 FT /rpt_family="L1" FT repeat_region 4585559..4585853 FT /rpt_family="Alu" FT repeat_region 4585854..4585979 FT /rpt_family="L1" FT repeat_region 4585980..4586370 FT /rpt_family="MaLR" FT repeat_region 4586371..4586561 FT /rpt_family="L1" FT repeat_region 4586562..4586874 FT /rpt_family="Alu" FT repeat_region 4586875..4587200 FT /rpt_family="L1" FT repeat_region 4587209..4587629 FT /rpt_family="L2" FT repeat_region 4587630..4587931 FT /rpt_family="Alu" FT repeat_region 4587932..4587959 FT /rpt_family="L2" FT repeat_region 4588061..4588159 FT /rpt_family="MIR" FT repeat_region 4588157..4588696 FT /rpt_family="L2" FT repeat_region 4588921..4589356 FT /rpt_family="Alu" FT repeat_region 4589444..4589845 FT /rpt_family="L2" FT repeat_region 4590133..4590568 FT /rpt_family="L1" FT repeat_region 4590763..4590801 FT /rpt_family="ERVL" FT repeat_region 4590802..4590829 FT /rpt_family="(CA)n" FT repeat_region 4590830..4591009 FT /rpt_family="ERVL" FT repeat_region 4591319..4591416 FT /rpt_family="L2" FT repeat_region 4591538..4591664 FT /rpt_family="MER1_type" FT repeat_region 4592047..4592155 FT /rpt_family="Alu" FT repeat_region 4592165..4593164 FT /rpt_family="L1" FT repeat_region 4592615..4593164 FT /rpt_family="L1" FT repeat_region 4593403..4593931 FT /rpt_family="ERVL" FT repeat_region 4596903..4597046 FT /rpt_family="MIR" FT repeat_region 4597578..4597828 FT /rpt_family="Alu" FT repeat_region 4597847..4598097 FT /rpt_family="L1" FT repeat_region 4598114..4598134 FT /rpt_family="AT_rich" FT repeat_region 4598608..4598897 FT /rpt_family="Alu" FT repeat_region 4598951..4599275 FT /rpt_family="Alu" FT repeat_region 4599605..4599728 FT /rpt_family="L1" FT repeat_region 4600015..4600248 FT /rpt_family="Alu" FT repeat_region 4600255..4600373 FT /rpt_family="L2" FT repeat_region 4600411..4600457 FT /rpt_family="L1" FT repeat_region 4600578..4600758 FT /rpt_family="MaLR" FT repeat_region 4600762..4601072 FT /rpt_family="Alu" FT repeat_region 4601075..4601361 FT /rpt_family="Alu" FT repeat_region 4601369..4601420 FT /rpt_family="(GGGA)n" FT repeat_region 4601963..4602113 FT /rpt_family="L1" FT repeat_region 4602127..4602376 FT /rpt_family="Alu" FT repeat_region 4602382..4602550 FT /rpt_family="Alu" FT repeat_region 4602552..4602857 FT /rpt_family="Alu" FT repeat_region 4602892..4603190 FT /rpt_family="L1" FT repeat_region 4603191..4603511 FT /rpt_family="Alu" FT repeat_region 4603512..4603634 FT /rpt_family="L1" FT repeat_region 4603801..4604025 FT /rpt_family="L1" FT repeat_region 4604026..4604325 FT /rpt_family="Alu" FT repeat_region 4604326..4604575 FT /rpt_family="L1" FT repeat_region 4604587..4604878 FT /rpt_family="Alu" FT repeat_region 4604879..4605224 FT /rpt_family="L1" FT repeat_region 4605225..4605521 FT /rpt_family="Alu" FT repeat_region 4605522..4606353 FT /rpt_family="L1" FT repeat_region 4606357..4606490 FT /rpt_family="L1" FT repeat_region 4606499..4606548 FT /rpt_family="MER1_type" FT repeat_region 4606691..4606753 FT /rpt_family="MIR" FT repeat_region 4607190..4607477 FT /rpt_family="Alu" FT repeat_region 4607693..4607993 FT /rpt_family="Alu" FT repeat_region 4608262..4608623 FT /rpt_family="Alu" FT repeat_region 4608629..4608936 FT /rpt_family="Alu" FT repeat_region 4608940..4609068 FT /rpt_family="Alu" FT repeat_region 4609870..4609998 FT /rpt_family="L1" FT repeat_region 4610003..4610242 FT /rpt_family="Alu" FT repeat_region 4610253..4610659 FT /rpt_family="ERVL" FT repeat_region 4610660..4611068 FT /rpt_family="(TA)n" FT repeat_region 4611069..4611129 FT /rpt_family="ERVL" FT repeat_region 4611130..4611190 FT /rpt_family="Alu" FT repeat_region 4611257..4611566 FT /rpt_family="Alu" FT repeat_region 4611666..4612061 FT /rpt_family="MaLR" FT repeat_region 4612131..4612426 FT /rpt_family="Alu" FT repeat_region 4612540..4612672 FT /rpt_family="L1" FT repeat_region 4612673..4612977 FT /rpt_family="Alu" FT repeat_region 4612978..4613096 FT /rpt_family="L1" FT repeat_region 4613155..4613278 FT /rpt_family="Alu" FT repeat_region 4613298..4613605 FT /rpt_family="L1" FT repeat_region 4613606..4613648 FT /rpt_family="MaLR" FT repeat_region 4613649..4613944 FT /rpt_family="Alu" FT repeat_region 4613945..4614296 FT /rpt_family="MaLR" FT repeat_region 4614297..4614552 FT /rpt_family="L1" FT repeat_region 4614599..4614624 FT /rpt_family="(TTA)n" FT repeat_region 4614650..4614731 FT /rpt_family="AT_rich" FT repeat_region 4614753..4614789 FT /rpt_family="(TTTA)n" FT repeat_region 4615110..4615403 FT /rpt_family="MaLR" FT repeat_region 4615405..4615442 FT /rpt_family="(CA)n" FT repeat_region 4615455..4615729 FT /rpt_family="Alu" FT repeat_region 4615767..4616055 FT /rpt_family="Alu" FT repeat_region 4616091..4616381 FT /rpt_family="ERV1" FT repeat_region 4616382..4616707 FT /rpt_family="Alu" FT repeat_region 4616708..4616872 FT /rpt_family="ERV1" FT repeat_region 4616929..4617001 FT /rpt_family="L2" FT repeat_region 4617002..4617202 FT /rpt_family="L1" FT repeat_region 4617208..4617238 FT /rpt_family="AT_rich" FT repeat_region 4617374..4617681 FT /rpt_family="Alu" FT repeat_region 4618747..4618938 FT /rpt_family="MaLR" FT repeat_region 4618952..4619294 FT /rpt_family="MaLR" FT repeat_region 4619303..4619596 FT /rpt_family="Alu" FT repeat_region 4619618..4619750 FT /rpt_family="Alu" FT repeat_region 4619783..4619874 FT /rpt_family="Alu" FT repeat_region 4619876..4620205 FT /rpt_family="Ricksha_c" FT repeat_region 4620206..4620516 FT /rpt_family="Alu" FT repeat_region 4620517..4622000 FT /rpt_family="Ricksha_c" FT repeat_region 4622002..4622056 FT /rpt_family="Alu" FT repeat_region 4622057..4623024 FT /rpt_family="ERVK" FT repeat_region 4623025..4623119 FT /rpt_family="SVA" FT repeat_region 4630561..4631528 FT /rpt_family="ERVK" FT repeat_region 4631529..4631623 FT /rpt_family="SVA" FT repeat_region 4639064..4640031 FT /rpt_family="ERVK" FT repeat_region 4640032..4640235 FT /rpt_family="Alu" FT repeat_region 4640266..4640356 FT /rpt_family="L1" FT repeat_region 4640357..4640668 FT /rpt_family="Alu" FT repeat_region 4640703..4641014 FT /rpt_family="Alu" FT repeat_region 4641015..4641305 FT /rpt_family="L1" FT repeat_region 4641318..4641448 FT /rpt_family="Alu" FT repeat_region 4641449..4641748 FT /rpt_family="Alu" FT repeat_region 4642251..4642395 FT /rpt_family="(TTTC)n" FT repeat_region 4643071..4643510 FT /rpt_family="(CA)n" FT repeat_region 4643525..4643615 FT /rpt_family="(CA)n" FT repeat_region 4643654..4643928 FT /rpt_family="(CA)n" FT repeat_region 4644498..4644705 FT /rpt_family="Alu" FT repeat_region 4645019..4645069 FT /rpt_family="MaLR" FT repeat_region 4645070..4645372 FT /rpt_family="Alu" FT repeat_region 4645373..4645440 FT /rpt_family="MaLR" FT repeat_region 4645770..4646048 FT /rpt_family="Alu" FT repeat_region 4646112..4646417 FT /rpt_family="L2" FT repeat_region 4647726..4647917 FT /rpt_family="MIR" FT repeat_region 4647933..4648239 FT /rpt_family="Alu" FT repeat_region 4648271..4648411 FT /rpt_family="Alu" FT repeat_region 4648414..4648612 FT /rpt_family="L1" FT repeat_region 4648616..4648640 FT /rpt_family="(TAAAA)n" FT repeat_region 4648643..4648837 FT /rpt_family="Alu" FT repeat_region 4649060..4649084 FT /rpt_family="(TTTTTG)n" FT repeat_region 4649336..4649480 FT /rpt_family="Alu" FT repeat_region 4649481..4649789 FT /rpt_family="Alu" FT repeat_region 4649790..4649949 FT /rpt_family="Alu" FT repeat_region 4649950..4649985 FT /rpt_family="AT_rich" FT repeat_region 4650035..4650343 FT /rpt_family="Alu" FT repeat_region 4650372..4650479 FT /rpt_family="MER1_type" FT repeat_region 4650548..4650681 FT /rpt_family="MER1_type" FT repeat_region 4650769..4651065 FT /rpt_family="Alu" FT repeat_region 4651151..4651661 FT /rpt_family="L1" FT repeat_region 4651662..4651951 FT /rpt_family="Alu" FT repeat_region 4651987..4652464 FT /rpt_family="MER1_type" FT repeat_region 4652465..4652585 FT /rpt_family="L1" FT repeat_region 4653216..4653519 FT /rpt_family="ERVL" FT repeat_region 4653847..4654170 FT /rpt_family="Alu" FT repeat_region 4654209..4654512 FT /rpt_family="Alu" FT repeat_region 4654659..4654802 FT /rpt_family="MIR" FT repeat_region 4654817..4655111 FT /rpt_family="Alu" FT repeat_region 4655140..4655444 FT /rpt_family="Alu" FT repeat_region 4655446..4655773 FT /rpt_family="MaLR" FT repeat_region 4655779..4656184 FT /rpt_family="L1" FT repeat_region 4656195..4656371 FT /rpt_family="L1" FT repeat_region 4656372..4656675 FT /rpt_family="Alu" FT repeat_region 4656676..4656830 FT /rpt_family="L1" FT repeat_region 4656831..4657145 FT /rpt_family="Alu" FT repeat_region 4657146..4657391 FT /rpt_family="L1" FT repeat_region 4657392..4657533 FT /rpt_family="MaLR" FT repeat_region 4657534..4657843 FT /rpt_family="Alu" FT repeat_region 4657844..4658072 FT /rpt_family="MaLR" FT repeat_region 4658136..4658458 FT /rpt_family="L1" FT repeat_region 4658459..4658486 FT /rpt_family="(CA)n" FT repeat_region 4658488..4658768 FT /rpt_family="Alu" FT repeat_region 4658769..4658807 FT /rpt_family="(CA)n" FT repeat_region 4658808..4659004 FT /rpt_family="L1" FT repeat_region 4659011..4659082 FT /rpt_family="Alu" FT repeat_region 4659110..4659181 FT /rpt_family="MaLR" FT repeat_region 4659182..4659461 FT /rpt_family="Alu" FT repeat_region 4659462..4659659 FT /rpt_family="MaLR" FT repeat_region 4659815..4660125 FT /rpt_family="Alu" FT repeat_region 4660323..4660441 FT /rpt_family="Alu" FT repeat_region 4660494..4660832 FT /rpt_family="Alu" FT repeat_region 4661109..4661368 FT /rpt_family="MER2_type" FT repeat_region 4661412..4661717 FT /rpt_family="Alu" FT repeat_region 4661746..4661775 FT /rpt_family="MER2_type" FT repeat_region 4661776..4662006 FT /rpt_family="MER2_type" FT repeat_region 4662117..4662436 FT /rpt_family="MaLR" FT repeat_region 4662437..4662512 FT /rpt_family="Mariner" FT repeat_region 4662513..4662564 FT /rpt_family="MaLR" FT repeat_region 4664611..4664886 FT /rpt_family="Alu" FT repeat_region 4664888..4664927 FT /rpt_family="(TTTA)n" FT repeat_region 4664936..4665208 FT /rpt_family="Alu" FT repeat_region 4665506..4666005 FT /rpt_family="L2" FT repeat_region 4666007..4666310 FT /rpt_family="Alu" FT repeat_region 4666350..4666470 FT /rpt_family="Alu" FT repeat_region 4666792..4667276 FT /rpt_family="CR1" FT repeat_region 4667618..4667717 FT /rpt_family="MIR" FT repeat_region 4667718..4668027 FT /rpt_family="Alu" FT repeat_region 4668028..4668094 FT /rpt_family="MIR" FT repeat_region 4668137..4668274 FT /rpt_family="L2" FT repeat_region 4668285..4668584 FT /rpt_family="Alu" FT repeat_region 4668595..4668712 FT /rpt_family="Alu" FT repeat_region 4668713..4668763 FT /rpt_family="AT_rich" FT repeat_region 4669037..4669084 FT /rpt_family="C-rich" FT repeat_region 4669249..4669435 FT /rpt_family="MIR" FT repeat_region 4670204..4670513 FT /rpt_family="Alu" FT repeat_region 4670581..4670880 FT /rpt_family="Alu" FT repeat_region 4671088..4671180 FT /rpt_family="L2" FT repeat_region 4671737..4671818 FT /rpt_family="MER1_type" FT repeat_region 4671882..4672143 FT /rpt_family="Alu" FT repeat_region 4672275..4672367 FT /rpt_family="L1" FT repeat_region 4672368..4672390 FT /rpt_family="AT_rich" FT repeat_region 4672439..4672718 FT /rpt_family="Alu" FT repeat_region 4672737..4672837 FT /rpt_family="MER1_type" FT repeat_region 4672874..4673005 FT /rpt_family="Alu" FT repeat_region 4673042..4673069 FT /rpt_family="AT_rich" FT repeat_region 4673070..4673093 FT /rpt_family="(TTTAA)n" FT repeat_region 4673094..4673264 FT /rpt_family="Alu" FT repeat_region 4673652..4673956 FT /rpt_family="Alu" FT repeat_region 4674153..4674455 FT /rpt_family="Alu" FT repeat_region 4674518..4674829 FT /rpt_family="Alu" FT repeat_region 4674936..4674980 FT /rpt_family="MER1_type" FT repeat_region 4674991..4675280 FT /rpt_family="Alu" FT repeat_region 4675320..4675609 FT /rpt_family="Alu" FT repeat_region 4675612..4675706 FT /rpt_family="MER1_type" FT repeat_region 4675791..4676075 FT /rpt_family="Alu" FT repeat_region 4676261..4676304 FT /rpt_family="(TA)n" FT repeat_region 4676305..4676377 FT /rpt_family="L1" FT repeat_region 4676392..4676457 FT /rpt_family="L1" FT repeat_region 4676458..4676766 FT /rpt_family="Alu" FT repeat_region 4676767..4676786 FT /rpt_family="L1" FT repeat_region 4677557..4677678 FT /rpt_family="Alu" FT repeat_region 4677679..4677715 FT /rpt_family="(CA)n" FT repeat_region 4677716..4677893 FT /rpt_family="Alu" FT repeat_region 4677915..4678075 FT /rpt_family="Alu" FT repeat_region 4678113..4678412 FT /rpt_family="Alu" FT repeat_region 4678413..4678801 FT /rpt_family="L2" FT repeat_region 4678816..4678853 FT /rpt_family="tRNA-Ala-GCY" FT repeat_region 4679124..4679163 FT /rpt_family="L1" FT repeat_region 4679164..4679464 FT /rpt_family="Alu" FT repeat_region 4679465..4679796 FT /rpt_family="L1" FT repeat_region 4679800..4680079 FT /rpt_family="Alu" FT repeat_region 4680105..4680392 FT /rpt_family="L1" FT repeat_region 4680393..4680418 FT /rpt_family="AT_rich" FT repeat_region 4680419..4680556 FT /rpt_family="Alu" FT repeat_region 4680557..4680857 FT /rpt_family="Alu" FT repeat_region 4680858..4681023 FT /rpt_family="Alu" FT misc_feature 4681251..4682117 FT /note="CpG_island (%GC=73.5, o/e=0.85, #CpGs=111)" FT repeat_region 4681349..4681429 FT /rpt_family="(CCCCG)n" FT repeat_region 4682252..4682383 FT /rpt_family="Alu" FT repeat_region 4682668..4682968 FT /rpt_family="Alu" FT repeat_region 4682980..4683113 FT /rpt_family="Alu" FT repeat_region 4683133..4683356 FT /rpt_family="MER2_type" FT repeat_region 4683357..4683651 FT /rpt_family="Alu" FT repeat_region 4683652..4683713 FT /rpt_family="MER2_type" FT repeat_region 4683743..4683784 FT /rpt_family="L2" FT repeat_region 4683877..4684104 FT /rpt_family="MER1_type" FT repeat_region 4684170..4684253 FT /rpt_family="Alu" FT repeat_region 4684261..4684568 FT /rpt_family="Alu" FT repeat_region 4684570..4684806 FT /rpt_family="Alu" FT repeat_region 4684826..4685059 FT /rpt_family="MER1_type" FT repeat_region 4685058..4685140 FT /rpt_family="MER1_type" FT repeat_region 4685141..4685164 FT /rpt_family="(TTTTG)n" FT repeat_region 4685165..4685204 FT /rpt_family="MER1_type" FT repeat_region 4685227..4685476 FT /rpt_family="MER1_type" FT repeat_region 4685477..4685776 FT /rpt_family="Alu" FT repeat_region 4685777..4685861 FT /rpt_family="MER1_type" FT repeat_region 4685985..4686100 FT /rpt_family="MaLR" FT repeat_region 4686127..4686581 FT /rpt_family="MaLR" FT repeat_region 4686632..4686933 FT /rpt_family="Alu" FT repeat_region 4687139..4687289 FT /rpt_family="MIR" FT repeat_region 4687429..4687721 FT /rpt_family="Alu" FT repeat_region 4688301..4688462 FT /rpt_family="MaLR" FT repeat_region 4688463..4688755 FT /rpt_family="Alu" FT repeat_region 4688756..4688821 FT /rpt_family="MaLR" FT repeat_region 4689051..4689200 FT /rpt_family="Alu" FT repeat_region 4689217..4689379 FT /rpt_family="Alu" FT repeat_region 4689380..4689690 FT /rpt_family="Alu" FT repeat_region 4689691..4689838 FT /rpt_family="Alu" FT repeat_region 4691205..4691365 FT /rpt_family="Alu" FT repeat_region 4691366..4691671 FT /rpt_family="Alu" FT repeat_region 4691680..4691714 FT /rpt_family="(TTTTG)n" FT repeat_region 4691715..4691838 FT /rpt_family="Alu" FT repeat_region 4691884..4691923 FT /rpt_family="(TCCC)n" FT repeat_region 4691964..4692191 FT /rpt_family="MaLR" FT repeat_region 4692244..4692561 FT /rpt_family="Alu" FT repeat_region 4692563..4692843 FT /rpt_family="ERVL" FT repeat_region 4692844..4693149 FT /rpt_family="Alu" FT repeat_region 4693150..4693300 FT /rpt_family="ERVL" FT repeat_region 4693393..4693425 FT /rpt_family="AT_rich" FT repeat_region 4693577..4693876 FT /rpt_family="Alu" FT repeat_region 4693990..4694283 FT /rpt_family="Alu" FT repeat_region 4694498..4694808 FT /rpt_family="Alu" FT repeat_region 4694923..4694969 FT /rpt_family="Alu" FT repeat_region 4695049..4695075 FT /rpt_family="L1" FT repeat_region 4695076..4695378 FT /rpt_family="Alu" FT repeat_region 4695379..4695464 FT /rpt_family="L1" FT repeat_region 4696032..4696389 FT /rpt_family="MaLR" FT repeat_region 4696440..4696745 FT /rpt_family="Alu" FT repeat_region 4696750..4696969 FT /rpt_family="Alu" FT repeat_region 4696970..4697192 FT /rpt_family="Alu" FT repeat_region 4697223..4697474 FT /rpt_family="L1" FT repeat_region 4697583..4697880 FT /rpt_family="L1" FT repeat_region 4697881..4698047 FT /rpt_family="MER1_type" FT repeat_region 4698048..4698133 FT /rpt_family="L1" FT repeat_region 4698134..4698624 FT /rpt_family="MER1_type" FT repeat_region 4698625..4698781 FT /rpt_family="L1" FT repeat_region 4698782..4699088 FT /rpt_family="Alu" FT repeat_region 4699089..4699212 FT /rpt_family="L1" FT repeat_region 4699252..4699812 FT /rpt_family="ERVL" FT repeat_region 4699926..4700038 FT /rpt_family="AcHobo" FT repeat_region 4700048..4700236 FT /rpt_family="MaLR" FT repeat_region 4700276..4700330 FT /rpt_family="MIR" FT repeat_region 4700627..4700881 FT /rpt_family="Alu" FT repeat_region 4700882..4700928 FT /rpt_family="(CA)n" FT repeat_region 4700950..4701086 FT /rpt_family="Alu" FT repeat_region 4702072..4702379 FT /rpt_family="Alu" FT repeat_region 4702522..4702610 FT /rpt_family="MIR" FT repeat_region 4702616..4702917 FT /rpt_family="Alu" FT repeat_region 4702918..4703028 FT /rpt_family="Alu" FT repeat_region 4703342..4703461 FT /rpt_family="L1" FT repeat_region 4703462..4703754 FT /rpt_family="Alu" FT repeat_region 4703755..4704027 FT /rpt_family="L1" FT repeat_region 4704028..4704338 FT /rpt_family="Alu" FT repeat_region 4704545..4704661 FT /rpt_family="Alu" FT repeat_region 4704662..4704679 FT /rpt_family="AT_rich" FT repeat_region 4704680..4704970 FT /rpt_family="Alu" FT repeat_region 4704971..4705000 FT /rpt_family="AT_rich" FT repeat_region 4705359..4705480 FT /rpt_family="L1" FT repeat_region 4705479..4705719 FT /rpt_family="L1" FT repeat_region 4705726..4706038 FT /rpt_family="Alu" FT repeat_region 4706102..4706282 FT /rpt_family="Alu" FT repeat_region 4706373..4706546 FT /rpt_family="Alu" FT repeat_region 4706547..4706862 FT /rpt_family="Alu" FT repeat_region 4706863..4706886 FT /rpt_family="Alu" FT repeat_region 4706887..4706981 FT /rpt_family="Alu" FT repeat_region 4706999..4707136 FT /rpt_family="Alu" FT repeat_region 4707137..4707445 FT /rpt_family="Alu" FT repeat_region 4707446..4707593 FT /rpt_family="Alu" FT repeat_region 4707666..4707720 FT /rpt_family="MaLR" FT repeat_region 4707990..4708108 FT /rpt_family="MaLR" FT repeat_region 4708052..4708116 FT /rpt_family="ERVL" FT repeat_region 4708232..4708397 FT /rpt_family="Alu" FT repeat_region 4708402..4708545 FT /rpt_family="Alu" FT repeat_region 4708546..4708828 FT /rpt_family="Alu" FT repeat_region 4708829..4708868 FT /rpt_family="(TA)n" FT repeat_region 4708869..4709034 FT /rpt_family="Alu" FT repeat_region 4709036..4709371 FT /rpt_family="L1" FT repeat_region 4709373..4709518 FT /rpt_family="MIR" FT repeat_region 4709783..4709847 FT /rpt_family="CT-rich" FT repeat_region 4709848..4710131 FT /rpt_family="Alu" FT repeat_region 4710135..4710232 FT /rpt_family="MIR" FT repeat_region 4710418..4710890 FT /rpt_family="MaLR" FT repeat_region 4711183..4711274 FT /rpt_family="(CA)n" FT repeat_region 4711865..4711952 FT /rpt_family="MER1_type" FT repeat_region 4711944..4712101 FT /rpt_family="MaLR" FT repeat_region 4712094..4712231 FT /rpt_family="MER1_type" FT repeat_region 4712296..4712610 FT /rpt_family="Alu" FT repeat_region 4712622..4712770 FT /rpt_family="Alu" FT repeat_region 4712771..4713045 FT /rpt_family="Alu" FT repeat_region 4713046..4713207 FT /rpt_family="Alu" FT repeat_region 4713210..4713517 FT /rpt_family="Alu" FT repeat_region 4713518..4713702 FT /rpt_family="L1" FT repeat_region 4713703..4713995 FT /rpt_family="Alu" FT repeat_region 4713996..4714193 FT /rpt_family="L1" FT repeat_region 4714194..4714501 FT /rpt_family="Alu" FT repeat_region 4714502..4714554 FT /rpt_family="L1" FT repeat_region 4714568..4714771 FT /rpt_family="Alu" FT repeat_region 4715013..4715302 FT /rpt_family="Alu" FT repeat_region 4715316..4715592 FT /rpt_family="Alu" FT repeat_region 4715923..4716229 FT /rpt_family="Alu" FT repeat_region 4716236..4716549 FT /rpt_family="Alu" FT repeat_region 4716555..4716849 FT /rpt_family="Alu" FT repeat_region 4717004..4717057 FT /rpt_family="L1" FT repeat_region 4717058..4717351 FT /rpt_family="Alu" FT repeat_region 4717352..4717879 FT /rpt_family="L1" FT repeat_region 4717880..4718193 FT /rpt_family="Alu" FT repeat_region 4718194..4718268 FT /rpt_family="L1" FT repeat_region 4718800..4719107 FT /rpt_family="Alu" FT repeat_region 4719342..4719405 FT /rpt_family="L2" FT repeat_region 4719636..4719767 FT /rpt_family="Alu" FT repeat_region 4719768..4720051 FT /rpt_family="Alu" FT repeat_region 4720052..4720213 FT /rpt_family="Alu" FT repeat_region 4720220..4720314 FT /rpt_family="(GGAA)n" FT repeat_region 4720316..4720614 FT /rpt_family="Alu" FT repeat_region 4720615..4721099 FT /rpt_family="(GGAA)n" FT repeat_region 4721184..4721435 FT /rpt_family="Alu" FT misc_feature 4721638..4722779 FT /note="CpG_island (%GC=79.2, o/e=0.91, #CpGs=168)" FT repeat_region 4721890..4721915 FT /rpt_family="(CCG)n" FT repeat_region 4722017..4722125 FT /rpt_family="(CCG)n" FT repeat_region 4722188..4722227 FT /rpt_family="GC_rich" FT repeat_region 4724848..4725152 FT /rpt_family="Alu" FT repeat_region 4725157..4725182 FT /rpt_family="AT_rich" FT repeat_region 4725307..4725601 FT /rpt_family="Alu" FT repeat_region 4726240..4726368 FT /rpt_family="L2" FT repeat_region 4726555..4726862 FT /rpt_family="Alu" FT repeat_region 4726913..4727224 FT /rpt_family="Alu" FT repeat_region 4727531..4727661 FT /rpt_family="Alu" FT repeat_region 4727681..4727988 FT /rpt_family="L1" FT repeat_region 4728021..4728309 FT /rpt_family="Alu" FT repeat_region 4728336..4728599 FT /rpt_family="L1" FT repeat_region 4728611..4728908 FT /rpt_family="Alu" FT repeat_region 4729110..4729217 FT /rpt_family="U13" FT ncRNA 4729111..4729214 FT /product="snoRNA-U13-related" FT /ncRNA_class="snoRNA" FT repeat_region 4730990..4731266 FT /rpt_family="Alu" FT repeat_region 4731383..4731443 FT /rpt_family="L2" FT repeat_region 4731563..4732019 FT /rpt_family="MER1_type" FT repeat_region 4732020..4732344 FT /rpt_family="Alu" FT repeat_region 4732351..4732614 FT /rpt_family="Alu" FT repeat_region 4732615..4732824 FT /rpt_family="MER1_type" FT repeat_region 4732992..4733036 FT /rpt_family="L1" FT repeat_region 4733367..4733489 FT /rpt_family="Alu" FT repeat_region 4733522..4733816 FT /rpt_family="Alu" FT repeat_region 4735055..4735150 FT /rpt_family="MER1_type" FT repeat_region 4735154..4735285 FT /rpt_family="Alu" FT repeat_region 4735286..4735585 FT /rpt_family="Alu" FT repeat_region 4735586..4735768 FT /rpt_family="Alu" FT repeat_region 4736196..4736286 FT /rpt_family="L2" FT repeat_region 4736417..4736719 FT /rpt_family="Alu" FT repeat_region 4736843..4736972 FT /rpt_family="MaLR" FT repeat_region 4736995..4737106 FT /rpt_family="MER1_type" FT repeat_region 4737373..4737421 FT /rpt_family="(TG)n" FT repeat_region 4737451..4737755 FT /rpt_family="Alu" FT repeat_region 4737773..4738019 FT /rpt_family="L1" FT repeat_region 4738092..4738182 FT /rpt_family="L1" FT repeat_region 4738183..4738484 FT /rpt_family="Alu" FT repeat_region 4738488..4738618 FT /rpt_family="Alu" FT repeat_region 4738619..4738840 FT /rpt_family="L1" FT repeat_region 4738917..4738982 FT /rpt_family="Alu" FT repeat_region 4739008..4739298 FT /rpt_family="Alu" FT repeat_region 4739306..4739399 FT /rpt_family="L1" FT repeat_region 4739419..4739677 FT /rpt_family="L1" FT repeat_region 4739696..4739937 FT /rpt_family="L2" FT repeat_region 4739964..4740150 FT /rpt_family="MIR" FT repeat_region 4740151..4740464 FT /rpt_family="Alu" FT repeat_region 4740465..4740506 FT /rpt_family="MIR" FT repeat_region 4741105..4741241 FT /rpt_family="Alu" FT repeat_region 4741242..4741555 FT /rpt_family="Alu" FT repeat_region 4741556..4741737 FT /rpt_family="Alu" FT repeat_region 4741968..4742276 FT /rpt_family="Alu" FT repeat_region 4742736..4742763 FT /rpt_family="(GGCTG)n" FT repeat_region 4742802..4742895 FT /rpt_family="L2" FT repeat_region 4743800..4744109 FT /rpt_family="Alu" FT repeat_region 4744135..4744168 FT /rpt_family="AT_rich" FT repeat_region 4744357..4744444 FT /rpt_family="Alu" FT repeat_region 4744458..4744761 FT /rpt_family="Alu" FT repeat_region 4744653..4744760 FT /rpt_family="Alu" FT repeat_region 4744813..4745112 FT /rpt_family="Alu" FT repeat_region 4745143..4745204 FT /rpt_family="(TC)n" FT repeat_region 4745205..4745465 FT /rpt_family="Alu" FT repeat_region 4745533..4745673 FT /rpt_family="L1" FT repeat_region 4745666..4745751 FT /rpt_family="L1" FT repeat_region 4747321..4747613 FT /rpt_family="Alu" FT repeat_region 4748414..4748724 FT /rpt_family="Alu" FT repeat_region 4749441..4749536 FT /rpt_family="MIR" FT repeat_region 4749765..4749838 FT /rpt_family="MIR" FT repeat_region 4749907..4750222 FT /rpt_family="Alu" FT repeat_region 4753120..4753420 FT /rpt_family="Alu" FT repeat_region 4753445..4753756 FT /rpt_family="Alu" FT repeat_region 4753920..4754204 FT /rpt_family="Alu" FT repeat_region 4755581..4755887 FT /rpt_family="Alu" FT repeat_region 4755903..4756164 FT /rpt_family="Alu" FT misc_feature 4757803..4758037 FT /note="CpG_island (%GC=62.6, o/e=0.88, #CpGs=21)" FT repeat_region 4758047..4758434 FT /rpt_family="L1" FT repeat_region 4758435..4758739 FT /rpt_family="Alu" FT repeat_region 4758744..4759065 FT /rpt_family="Alu" FT repeat_region 4759066..4759125 FT /rpt_family="L1" FT repeat_region 4759126..4759412 FT /rpt_family="Alu" FT repeat_region 4759413..4759733 FT /rpt_family="L1" FT repeat_region 4759737..4760170 FT /rpt_family="L1" FT repeat_region 4760333..4760636 FT /rpt_family="Alu" FT repeat_region 4761210..4761521 FT /rpt_family="Alu" FT repeat_region 4763306..4763601 FT /rpt_family="Alu" FT repeat_region 4763823..4764126 FT /rpt_family="Alu" FT repeat_region 4764300..4764434 FT /rpt_family="MaLR" FT misc_feature 4764685..4765252 FT /note="CpG_island (%GC=63.6, o/e=0.68, #CpGs=42)" FT repeat_region 4766023..4766265 FT /rpt_family="Alu" FT repeat_region 4766575..4766882 FT /rpt_family="Alu" FT repeat_region 4766932..4767244 FT /rpt_family="Alu" FT repeat_region 4768241..4768377 FT /rpt_family="Alu" FT repeat_region 4769339..4769656 FT /rpt_family="Alu" FT repeat_region 4770520..4770646 FT /rpt_family="Alu" FT repeat_region 4771109..4771413 FT /rpt_family="Alu" FT repeat_region 4771960..4771985 FT /rpt_family="(TTCA)n" FT repeat_region 4771988..4772217 FT /rpt_family="Alu" FT repeat_region 4772515..4772732 FT /rpt_family="L1" FT repeat_region 4772829..4772959 FT /rpt_family="Alu" FT repeat_region 4772999..4773227 FT /rpt_family="MaLR" FT repeat_region 4774972..4775194 FT /rpt_family="L1" FT repeat_region 4775503..4775794 FT /rpt_family="Alu" FT repeat_region 4776041..4776344 FT /rpt_family="Alu" FT repeat_region 4776359..4776463 FT /rpt_family="MIR" FT repeat_region 4777057..4777216 FT /rpt_family="(TG)n" FT repeat_region 4777472..4777776 FT /rpt_family="Alu" FT repeat_region 4777786..4778093 FT /rpt_family="Alu" FT repeat_region 4779029..4779064 FT /rpt_family="(TTTTTG)n" FT repeat_region 4779644..4779779 FT /rpt_family="Alu" FT repeat_region 4779780..4780092 FT /rpt_family="Alu" FT repeat_region 4780093..4780279 FT /rpt_family="Alu" FT repeat_region 4780955..4781261 FT /rpt_family="Alu" FT repeat_region 4781555..4781899 FT /rpt_family="MER1_type" FT repeat_region 4782050..4782347 FT /rpt_family="Alu" FT repeat_region 4782822..4782901 FT /rpt_family="L1" FT repeat_region 4782902..4783196 FT /rpt_family="Alu" FT repeat_region 4783197..4783240 FT /rpt_family="L1" FT repeat_region 4783511..4783714 FT /rpt_family="Alu" FT repeat_region 4783888..4784237 FT /rpt_family="L1" FT misc_feature 4784821..4785058 FT /note="CpG_island (%GC=69.7, o/e=0.68, #CpGs=19)" FT repeat_region 4785073..4785120 FT /rpt_family="(TG)n" FT repeat_region 4785251..4785525 FT /rpt_family="Alu" FT repeat_region 4786062..4786339 FT /rpt_family="Alu" FT misc_feature 4786762..4786987 FT /note="CpG_island (%GC=65.0, o/e=0.72, #CpGs=18)" FT repeat_region 4787098..4787129 FT /rpt_family="AT_rich" FT repeat_region 4787160..4787447 FT /rpt_family="Alu" FT repeat_region 4787473..4787630 FT /rpt_family="Alu" FT repeat_region 4787863..4788067 FT /rpt_family="L1" FT repeat_region 4788239..4788344 FT /rpt_family="L1" FT repeat_region 4788388..4788607 FT /rpt_family="Alu" FT repeat_region 4788680..4789023 FT /rpt_family="L1" FT repeat_region 4790077..4790339 FT /rpt_family="Alu" FT repeat_region 4790340..4790635 FT /rpt_family="Alu" FT repeat_region 4790644..4790975 FT /rpt_family="Alu" FT repeat_region 4791585..4791755 FT /rpt_family="Alu" FT repeat_region 4791769..4792074 FT /rpt_family="Alu" FT misc_feature 4794118..4794525 FT /note="CpG_island (%GC=67.4, o/e=0.70, #CpGs=35)" FT misc_feature 4794746..4795042 FT /note="CpG_island (%GC=64.3, o/e=0.89, #CpGs=24)" FT repeat_region 4795113..4795376 FT /rpt_family="Alu" FT repeat_region 4795739..4796046 FT /rpt_family="Alu" FT repeat_region 4796135..4796414 FT /rpt_family="Alu" FT repeat_region 4796893..4796977 FT /rpt_family="MER2_type" FT repeat_region 4796978..4797295 FT /rpt_family="Alu" FT repeat_region 4797296..4797508 FT /rpt_family="MER2_type" FT misc_feature 4798530..4799281 FT /note="CpG_island (%GC=69.5, o/e=0.83, #CpGs=71)" FT repeat_region 4798871..4798890 FT /rpt_family="(CGGGG)n" FT repeat_region 4799381..4799673 FT /rpt_family="Alu" FT repeat_region 4800200..4800507 FT /rpt_family="Alu" FT misc_feature 4800617..4800919 FT /note="CpG_island (%GC=64.7, o/e=1.00, #CpGs=25)" FT repeat_region 4801014..4801067 FT /rpt_family="L2" FT repeat_region 4801096..4801265 FT /rpt_family="Alu" FT repeat_region 4801266..4801355 FT /rpt_family="Alu" FT misc_feature 4801842..4802219 FT /note="CpG_island (%GC=72.0, o/e=0.77, #CpGs=33)" FT repeat_region 4801926..4801983 FT /rpt_family="(CCA)n" FT misc_feature 4802763..4803020 FT /note="CpG_island (%GC=60.9, o/e=1.00, #CpGs=22)" FT repeat_region 4804748..4804846 FT /rpt_family="MIR" FT misc_feature 4806861..4807086 FT /note="CpG_island (%GC=63.3, o/e=0.78, #CpGs=21)" FT repeat_region 4807753..4808062 FT /rpt_family="Alu" FT misc_feature 4807786..4808059 FT /note="CpG_island (%GC=62.4, o/e=0.89, #CpGs=24)" FT repeat_region 4809075..4809371 FT /rpt_family="Alu" FT repeat_region 4809401..4809429 FT /rpt_family="(TTTTG)n" FT repeat_region 4809884..4810172 FT /rpt_family="Alu" FT repeat_region 4810496..4810533 FT /rpt_family="(TG)n" FT repeat_region 4812002..4812104 FT /rpt_family="MIR" FT repeat_region 4812471..4812786 FT /rpt_family="Alu" FT repeat_region 4812887..4813032 FT /rpt_family="Alu" FT repeat_region 4813247..4813542 FT /rpt_family="L1" FT repeat_region 4814067..4814132 FT /rpt_family="L2" FT repeat_region 4814667..4814800 FT /rpt_family="MIR" FT misc_feature 4815020..4815542 FT /note="CpG_island (%GC=69.6, o/e=0.92, #CpGs=56)" FT repeat_region 4816066..4816394 FT /rpt_family="Alu" FT repeat_region 4816445..4816567 FT /rpt_family="Alu" FT repeat_region 4816985..4817019 FT /rpt_family="(TTTA)n" FT repeat_region 4817029..4817319 FT /rpt_family="Alu" FT repeat_region 4817564..4817873 FT /rpt_family="Alu" FT repeat_region 4818329..4818500 FT /rpt_family="L1" FT repeat_region 4818365..4818483 FT /rpt_family="L1" FT repeat_region 4818511..4818667 FT /rpt_family="Alu" FT repeat_region 4818668..4819109 FT /rpt_family="L1" FT repeat_region 4819114..4819258 FT /rpt_family="Alu" FT repeat_region 4819259..4819573 FT /rpt_family="Alu" FT repeat_region 4819574..4819692 FT /rpt_family="Alu" FT repeat_region 4819969..4820112 FT /rpt_family="Alu" FT repeat_region 4820114..4820410 FT /rpt_family="Alu" FT repeat_region 4821672..4821942 FT /rpt_family="Alu" FT misc_feature 4823507..4824097 FT /note="CpG_island (%GC=69.7, o/e=0.69, #CpGs=44)" FT misc_feature 4824366..4824680 FT /note="CpG_island (%GC=68.6, o/e=0.69, #CpGs=24)" FT misc_feature 4825117..4825345 FT /note="CpG_island (%GC=69.4, o/e=0.72, #CpGs=18)" FT repeat_region 4825397..4825536 FT /rpt_family="Alu" FT repeat_region 4826404..4826702 FT /rpt_family="Alu" FT repeat_region 4826842..4827129 FT /rpt_family="Alu" FT misc_feature 4828345..4828549 FT /note="CpG_island (%GC=71.2, o/e=0.57, #CpGs=16)" FT repeat_region 4828751..4828889 FT /rpt_family="(TCCCG)n" FT repeat_region 4829678..4829726 FT /rpt_family="(CCCCAG)n" FT misc_feature 4831749..4832481 FT /note="CpG_island (%GC=70.7, o/e=0.73, #CpGs=65)" FT repeat_region 4831914..4832027 FT /rpt_family="C-rich" FT repeat_region 4832944..4832977 FT /rpt_family="L1" FT repeat_region 4834367..4834405 FT /rpt_family="L1" FT repeat_region 4834406..4834909 FT /rpt_family="ERV1" FT repeat_region 4834910..4835075 FT /rpt_family="Alu" FT repeat_region 4835076..4835388 FT /rpt_family="Alu" FT repeat_region 4835389..4835529 FT /rpt_family="Alu" FT repeat_region 4835530..4835834 FT /rpt_family="Alu" FT repeat_region 4835835..4835953 FT /rpt_family="ERV1" FT repeat_region 4835954..4836188 FT /rpt_family="L1" FT repeat_region 4836265..4836357 FT /rpt_family="L1" FT repeat_region 4836368..4836667 FT /rpt_family="Alu" FT repeat_region 4836879..4837097 FT /rpt_family="MaLR" FT repeat_region 4837130..4837244 FT /rpt_family="MaLR" FT repeat_region 4837311..4837329 FT /rpt_family="L1" FT repeat_region 4837330..4837615 FT /rpt_family="Alu" FT repeat_region 4837616..4837738 FT /rpt_family="L1" FT repeat_region 4837701..4837806 FT /rpt_family="L1" FT gene complement(4838736..4874809) FT /gene="FLJ10324" FT mRNA complement(join(4838736..4839114,4839261..4839400, FT 4839802..4839941,4841284..4841626,4843177..4843699)) FT /gene="FLJ10324" FT mRNA complement(join(4838740..4839114,4839261..4839400, FT 4839802..4839941,4841284..4841626,4843177..4843385, FT 4845197..4845347,4854909..4855081,4855859..4856096, FT 4856870..4856982,4862025..4862185,4871772..4871809, FT 4874238..4874809)) FT /gene="FLJ10324" FT CDS complement(join(4839009..4839114,4839261..4839400, FT 4839802..4839941,4841284..4841626,4843177..4843385, FT 4845197..4845347,4854909..4855081,4855859..4856096, FT 4856870..4856982,4862025..4862185,4871772..4871809, FT 4874238..4874390)) FT /codon_start=1 FT /gene="FLJ10324" FT /product="unknown" FT /note="Homo sapiens hypothetical protein FLJ10324 FT (FLJ10324), mRNA.; H_NH0160E17.1.1 This gene was based on FT gi(8922353)" FT /protein_id="AAS07559.1" FT /translation="MTLIEPGGDDHKLTPAFLLCLCIQHSATHFQPGTFGQLLLKIARL FT IRETVWEKTKELAEKQAQLQEPISLASCAMADLVPDLQPILFWMSNSIELLYFIQQKCP FT LYMQSMEEQLDITGSKESLFSCTLTASEEAMAVLEEVVLYAFQQCVYYVSKSLYICLPA FT LLECPPFQTERRESWSSAPELPEELRRVVSVYQAALDLLRQLQVHPEVASQMLAYLFFF FT SGTLLLNQLLDRGPSLSCFHWPRGVQACARLQQLLEWMRSAGFGAAGEHFFQKLSCTLN FT LLATPRAQLIQMSWTALRAAFPALSPAQLHRLLTHYQLASAMGPMSTWEPGAQDSPEAF FT RSEDVLESYENPPPIVLPSDGFQVDLEANCLDDSIYQHLLYVRHFLWGLRSRASPGSPG FT RPGSGASQPVCPEGMHHVVLDGHLEAPSCPLAPRDPGPAAREVAPERTLPLRGAPWAQA FT PPGRQPSRGGSQAGPPHTDSSCLLTPPSTPLGPEPGDPDWPESGGPCGKALPERQRNGL FT SGLRGAAPEGDSAALAEESPPAPSSRSSSTEDFCYVFTVELERGPSGLGMGLIDGMHTH FT LGAPGLYIQTLLPGSPAAADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFL FT VAKSDVETAKKIHFRTPPL" FT CDS complement(join(4839009..4839114,4839261..4839400, FT 4839802..4839941,4841284..4841626,4843177..4843599)) FT /codon_start=1 FT /gene="FLJ10324" FT /product="unknown" FT /note="Homo sapiens, clone MGC:4795 IMAGE:3543951, mRNA, FT complete cds.; H_NH0160E17.1.2 This gene was based on FT gi(13436229)" FT /protein_id="AAS07560.1" FT /translation="MSHRVVGGNSEGMSPRVGPVTVARIPASCVHRAGDSGLNLLAPGF FT PHRWAGRPGEGGSFSCGHYGHPLSPAEDVLESYENPPPIVLPSDGFQVDLEANCLDDSI FT YQHLLYVRHFLWGLRSRASPGSPGRPGSGASQPVCPEGMHHVVLDGHLEAPSCPLAPRD FT PGPAAREVAPERTLPLRGAPWAQAPPGRQPSRGGSQAGPPHTDSSCLLTPPSTPLGPEP FT GDPDWPESGGPCGKALPERQRNGLSGLRGAAPEGDSAALAEESPPAPSSRSSSTEDFCY FT VFTVELERGPSGLGMGLIDGMHTHLGAPGLYIQTLLPGSPAAADGRLSLGDRILEVNGS FT SLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHFRTPPL" FT repeat_region 4839882..4840018 FT /rpt_family="L1" FT repeat_region 4840642..4840899 FT /rpt_family="(CA)n" FT repeat_region 4844136..4844417 FT /rpt_family="Alu" FT repeat_region 4844445..4844746 FT /rpt_family="Alu" FT repeat_region 4845777..4846117 FT /rpt_family="Alu" FT repeat_region 4846208..4846623 FT /rpt_family="L1" FT repeat_region 4847091..4847361 FT /rpt_family="(TCTCCC)n" FT repeat_region 4847363..4847793 FT /rpt_family="CT-rich" FT repeat_region 4847794..4847887 FT /rpt_family="C-rich" FT repeat_region 4847919..4848073 FT /rpt_family="L1" FT repeat_region 4848074..4848244 FT /rpt_family="MER1_type" FT misc_feature 4848200..4849204 FT /note="CpG_island (%GC=68.5, o/e=0.85, #CpGs=87)" FT repeat_region 4848521..4848681 FT /rpt_family="C-rich" FT repeat_region 4849050..4849193 FT /rpt_family="L1" FT repeat_region 4849289..4849466 FT /rpt_family="Alu" FT repeat_region 4849483..4849783 FT /rpt_family="Alu" FT repeat_region 4849784..4850066 FT /rpt_family="Alu" FT repeat_region 4850107..4850460 FT /rpt_family="L1" FT repeat_region 4850485..4850789 FT /rpt_family="Alu" FT ncRNA complement(4850821..4850920) FT /gene="FLJ10324" FT /product="scRNA-hY3_RNA-related" FT /ncRNA_class="scRNA" FT repeat_region 4850821..4850920 FT /rpt_family="HY3" FT repeat_region 4850984..4851106 FT /rpt_family="L1" FT repeat_region 4851107..4851417 FT /rpt_family="Alu" FT repeat_region 4851418..4851504 FT /rpt_family="L1" FT repeat_region 4851505..4851811 FT /rpt_family="Alu" FT repeat_region 4851812..4852042 FT /rpt_family="L1" FT repeat_region 4852043..4852352 FT /rpt_family="Alu" FT repeat_region 4852353..4852615 FT /rpt_family="L1" FT repeat_region 4852702..4852731 FT /rpt_family="(TC)n" FT repeat_region 4852732..4852908 FT /rpt_family="Alu" FT repeat_region 4853454..4853578 FT /rpt_family="L1" FT repeat_region 4853579..4853710 FT /rpt_family="Alu" FT repeat_region 4853711..4853893 FT /rpt_family="L1" FT repeat_region 4853954..4854060 FT /rpt_family="Alu" FT repeat_region 4854241..4854738 FT /rpt_family="MaLR" FT misc_feature 4855991..4856212 FT /note="CpG_island (%GC=70.7, o/e=0.71, #CpGs=20)" FT misc_feature 4856859..4857166 FT /note="CpG_island (%GC=65.6, o/e=0.64, #CpGs=25)" FT repeat_region 4857233..4857252 FT /rpt_family="(CAGCC)n" FT repeat_region 4858542..4858672 FT /rpt_family="Alu" FT repeat_region 4858692..4858989 FT /rpt_family="Alu" FT repeat_region 4861214..4861503 FT /rpt_family="Alu" FT repeat_region 4862662..4862793 FT /rpt_family="L1" FT repeat_region 4862805..4862947 FT /rpt_family="Alu" FT repeat_region 4862968..4863100 FT /rpt_family="Alu" FT repeat_region 4865175..4865223 FT /rpt_family="(GAAA)n" FT repeat_region 4865226..4865539 FT /rpt_family="Alu" FT repeat_region 4865592..4865850 FT /rpt_family="Alu" FT repeat_region 4865994..4866081 FT /rpt_family="L1" FT repeat_region 4866082..4866387 FT /rpt_family="Alu" FT repeat_region 4866388..4866714 FT /rpt_family="L1" FT repeat_region 4866715..4867007 FT /rpt_family="Alu" FT misc_feature 4866910..4867298 FT /note="CpG_island (%GC=58.4, o/e=0.74, #CpGs=25)" FT repeat_region 4867009..4867321 FT /rpt_family="Alu" FT repeat_region 4867322..4867526 FT /rpt_family="L1" FT repeat_region 4867527..4867553 FT /rpt_family="(CAAA)n" FT repeat_region 4867566..4867806 FT /rpt_family="L1" FT repeat_region 4867807..4868101 FT /rpt_family="Alu" FT repeat_region 4868108..4868201 FT /rpt_family="L1" FT repeat_region 4869201..4869561 FT /rpt_family="MaLR" FT repeat_region 4870202..4870226 FT /rpt_family="L1" FT repeat_region 4870227..4870363 FT /rpt_family="Alu" FT repeat_region 4870364..4870672 FT /rpt_family="Alu" FT repeat_region 4870673..4870844 FT /rpt_family="Alu" FT repeat_region 4870845..4871181 FT /rpt_family="L1" FT repeat_region 4871209..4871228 FT /rpt_family="(A)n" FT repeat_region 4871229..4871504 FT /rpt_family="Alu" FT repeat_region 4871505..4871537 FT /rpt_family="(CAAAA)n" FT repeat_region 4872088..4872397 FT /rpt_family="Alu" FT repeat_region 4872654..4872711 FT /rpt_family="MIR" FT repeat_region 4872796..4872947 FT /rpt_family="MIR" FT repeat_region 4873509..4873694 FT /rpt_family="MER1_type" FT misc_feature 4874105..4875095 FT /note="CpG_island (%GC=69.6, o/e=0.65, #CpGs=75)" FT misc_feature 4876025..4876229 FT /note="CpG_island (%GC=75.1, o/e=0.85, #CpGs=22)" FT repeat_region 4876287..4876582 FT /rpt_family="Alu" FT repeat_region 4877169..4877346 FT /rpt_family="(CA)n" FT repeat_region 4878555..4878608 FT /rpt_family="(CATG)n" FT repeat_region 4878864..4879053 FT /rpt_family="L1" FT repeat_region 4879201..4879237 FT /rpt_family="AT_rich" FT repeat_region 4879387..4879678 FT /rpt_family="Alu" FT repeat_region 4880318..4880626 FT /rpt_family="Alu" FT repeat_region 4881418..4881701 FT /rpt_family="Alu" FT repeat_region 4882494..4882625 FT /rpt_family="Alu" FT repeat_region 4882635..4882943 FT /rpt_family="Alu" FT repeat_region 4883261..4883563 FT /rpt_family="Alu" FT repeat_region 4883676..4883796 FT /rpt_family="L1" FT repeat_region 4883797..4884101 FT /rpt_family="Alu" FT repeat_region 4884102..4884232 FT /rpt_family="L1" FT repeat_region 4884238..4884534 FT /rpt_family="Alu" FT repeat_region 4884576..4884642 FT /rpt_family="ERV1" FT repeat_region 4884769..4885055 FT /rpt_family="Alu" FT repeat_region 4885127..4885299 FT /rpt_family="L1" FT repeat_region 4885750..4886075 FT /rpt_family="Alu" FT repeat_region 4886175..4886477 FT /rpt_family="Alu" FT repeat_region 4886493..4886669 FT /rpt_family="L1" FT repeat_region 4886670..4886972 FT /rpt_family="Alu" FT repeat_region 4886973..4887544 FT /rpt_family="L1" FT repeat_region 4887545..4887862 FT /rpt_family="Alu" FT repeat_region 4887863..4887994 FT /rpt_family="L1" FT repeat_region 4888048..4888487 FT /rpt_family="L1" FT repeat_region 4888488..4888797 FT /rpt_family="Alu" FT repeat_region 4888798..4888955 FT /rpt_family="L1" FT repeat_region 4889034..4889132 FT /rpt_family="Tc2" FT repeat_region 4889236..4889603 FT /rpt_family="Tc2" FT repeat_region 4889848..4889869 FT /rpt_family="(A)n" FT repeat_region 4889963..4890549 FT /rpt_family="MaLR" FT repeat_region 4890551..4890858 FT /rpt_family="Alu" FT repeat_region 4890869..4892074 FT /rpt_family="MaLR" FT repeat_region 4892077..4892289 FT /rpt_family="Alu" FT repeat_region 4892299..4892473 FT /rpt_family="Alu" FT repeat_region 4892474..4892783 FT /rpt_family="MaLR" FT repeat_region 4892784..4893088 FT /rpt_family="MaLR" FT repeat_region 4893092..4893392 FT /rpt_family="Alu" FT repeat_region 4893455..4893876 FT /rpt_family="MaLR" FT repeat_region 4894043..4894354 FT /rpt_family="Alu" FT repeat_region 4894414..4894882 FT /rpt_family="L1" FT repeat_region 4895062..4895424 FT /rpt_family="L1" FT repeat_region 4895425..4895739 FT /rpt_family="Alu" FT repeat_region 4895740..4896040 FT /rpt_family="Alu" FT repeat_region 4896041..4896252 FT /rpt_family="L1" FT repeat_region 4896231..4896431 FT /rpt_family="L1" FT repeat_region 4896484..4896636 FT /rpt_family="MER1_type" FT repeat_region 4896648..4897188 FT /rpt_family="L1" FT repeat_region 4898815..4899112 FT /rpt_family="L1" FT gene complement(4899516..4901546) FT /gene="PAPOLB" FT mRNA complement(4899516..4901546) FT /gene="PAPOLB" FT CDS complement(4899528..4901438) FT /codon_start=1 FT /gene="PAPOLB" FT /product="unknown" FT /note="Homo sapiens poly(A) polymerase beta (testis FT specific) (PAPOLB), mRNA.; H_NH0160E17.2 This gene was FT based on gi(9910477)" FT /protein_id="AAS07561.1" FT /translation="MPFPVTTQGPPQPAPPPNRYGVSSPISLAVPKETDCLLTQRLIET FT LRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESKSLPQSVIENVGGKIFTFGSYR FT LGVHTKGADIDALCVAPSHVDRSDFFTSFYAKLKLQEEVKDLRAVEEAFVPVIKLCFDG FT IEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRL FT TLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAVASTLVRKFFLVFSEWEW FT PNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSISTRMVMIEE FT FKQGLAITHEILLSKAEWSKLFEAPSFFQKYKHYIVLLASASTEKQHLEWVGLVESKIR FT ILVGSLEKNEFITLAHVNPQSFPAPKENPDMEEFRTMWVIGLGLKKPDNSEILSIDLTY FT DIQSFTDTVYRQAVNSKMFEMGMKITAMHLRRKELHQLLPHHVLQDKKAHSTEGRRLTD FT LNDSSFDLSAGCENSMSVPSSTSTMKTGPLISSSQGRNSPALAVMTASVANIQATEFSL FT QQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLI FT L" FT misc_feature 4901337..4901753 FT /note="CpG_island (%GC=71.7, o/e=0.88, #CpGs=51)" FT repeat_region 4902250..4902557 FT /rpt_family="Alu" FT repeat_region 4902576..4903730 FT /rpt_family="L1" FT repeat_region 4903735..4904876 FT /rpt_family="L2" FT repeat_region 4904894..4904991 FT /rpt_family="MER2_type" FT repeat_region 4905470..4905724 FT /rpt_family="MER2_type" FT repeat_region 4905750..4905789 FT /rpt_family="(TG)n" FT repeat_region 4905790..4905945 FT /rpt_family="Alu" FT repeat_region 4905981..4906081 FT /rpt_family="L2" FT repeat_region 4906367..4906806 FT /rpt_family="MaLR" FT repeat_region 4906887..4907126 FT /rpt_family="L1" FT repeat_region 4907130..4907246 FT /rpt_family="Alu" FT repeat_region 4907253..4907286 FT /rpt_family="(TAAA)n" FT repeat_region 4907700..4907992 FT /rpt_family="Alu" FT repeat_region 4908238..4908475 FT /rpt_family="L1" FT repeat_region 4908476..4908781 FT /rpt_family="Alu" FT repeat_region 4908783..4909063 FT /rpt_family="Alu" FT repeat_region 4909064..4909453 FT /rpt_family="L1" FT repeat_region 4909480..4909803 FT /rpt_family="Alu" FT repeat_region 4910064..4910374 FT /rpt_family="Alu" FT repeat_region 4911409..4911451 FT /rpt_family="L2" FT repeat_region 4911822..4911906 FT /rpt_family="MER1_type" FT repeat_region 4912577..4912863 FT /rpt_family="Alu" FT repeat_region 4912965..4913009 FT /rpt_family="(CA)n" FT repeat_region 4914407..4914541 FT /rpt_family="Alu" FT repeat_region 4914542..4914870 FT /rpt_family="Alu" FT misc_feature 4914545..4914772 FT /note="CpG_island (%GC=61.8, o/e=0.82, #CpGs=18)" FT repeat_region 4914871..4915039 FT /rpt_family="Alu" FT repeat_region 4915553..4915623 FT /rpt_family="MER1_type" FT repeat_region 4915627..4915919 FT /rpt_family="Alu" FT repeat_region 4915923..4916231 FT /rpt_family="Alu" FT repeat_region 4916828..4917082 FT /rpt_family="Alu" FT repeat_region 4917901..4918174 FT /rpt_family="Alu" FT repeat_region 4920483..4920761 FT /rpt_family="Alu" FT repeat_region 4920765..4921073 FT /rpt_family="Alu" FT repeat_region 4921076..4921389 FT /rpt_family="Alu" FT repeat_region 4921432..4921518 FT /rpt_family="AcHobo" FT misc_feature 4922708..4923576 FT /note="CpG_island (%GC=76.4, o/e=0.85, #CpGs=103)" FT repeat_region 4923854..4923922 FT /rpt_family="L2" FT repeat_region 4924203..4924294 FT /rpt_family="MIR" FT repeat_region 4924297..4924507 FT /rpt_family="ERV1" FT repeat_region 4924508..4924817 FT /rpt_family="Alu" FT repeat_region 4924818..4924869 FT /rpt_family="ERV1" FT repeat_region 4924872..4924913 FT /rpt_family="MIR" FT repeat_region 4925161..4925344 FT /rpt_family="MER1_type" FT repeat_region 4925456..4925865 FT /rpt_family="MaLR" FT repeat_region 4925932..4926220 FT /rpt_family="Alu" FT repeat_region 4926267..4926460 FT /rpt_family="MaLR" FT repeat_region 4926460..4926622 FT /rpt_family="MaLR" FT repeat_region 4926623..4926915 FT /rpt_family="Alu" FT repeat_region 4926916..4926989 FT /rpt_family="MaLR" FT repeat_region 4927436..4927525 FT /rpt_family="(TA)n" FT repeat_region 4927552..4927824 FT /rpt_family="Alu" FT repeat_region 4927826..4927993 FT /rpt_family="L2" FT repeat_region 4928468..4928752 FT /rpt_family="Alu" FT repeat_region 4928753..4928954 FT /rpt_family="L1" FT repeat_region 4929251..4929562 FT /rpt_family="Alu" FT repeat_region 4929736..4930015 FT /rpt_family="Alu" FT repeat_region 4930050..4930413 FT /rpt_family="ERV1" FT repeat_region 4930414..4930709 FT /rpt_family="Alu" FT repeat_region 4930710..4930780 FT /rpt_family="ERV1" FT repeat_region 4930771..4930828 FT /rpt_family="ERV1" FT repeat_region 4930829..4931127 FT /rpt_family="Alu" FT repeat_region 4931128..4931148 FT /rpt_family="ERV1" FT repeat_region 4931149..4931324 FT /rpt_family="(TCTA)n" FT repeat_region 4931325..4931346 FT /rpt_family="ERV1" FT repeat_region 4931347..4931525 FT /rpt_family="(TCTA)n" FT repeat_region 4931526..4931768 FT /rpt_family="ERV1" FT repeat_region 4931771..4931919 FT /rpt_family="L1" FT repeat_region 4931937..4932259 FT /rpt_family="Alu" FT repeat_region 4932348..4932644 FT /rpt_family="Alu" FT repeat_region 4932650..4932810 FT /rpt_family="MaLR" FT repeat_region 4932811..4932978 FT /rpt_family="ERV1" FT repeat_region 4932979..4933320 FT /rpt_family="Alu" FT repeat_region 4933321..4933766 FT /rpt_family="ERV1" FT repeat_region 4933767..4933919 FT /rpt_family="MaLR" FT repeat_region 4933994..4934208 FT /rpt_family="ERVL" FT repeat_region 4934212..4934421 FT /rpt_family="ERV1" FT repeat_region 4934420..4934711 FT /rpt_family="ERV1" FT repeat_region 4934712..4935006 FT /rpt_family="Alu" FT repeat_region 4935007..4935155 FT /rpt_family="ERV1" FT repeat_region 4935161..4935464 FT /rpt_family="Alu" FT repeat_region 4935489..4935776 FT /rpt_family="ERVL" FT repeat_region 4935831..4936135 FT /rpt_family="Alu" FT repeat_region 4936136..4936365 FT /rpt_family="MaLR" FT repeat_region 4936441..4936483 FT /rpt_family="L1" FT repeat_region 4936484..4936790 FT /rpt_family="Alu" FT repeat_region 4936791..4936840 FT /rpt_family="L1" FT repeat_region 4936859..4936879 FT /rpt_family="(A)n" FT repeat_region 4937364..4937668 FT /rpt_family="Alu" FT repeat_region 4938029..4938129 FT /rpt_family="MER1_type" FT repeat_region 4938130..4938165 FT /rpt_family="(ATAGG)n" FT repeat_region 4938176..4938245 FT /rpt_family="MaLR" FT repeat_region 4938246..4938559 FT /rpt_family="Alu" FT repeat_region 4938560..4938636 FT /rpt_family="(GGAA)n" FT repeat_region 4938637..4938922 FT /rpt_family="MaLR" FT repeat_region 4938925..4938951 FT /rpt_family="(ATAGG)n" FT repeat_region 4939019..4939325 FT /rpt_family="Alu" FT repeat_region 4939327..4939380 FT /rpt_family="MER1_type" FT repeat_region 4939663..4939839 FT /rpt_family="Alu" FT repeat_region 4939843..4939912 FT /rpt_family="Alu" FT repeat_region 4940070..4940162 FT /rpt_family="MER1_type" FT repeat_region 4940489..4940779 FT /rpt_family="Alu" FT repeat_region 4940790..4941098 FT /rpt_family="Alu" FT repeat_region 4941145..4941288 FT /rpt_family="MIR" FT repeat_region 4941429..4941571 FT /rpt_family="MER1_type" FT repeat_region 4941579..4941878 FT /rpt_family="Alu" FT repeat_region 4941883..4941910 FT /rpt_family="AT_rich" FT repeat_region 4941975..4942129 FT /rpt_family="MIR" FT repeat_region 4942597..4942888 FT /rpt_family="Alu" FT repeat_region 4943572..4943862 FT /rpt_family="Alu" FT repeat_region 4944277..4944452 FT /rpt_family="MIR" FT repeat_region 4944435..4944790 FT /rpt_family="L2" FT repeat_region 4944522..4944733 FT /rpt_family="L2" FT repeat_region 4944857..4945034 FT /rpt_family="GA-rich" FT repeat_region 4945051..4945133 FT /rpt_family="GA-rich" FT repeat_region 4945510..4945563 FT /rpt_family="(CA)n" FT repeat_region 4946413..4946543 FT /rpt_family="MER1_type" FT repeat_region 4947445..4947740 FT /rpt_family="Alu" FT repeat_region 4947774..4948072 FT /rpt_family="Alu" FT repeat_region 4948101..4948241 FT /rpt_family="L1" FT repeat_region 4948249..4948545 FT /rpt_family="Alu" FT repeat_region 4948556..4948672 FT /rpt_family="L1" FT repeat_region 4948839..4948959 FT /rpt_family="Alu" FT repeat_region 4949012..4949077 FT /rpt_family="Alu" FT repeat_region 4949081..4949365 FT /rpt_family="Alu" FT repeat_region 4949374..4949466 FT /rpt_family="MIR" FT repeat_region 4949764..4949837 FT /rpt_family="MIR" FT repeat_region 4949838..4950001 FT /rpt_family="MER1_type" FT repeat_region 4950002..4950039 FT /rpt_family="MIR" FT repeat_region 4950255..4950570 FT /rpt_family="Alu" FT repeat_region 4951225..4951577 FT /rpt_family="Alu" FT repeat_region 4951619..4951773 FT /rpt_family="Alu" FT repeat_region 4951908..4952206 FT /rpt_family="Alu" FT repeat_region 4952333..4952633 FT /rpt_family="Alu" FT repeat_region 4952706..4953066 FT /rpt_family="L1" FT repeat_region 4953067..4953376 FT /rpt_family="Alu" FT repeat_region 4953377..4953388 FT /rpt_family="L1" FT repeat_region 4953389..4953590 FT /rpt_family="Alu" FT repeat_region 4953591..4953618 FT /rpt_family="L1" FT repeat_region 4953620..4953773 FT /rpt_family="Alu" FT repeat_region 4953775..4954040 FT /rpt_family="L1" FT repeat_region 4954160..4954244 FT /rpt_family="L2" FT repeat_region 4954280..4954589 FT /rpt_family="Alu" FT repeat_region 4954630..4954920 FT /rpt_family="Alu" FT repeat_region 4954930..4954952 FT /rpt_family="AT_rich" FT repeat_region 4954953..4955080 FT /rpt_family="L1" FT repeat_region 4955093..4955396 FT /rpt_family="Alu" FT repeat_region 4956003..4956313 FT /rpt_family="Alu" FT repeat_region 4956420..4956711 FT /rpt_family="Alu" FT repeat_region 4956773..4957008 FT /rpt_family="MIR" FT repeat_region 4957011..4957369 FT /rpt_family="Alu" FT repeat_region 4957438..4957905 FT /rpt_family="MaLR" FT repeat_region 4958103..4958418 FT /rpt_family="Alu" FT repeat_region 4958447..4958750 FT /rpt_family="Alu" FT repeat_region 4958918..4959231 FT /rpt_family="Alu" FT repeat_region 4959235..4959555 FT /rpt_family="Alu" FT repeat_region 4960064..4960136 FT /rpt_family="MER1_type" FT repeat_region 4960137..4960195 FT /rpt_family="CT-rich" FT repeat_region 4960200..4960299 FT /rpt_family="L1" FT repeat_region 4960300..4960369 FT /rpt_family="CT-rich" FT repeat_region 4960377..4960647 FT /rpt_family="Alu" FT repeat_region 4960661..4960712 FT /rpt_family="MER1_type" FT repeat_region 4960970..4961271 FT /rpt_family="Alu" FT repeat_region 4961574..4961869 FT /rpt_family="Alu" FT repeat_region 4961919..4962088 FT /rpt_family="Alu" FT repeat_region 4962097..4962117 FT /rpt_family="AT_rich" FT repeat_region 4962214..4962369 FT /rpt_family="Alu" FT repeat_region 4962733..4963034 FT /rpt_family="Alu" FT repeat_region 4963122..4963204 FT /rpt_family="MIR" FT repeat_region 4963281..4963349 FT /rpt_family="MIR" FT repeat_region 4963356..4963498 FT /rpt_family="L2" FT repeat_region 4963499..4963549 FT /rpt_family="Alu" FT repeat_region 4963550..4963864 FT /rpt_family="Alu" FT repeat_region 4964096..4964190 FT /rpt_family="L2" FT repeat_region 4964274..4964485 FT /rpt_family="L2" FT repeat_region 4964557..4964861 FT /rpt_family="Alu" FT repeat_region 4965271..4965337 FT /rpt_family="CT-rich" FT repeat_region 4965445..4965736 FT /rpt_family="Alu" FT repeat_region 4965737..4966024 FT /rpt_family="Alu" FT repeat_region 4966050..4966364 FT /rpt_family="L1" FT repeat_region 4966365..4966674 FT /rpt_family="Alu" FT repeat_region 4966675..4966862 FT /rpt_family="L1" FT repeat_region 4966760..4966862 FT /rpt_family="L1" FT repeat_region 4966894..4967176 FT /rpt_family="Alu" FT repeat_region 4967180..4967331 FT /rpt_family="Alu" FT repeat_region 4967337..4967374 FT /rpt_family="A-rich" FT repeat_region 4967416..4967506 FT /rpt_family="MIR" FT repeat_region 4968015..4968059 FT /rpt_family="L2" FT repeat_region 4968223..4968274 FT /rpt_family="L2" FT repeat_region 4968458..4968509 FT /rpt_family="L2" FT repeat_region 4969127..4969147 FT /rpt_family="(TTTG)n" FT repeat_region 4969164..4969453 FT /rpt_family="Alu" FT repeat_region 4969496..4969618 FT /rpt_family="MaLR" FT repeat_region 4969619..4969922 FT /rpt_family="Alu" FT repeat_region 4969923..4969988 FT /rpt_family="MaLR" FT repeat_region 4969989..4970293 FT /rpt_family="Alu" FT repeat_region 4970294..4970379 FT /rpt_family="MaLR" FT repeat_region 4970468..4970781 FT /rpt_family="Alu" FT repeat_region 4970782..4971083 FT /rpt_family="Alu" FT repeat_region 4971092..4971275 FT /rpt_family="Alu" FT repeat_region 4971276..4971495 FT /rpt_family="Alu" FT repeat_region 4972042..4972255 FT /rpt_family="L1" FT repeat_region 4972256..4972555 FT /rpt_family="Alu" FT repeat_region 4972556..4972616 FT /rpt_family="L1" FT repeat_region 4972728..4973004 FT /rpt_family="Alu" FT repeat_region 4973129..4973266 FT /rpt_family="L1" FT repeat_region 4973276..4973563 FT /rpt_family="Alu" FT repeat_region 4973572..4973860 FT /rpt_family="Alu" FT repeat_region 4973881..4974032 FT /rpt_family="Alu" FT repeat_region 4974368..4974526 FT /rpt_family="MIR" FT repeat_region 4974535..4974834 FT /rpt_family="Alu" FT repeat_region 4974836..4974996 FT /rpt_family="Alu" FT repeat_region 4974997..4975080 FT /rpt_family="MER1_type" FT repeat_region 4975081..4975101 FT /rpt_family="AT_rich" FT repeat_region 4975114..4975337 FT /rpt_family="Alu" FT repeat_region 4975378..4975531 FT /rpt_family="L1" FT repeat_region 4975534..4975842 FT /rpt_family="Alu" FT repeat_region 4975864..4976081 FT /rpt_family="L1" FT repeat_region 4976201..4976323 FT /rpt_family="Alu" FT repeat_region 4976367..4976666 FT /rpt_family="Alu" FT repeat_region 4976685..4976738 FT /rpt_family="MaLR" FT repeat_region 4976747..4977101 FT /rpt_family="Alu" FT repeat_region 4977124..4977440 FT /rpt_family="Alu" FT repeat_region 4977441..4977579 FT /rpt_family="Alu" FT repeat_region 4977597..4977939 FT /rpt_family="Alu" FT repeat_region 4977944..4978275 FT /rpt_family="MaLR" FT repeat_region 4978557..4978856 FT /rpt_family="Alu" FT repeat_region 4978895..4979187 FT /rpt_family="Alu" FT repeat_region 4979192..4979361 FT /rpt_family="L1" FT repeat_region 4979362..4979672 FT /rpt_family="Alu" FT repeat_region 4979673..4979832 FT /rpt_family="L1" FT repeat_region 4980979..4981276 FT /rpt_family="Alu" FT repeat_region 4981331..4981413 FT /rpt_family="L1" FT repeat_region 4981582..4981883 FT /rpt_family="Alu" FT repeat_region 4981888..4982197 FT /rpt_family="Alu" FT repeat_region 4982249..4982546 FT /rpt_family="Alu" FT repeat_region 4982631..4982939 FT /rpt_family="Alu" FT repeat_region 4982943..4983073 FT /rpt_family="Alu" FT repeat_region 4983245..4983346 FT /rpt_family="MIR" FT repeat_region 4983427..4983726 FT /rpt_family="Alu" FT repeat_region 4983730..4983905 FT /rpt_family="Alu" FT repeat_region 4984265..4984362 FT /rpt_family="MaLR" FT repeat_region 4984368..4984388 FT /rpt_family="CT-rich" FT repeat_region 4984389..4984620 FT /rpt_family="Alu" FT repeat_region 4984621..4984705 FT /rpt_family="CT-rich" FT repeat_region 4984771..4984881 FT /rpt_family="L1" FT repeat_region 4984882..4984894 FT /rpt_family="CT-rich" FT repeat_region 4984895..4985196 FT /rpt_family="Alu" FT repeat_region 4985197..4985219 FT /rpt_family="CT-rich" FT repeat_region 4985220..4985505 FT /rpt_family="Alu" FT repeat_region 4985506..4985523 FT /rpt_family="CT-rich" FT repeat_region 4985693..4985871 FT /rpt_family="(CA)n" FT repeat_region 4986119..4986245 FT /rpt_family="L1" FT repeat_region 4986361..4986503 FT /rpt_family="Alu" FT repeat_region 4986504..4986556 FT /rpt_family="MaLR" FT repeat_region 4986557..4986864 FT /rpt_family="Alu" FT repeat_region 4986865..4987029 FT /rpt_family="MaLR" FT repeat_region 4987030..4987323 FT /rpt_family="Alu" FT repeat_region 4987324..4987628 FT /rpt_family="Alu" FT repeat_region 4987629..4987817 FT /rpt_family="MaLR" FT repeat_region 4987831..4987875 FT /rpt_family="MaLR" FT repeat_region 4987876..4988175 FT /rpt_family="Alu" FT repeat_region 4988176..4988424 FT /rpt_family="MaLR" FT repeat_region 4988483..4988627 FT /rpt_family="Alu" FT repeat_region 4988646..4988846 FT /rpt_family="Alu" FT repeat_region 4988855..4989150 FT /rpt_family="L1" FT repeat_region 4989151..4989432 FT /rpt_family="Alu" FT repeat_region 4989433..4989465 FT /rpt_family="L1" FT repeat_region 4989618..4989710 FT /rpt_family="L1" FT repeat_region 4989711..4989747 FT /rpt_family="(TG)n" FT repeat_region 4989749..4990028 FT /rpt_family="Alu" FT repeat_region 4990029..4990331 FT /rpt_family="L1" FT repeat_region 4990332..4990643 FT /rpt_family="Alu" FT repeat_region 4990644..4990656 FT /rpt_family="L1" FT repeat_region 4991095..4991183 FT /rpt_family="L2" FT repeat_region 4991248..4991530 FT /rpt_family="Alu" FT repeat_region 4991543..4991666 FT /rpt_family="Alu" FT repeat_region 4992246..4992320 FT /rpt_family="MER1_type" FT repeat_region 4992321..4992607 FT /rpt_family="Alu" FT repeat_region 4992608..4992646 FT /rpt_family="(TTTG)n" FT repeat_region 4992648..4992748 FT /rpt_family="Alu" FT repeat_region 4992837..4992910 FT /rpt_family="L2" FT repeat_region 4992917..4993106 FT /rpt_family="AcHobo" FT repeat_region 4993107..4993401 FT /rpt_family="Alu" FT repeat_region 4993402..4993497 FT /rpt_family="AcHobo" FT repeat_region 4993503..4993760 FT /rpt_family="Alu" FT repeat_region 4993789..4994049 FT /rpt_family="L1" FT repeat_region 4994050..4994349 FT /rpt_family="Alu" FT repeat_region 4994350..4994670 FT /rpt_family="L1" FT repeat_region 4994671..4994786 FT /rpt_family="Alu" FT repeat_region 4994787..4994902 FT /rpt_family="L1" FT repeat_region 4995095..4995341 FT /rpt_family="MER1_type" FT repeat_region 4995378..4995401 FT /rpt_family="MER1_type" FT repeat_region 4995402..4995705 FT /rpt_family="Alu" FT repeat_region 4995706..4995745 FT /rpt_family="MER1_type" FT repeat_region 4995772..4996070 FT /rpt_family="Alu" FT repeat_region 4996298..4996405 FT /rpt_family="MIR" FT repeat_region 4996549..4996805 FT /rpt_family="Alu" FT repeat_region 4996817..4996997 FT /rpt_family="Alu" FT repeat_region 4996998..4997295 FT /rpt_family="Alu" FT misc_feature 4998217..4999110 FT /note="CpG_island (%GC=73.6, o/e=0.86, #CpGs=102)" FT repeat_region 4998252..4998405 FT /rpt_family="MIR" FT repeat_region 4998538..4998563 FT /rpt_family="GC_rich" FT repeat_region 4998852..4998893 FT /rpt_family="GC_rich" FT repeat_region 4998953..4999041 FT /rpt_family="G-rich" FT repeat_region 4999238..4999667 FT /rpt_family="G-rich" FT repeat_region 4999679..4999863 FT /rpt_family="G-rich" FT repeat_region 5000620..5000902 FT /rpt_family="Alu" FT repeat_region 5001108..5001198 FT /rpt_family="Alu" FT repeat_region 5001201..5001354 FT /rpt_family="Alu" FT repeat_region 5001369..5001445 FT /rpt_family="ERVL" FT repeat_region 5001468..5001525 FT /rpt_family="(TCTA)n" FT repeat_region 5001556..5001840 FT /rpt_family="Alu" FT repeat_region 5001842..5002155 FT /rpt_family="Alu" FT repeat_region 5002156..5002207 FT /rpt_family="(GGA)n" FT repeat_region 5002383..5002481 FT /rpt_family="MIR" FT repeat_region 5003451..5003733 FT /rpt_family="Alu" FT repeat_region 5003740..5004051 FT /rpt_family="Alu" FT repeat_region 5004052..5004443 FT /rpt_family="ERV1" FT repeat_region 5004497..5004632 FT /rpt_family="L2" FT repeat_region 5004649..5004779 FT /rpt_family="Alu" FT repeat_region 5004780..5005092 FT /rpt_family="Alu" FT repeat_region 5005187..5005475 FT /rpt_family="Alu" FT repeat_region 5005614..5005899 FT /rpt_family="ERV1" FT repeat_region 5005900..5006213 FT /rpt_family="Alu" FT repeat_region 5006214..5006384 FT /rpt_family="ERV1" FT repeat_region 5006386..5006691 FT /rpt_family="Alu" FT repeat_region 5006744..5007034 FT /rpt_family="Alu" FT repeat_region 5007035..5007064 FT /rpt_family="AT_rich" FT repeat_region 5007065..5007372 FT /rpt_family="Alu" FT repeat_region 5007374..5007545 FT /rpt_family="(TA)n" FT repeat_region 5007546..5007813 FT /rpt_family="Alu" FT repeat_region 5007833..5008135 FT /rpt_family="Alu" FT repeat_region 5008149..5008355 FT /rpt_family="ERVL" FT repeat_region 5008356..5008663 FT /rpt_family="Alu" FT repeat_region 5008693..5008939 FT /rpt_family="Alu" FT repeat_region 5008940..5009041 FT /rpt_family="(GGGAA)n" FT repeat_region 5009080..5009254 FT /rpt_family="L1" FT repeat_region 5009255..5009550 FT /rpt_family="Alu" FT repeat_region 5009551..5010002 FT /rpt_family="L1" FT repeat_region 5010003..5010296 FT /rpt_family="Alu" FT repeat_region 5010297..5010367 FT /rpt_family="L1" FT repeat_region 5010381..5010396 FT /rpt_family="Alu" FT repeat_region 5010397..5010733 FT /rpt_family="Alu" FT repeat_region 5010734..5010895 FT /rpt_family="Alu" FT repeat_region 5010927..5011127 FT /rpt_family="L1" FT repeat_region 5011130..5011162 FT /rpt_family="(T)n" FT repeat_region 5011662..5011960 FT /rpt_family="Alu" FT repeat_region 5011963..5012244 FT /rpt_family="Alu" FT repeat_region 5012272..5012577 FT /rpt_family="Alu" FT repeat_region 5012750..5012829 FT /rpt_family="MIR" FT repeat_region 5012835..5012941 FT /rpt_family="Alu" FT repeat_region 5012942..5013252 FT /rpt_family="Alu" FT repeat_region 5013277..5013344 FT /rpt_family="L2" FT misc_feature 5013509..5014436 FT /note="CpG_island (%GC=72.7, o/e=0.87, #CpGs=114)" FT repeat_region 5013879..5013904 FT /rpt_family="(CGGGGG)n" FT repeat_region 5014534..5014843 FT /rpt_family="Alu" FT repeat_region 5014845..5014883 FT /rpt_family="AT_rich" FT repeat_region 5014941..5015273 FT /rpt_family="L1" FT repeat_region 5015274..5015570 FT /rpt_family="Alu" FT repeat_region 5015571..5015695 FT /rpt_family="L1" FT repeat_region 5016529..5016824 FT /rpt_family="Alu" FT repeat_region 5016843..5017019 FT /rpt_family="Alu" FT repeat_region 5017130..5017427 FT /rpt_family="Alu" FT repeat_region 5017582..5017634 FT /rpt_family="MER1_type" FT repeat_region 5017675..5017704 FT /rpt_family="(TTTA)n" FT repeat_region 5017707..5017988 FT /rpt_family="Alu" FT repeat_region 5018155..5018498 FT /rpt_family="L1" FT repeat_region 5018624..5018914 FT /rpt_family="Alu" FT repeat_region 5018921..5019124 FT /rpt_family="Alu" FT repeat_region 5019317..5019432 FT /rpt_family="L1" FT repeat_region 5019436..5019677 FT /rpt_family="L1" FT repeat_region 5019828..5019891 FT /rpt_family="L1" FT repeat_region 5020935..5021242 FT /rpt_family="Alu" FT repeat_region 5023454..5023482 FT /rpt_family="(TTG)n" FT repeat_region 5023736..5023970 FT /rpt_family="L1" FT repeat_region 5024341..5024436 FT /rpt_family="MIR" FT repeat_region 5024957..5025052 FT /rpt_family="MIR" FT repeat_region 5025525..5025823 FT /rpt_family="Alu" FT repeat_region 5026351..5026373 FT /rpt_family="(CAT)n" FT repeat_region 5026376..5026665 FT /rpt_family="Alu" FT repeat_region 5026671..5026924 FT /rpt_family="L2" FT repeat_region 5027242..5027535 FT /rpt_family="Alu" FT repeat_region 5027828..5028118 FT /rpt_family="Alu" FT repeat_region 5028254..5028563 FT /rpt_family="Alu" FT repeat_region 5029650..5029872 FT /rpt_family="CR1" FT repeat_region 5029875..5029967 FT /rpt_family="CR1" FT repeat_region 5030459..5030765 FT /rpt_family="Alu" FT repeat_region 5030871..5031109 FT /rpt_family="MIR" FT repeat_region 5031171..5031366 FT /rpt_family="Alu" FT repeat_region 5031900..5031946 FT /rpt_family="MER1_type" FT repeat_region 5032062..5032376 FT /rpt_family="Alu" FT repeat_region 5032377..5032648 FT /rpt_family="Alu" FT repeat_region 5032655..5032748 FT /rpt_family="MIR" FT repeat_region 5032778..5033074 FT /rpt_family="Alu" FT repeat_region 5033078..5033165 FT /rpt_family="MIR" FT repeat_region 5033551..5033742 FT /rpt_family="MIR" FT repeat_region 5033753..5034044 FT /rpt_family="Alu" FT repeat_region 5034161..5034234 FT /rpt_family="Alu" FT repeat_region 5034257..5034354 FT /rpt_family="L2" FT repeat_region 5034493..5034548 FT /rpt_family="MIR" FT repeat_region 5034642..5034753 FT /rpt_family="MIR" FT repeat_region 5034805..5034936 FT /rpt_family="MIR" FT repeat_region 5035065..5035169 FT /rpt_family="L2" FT repeat_region 5036092..5036160 FT /rpt_family="MIR" FT repeat_region 5038327..5038478 FT /rpt_family="L2" FT repeat_region 5039235..5039328 FT /rpt_family="MIR" FT repeat_region 5039427..5039729 FT /rpt_family="Alu" FT repeat_region 5040263..5040433 FT /rpt_family="Alu" FT repeat_region 5040437..5040524 FT /rpt_family="(TTAAA)n" FT repeat_region 5040779..5040967 FT /rpt_family="L1" FT repeat_region 5040975..5041021 FT /rpt_family="CT-rich" FT repeat_region 5041058..5041405 FT /rpt_family="Alu" FT repeat_region 5041415..5041815 FT /rpt_family="L1" FT repeat_region 5041818..5042068 FT /rpt_family="L1" FT repeat_region 5042081..5042242 FT /rpt_family="L1" FT repeat_region 5042243..5042553 FT /rpt_family="Alu" FT repeat_region 5042554..5042566 FT /rpt_family="L1" FT repeat_region 5042584..5042620 FT /rpt_family="AT_rich" FT repeat_region 5042689..5042970 FT /rpt_family="Alu" FT repeat_region 5042971..5043075 FT /rpt_family="L1" FT repeat_region 5043493..5043805 FT /rpt_family="L1" FT repeat_region 5043806..5044060 FT /rpt_family="L1" FT repeat_region 5044061..5044177 FT /rpt_family="Alu" FT repeat_region 5044178..5044467 FT /rpt_family="L1" FT repeat_region 5044588..5044672 FT /rpt_family="MaLR" FT repeat_region 5045225..5045509 FT /rpt_family="Alu" FT repeat_region 5045510..5045623 FT /rpt_family="L1" FT repeat_region 5045843..5046140 FT /rpt_family="Alu" FT repeat_region 5046189..5046222 FT /rpt_family="AT_rich" FT repeat_region 5046365..5046471 FT /rpt_family="L1" FT repeat_region 5046472..5046765 FT /rpt_family="Alu" FT repeat_region 5046766..5046806 FT /rpt_family="L1" FT repeat_region 5046853..5047035 FT /rpt_family="L1" FT repeat_region 5047038..5047512 FT /rpt_family="L1" FT repeat_region 5047533..5047749 FT /rpt_family="L1" FT repeat_region 5047750..5048083 FT /rpt_family="L1" FT repeat_region 5048084..5048187 FT /rpt_family="L1" FT repeat_region 5048572..5048684 FT /rpt_family="Alu" FT repeat_region 5048687..5048740 FT /rpt_family="GA-rich" FT repeat_region 5048968..5049226 FT /rpt_family="Alu" FT repeat_region 5049251..5049500 FT /rpt_family="L1" FT repeat_region 5049500..5050380 FT /rpt_family="L1" FT repeat_region 5051091..5051178 FT /rpt_family="MIR" FT repeat_region 5051440..5051555 FT /rpt_family="MER1_type" FT repeat_region 5053233..5053544 FT /rpt_family="Alu" FT repeat_region 5053660..5053779 FT /rpt_family="MIR" FT repeat_region 5053964..5054385 FT /rpt_family="MaLR" FT repeat_region 5054532..5054812 FT /rpt_family="Alu" FT repeat_region 5055225..5055504 FT /rpt_family="Alu" FT repeat_region 5055550..5055932 FT /rpt_family="MaLR" FT repeat_region 5055954..5056007 FT /rpt_family="ERV1" FT repeat_region 5056008..5056062 FT /rpt_family="ERVL" FT repeat_region 5056109..5056225 FT /rpt_family="ERV1" FT repeat_region 5056279..5056579 FT /rpt_family="Alu" FT repeat_region 5056582..5056882 FT /rpt_family="Alu" FT repeat_region 5057423..5057730 FT /rpt_family="Alu" FT repeat_region 5058141..5058289 FT /rpt_family="MaLR" FT repeat_region 5058358..5058659 FT /rpt_family="Alu" FT repeat_region 5058693..5058873 FT /rpt_family="L1" FT repeat_region 5058883..5059374 FT /rpt_family="ERV1" FT repeat_region 5059375..5059681 FT /rpt_family="Alu" FT repeat_region 5059682..5059900 FT /rpt_family="ERV1" FT repeat_region 5059911..5060072 FT /rpt_family="Alu" FT repeat_region 5060133..5060364 FT /rpt_family="Alu" FT repeat_region 5060510..5060971 FT /rpt_family="ERV1" FT repeat_region 5061891..5062200 FT /rpt_family="Alu" FT repeat_region 5066726..5067515 FT /rpt_family="ERV1" FT repeat_region 5067494..5067891 FT /rpt_family="ERV1" FT repeat_region 5067892..5068347 FT /rpt_family="ERV1" FT repeat_region 5068348..5068624 FT /rpt_family="Alu" FT repeat_region 5068653..5068688 FT /rpt_family="AT_rich" FT repeat_region 5068698..5068798 FT /rpt_family="Alu" FT repeat_region 5069133..5069154 FT /rpt_family="AT_rich" FT repeat_region 5070906..5071108 FT /rpt_family="Alu" FT repeat_region 5071807..5071944 FT /rpt_family="Alu" FT repeat_region 5071945..5072217 FT /rpt_family="Alu" FT repeat_region 5072218..5072242 FT /rpt_family="(CAAT)n" FT repeat_region 5072243..5072407 FT /rpt_family="Alu" FT repeat_region 5073117..5073424 FT /rpt_family="Alu" FT repeat_region 5074163..5074450 FT /rpt_family="Alu" FT repeat_region 5074485..5074780 FT /rpt_family="Alu" FT repeat_region 5075404..5075741 FT /rpt_family="Alu" FT repeat_region 5075746..5075902 FT /rpt_family="Alu" FT repeat_region 5075956..5076072 FT /rpt_family="CR1" FT repeat_region 5076592..5076935 FT /rpt_family="Alu" FT repeat_region 5076994..5077297 FT /rpt_family="Alu" FT repeat_region 5078413..5078704 FT /rpt_family="Alu" FT repeat_region 5078770..5079068 FT /rpt_family="Alu" FT repeat_region 5079158..5079500 FT /rpt_family="CR1" FT repeat_region 5079501..5079797 FT /rpt_family="Alu" FT repeat_region 5079798..5079856 FT /rpt_family="CR1" FT repeat_region 5079952..5080102 FT /rpt_family="Alu" FT repeat_region 5080122..5080235 FT /rpt_family="MER1_type" FT repeat_region 5080347..5080659 FT /rpt_family="Alu" FT repeat_region 5081054..5081369 FT /rpt_family="Alu" FT repeat_region 5081390..5081568 FT /rpt_family="ERV1" FT repeat_region 5081569..5081870 FT /rpt_family="Alu" FT repeat_region 5081871..5082118 FT /rpt_family="ERV1" FT repeat_region 5082119..5082434 FT /rpt_family="Alu" FT repeat_region 5082435..5082531 FT /rpt_family="ERV1" FT repeat_region 5082532..5082826 FT /rpt_family="Alu" FT repeat_region 5082827..5082966 FT /rpt_family="ERV1" FT repeat_region 5082967..5083272 FT /rpt_family="Alu" FT repeat_region 5083419..5084058 FT /rpt_family="ERV1" FT repeat_region 5084059..5084316 FT /rpt_family="Alu" FT repeat_region 5084317..5084625 FT /rpt_family="ERV1" FT repeat_region 5084754..5085029 FT /rpt_family="Alu" FT misc_feature 5085412..5086342 FT /note="CpG_island (%GC=69.6, o/e=0.80, #CpGs=85)" FT gene 5085553..5106797 FT /gene="RBAK" FT mRNA join(5085553..5086027,5087664..5087722,5096926..5097052, FT 5097315..5097410,5103326..5106797) FT /gene="RBAK" FT repeat_region 5086410..5086568 FT /rpt_family="MIR" FT repeat_region 5086748..5087053 FT /rpt_family="Alu" FT repeat_region 5087233..5087450 FT /rpt_family="Alu" FT repeat_region 5087454..5087514 FT /rpt_family="Alu" FT CDS join(5087708..5087722,5096926..5097052,5097315..5097410, FT 5103326..5105232) FT /codon_start=1 FT /gene="RBAK" FT /product="unknown" FT /note="Homo sapiens RB-associated KRAB repressor (RBAK), FT mRNA.; H_NH0730B22.1" FT /protein_id="AAQ93364.1" FT /translation="MNTLQGPVSFKDVAVDFTQEEWQQLDPDEKITYRDVMLENYSHLV FT SVGYDTTKPNVIIKLEQGEEPWIMGGEFPCQHSPEAWRVDDLIERIQENEDKHSRQAAC FT INSKTLTEEKENTFSQIYMETSLVPSSIIAHNCVSCGKNLESISQLISSDGSYARTKPD FT ECNECGKTYHGEKMCEFNQNGDTYSHNEENILQKISILEKPFEYNECMEALDNEAVFIA FT HKRAYIGEKPYEWNDSGPDFIQMSNFNAYQRSQMEMKPFECSECGKSFCKKSKFIIHQR FT AHTGEKPYECNVCGKSFSQKGTLTVHRRSHLEEKPYKCNECGKTFCQKLHLTQHLRTHS FT GEKPYECSECGKTFCQKTHLTLHQRNHSGERPYPCNECGKSFSRKSALSDHQRTHTGEK FT LYKCNECGKSYYRKSTLITHQRTHTGEKPYQCSECGKFFSRVSYLTIHYRSHLEEKPYE FT CNECGKTFNLNSAFIRHRKVHTEEKSHECSECGKFSQLYLTDHHTAHLEEKPYECNECG FT KTFLVNSAFDGHQPLPKGEKSYECNVCGKLFNELSYYTEHYRSHSEEKPYGCSECGKTF FT SHNSSLFRHQRVHTGEKPYECYECGKFFSQKSYLTIHHRIHSGEKPYECSKCGKVFSRM FT SNLTVHYRSHSGEKPYECNECGKVFSQKSYLTVHYRTHSGEKPYECNECGKKFHHRSAF FT NSHQRIHRRGNMNVLDVENL" FT repeat_region 5087801..5088104 FT /rpt_family="Alu" FT repeat_region 5088294..5088677 FT /rpt_family="MaLR" FT repeat_region 5089109..5089286 FT /rpt_family="L2" FT repeat_region 5089344..5089649 FT /rpt_family="Alu" FT repeat_region 5089650..5089767 FT /rpt_family="Alu" FT repeat_region 5089903..5090211 FT /rpt_family="L1" FT repeat_region 5090212..5090501 FT /rpt_family="Alu" FT repeat_region 5090502..5090753 FT /rpt_family="L1" FT repeat_region 5090827..5091414 FT /rpt_family="L1" FT repeat_region 5091429..5092372 FT /rpt_family="L1" FT repeat_region 5092373..5092406 FT /rpt_family="(ATTG)n" FT repeat_region 5092407..5092690 FT /rpt_family="Alu" FT repeat_region 5092691..5093583 FT /rpt_family="L1" FT repeat_region 5093618..5093755 FT /rpt_family="L1" FT repeat_region 5093758..5094053 FT /rpt_family="Alu" FT repeat_region 5094078..5094127 FT /rpt_family="T-rich" FT repeat_region 5094136..5094194 FT /rpt_family="L1" FT repeat_region 5094235..5094363 FT /rpt_family="Alu" FT repeat_region 5094406..5094519 FT /rpt_family="L1" FT repeat_region 5094582..5094709 FT /rpt_family="Alu" FT repeat_region 5094878..5094920 FT /rpt_family="(TG)n" FT repeat_region 5095023..5095347 FT /rpt_family="L1" FT repeat_region 5095647..5095724 FT /rpt_family="Alu" FT repeat_region 5095730..5096048 FT /rpt_family="Alu" FT repeat_region 5096397..5096531 FT /rpt_family="L2" FT repeat_region 5096546..5096671 FT /rpt_family="L2" FT repeat_region 5096693..5096759 FT /rpt_family="(TA)n" FT repeat_region 5097694..5097721 FT /rpt_family="(TTTG)n" FT repeat_region 5097724..5098000 FT /rpt_family="Alu" FT repeat_region 5098308..5098395 FT /rpt_family="L2" FT repeat_region 5098913..5098963 FT /rpt_family="(TTCC)n" FT repeat_region 5098965..5099140 FT /rpt_family="Alu" FT repeat_region 5099143..5099240 FT /rpt_family="L1" FT repeat_region 5100734..5100972 FT /rpt_family="MIR" FT repeat_region 5101086..5101220 FT /rpt_family="Alu" FT repeat_region 5101247..5101540 FT /rpt_family="Alu" FT repeat_region 5101854..5102915 FT /rpt_family="ERVK" FT repeat_region 5103109..5103145 FT /rpt_family="(TG)n" FT repeat_region 5105466..5105491 FT /rpt_family="AT_rich" FT repeat_region 5106381..5106470 FT /rpt_family="MaLR" FT repeat_region 5106516..5106882 FT /rpt_family="L1" FT repeat_region 5106924..5107759 FT /rpt_family="L1" FT repeat_region 5107782..5107921 FT /rpt_family="MER1_type" FT repeat_region 5107982..5108783 FT /rpt_family="L1" FT repeat_region 5109428..5109451 FT /rpt_family="(T)n" FT repeat_region 5109468..5109766 FT /rpt_family="Alu" FT repeat_region 5110209..5110307 FT /rpt_family="Alu" FT repeat_region 5110327..5110628 FT /rpt_family="Alu" FT repeat_region 5110629..5110765 FT /rpt_family="Alu" FT repeat_region 5110988..5111256 FT /rpt_family="Alu" FT repeat_region 5111257..5111410 FT /rpt_family="L1" FT misc_feature 5111621..5112088 FT /note="CpG_island (%GC=69.4, o/e=0.69, #CpGs=37)" FT repeat_region 5112022..5112045 FT /rpt_family="(CTG)n" FT repeat_region 5112148..5112235 FT /rpt_family="G-rich" FT repeat_region 5113670..5113973 FT /rpt_family="Alu" FT repeat_region 5113975..5114294 FT /rpt_family="L1" FT repeat_region 5114295..5114592 FT /rpt_family="Alu" FT misc_feature 5114321..5114523 FT /note="CpG_island (%GC=60.1, o/e=0.89, #CpGs=16)" FT repeat_region 5114593..5114641 FT /rpt_family="L1" FT repeat_region 5114647..5114926 FT /rpt_family="Alu" FT repeat_region 5114933..5115088 FT /rpt_family="Alu" FT repeat_region 5115107..5115179 FT /rpt_family="L1" FT repeat_region 5115180..5115527 FT /rpt_family="MaLR" FT repeat_region 5115528..5115650 FT /rpt_family="L1" FT repeat_region 5116044..5116299 FT /rpt_family="ERVL" FT repeat_region 5116302..5116606 FT /rpt_family="Alu" FT repeat_region 5116625..5116764 FT /rpt_family="L1" FT repeat_region 5116765..5117073 FT /rpt_family="Alu" FT repeat_region 5117074..5117205 FT /rpt_family="L1" FT repeat_region 5117209..5117340 FT /rpt_family="Alu" FT repeat_region 5117804..5118107 FT /rpt_family="Alu" FT repeat_region 5118174..5118278 FT /rpt_family="Alu" FT repeat_region 5118297..5118727 FT /rpt_family="Alu" FT repeat_region 5118961..5119256 FT /rpt_family="Alu" FT repeat_region 5119272..5119546 FT /rpt_family="Alu" FT repeat_region 5119550..5119720 FT /rpt_family="Alu" FT repeat_region 5119725..5120014 FT /rpt_family="Alu" FT repeat_region 5120591..5120904 FT /rpt_family="Alu" FT repeat_region 5121007..5121290 FT /rpt_family="Alu" FT repeat_region 5121292..5121312 FT /rpt_family="AT_rich" FT repeat_region 5121574..5121898 FT /rpt_family="Alu" FT repeat_region 5122065..5122355 FT /rpt_family="Alu" FT misc_feature 5122887..5123164 FT /note="CpG_island (%GC=56.8, o/e=0.65, #CpGs=26)" FT repeat_region 5123496..5123745 FT /rpt_family="Alu" FT repeat_region 5123883..5124169 FT /rpt_family="Alu" FT repeat_region 5124318..5124606 FT /rpt_family="Alu" FT repeat_region 5124609..5124902 FT /rpt_family="Alu" FT misc_feature 5125379..5125616 FT /note="CpG_island (%GC=60.5, o/e=0.78, #CpGs=18)" FT repeat_region 5125380..5125675 FT /rpt_family="Alu" FT repeat_region 5125677..5125835 FT /rpt_family="Alu" FT repeat_region 5126675..5126970 FT /rpt_family="Alu" FT repeat_region 5127012..5127245 FT /rpt_family="MaLR" FT repeat_region 5127246..5127527 FT /rpt_family="Alu" FT repeat_region 5127528..5127668 FT /rpt_family="MaLR" FT repeat_region 5127834..5128142 FT /rpt_family="Alu" FT repeat_region 5128395..5128700 FT /rpt_family="Alu" FT repeat_region 5129064..5129357 FT /rpt_family="Alu" FT repeat_region 5129369..5129508 FT /rpt_family="L1" FT repeat_region 5129509..5129758 FT /rpt_family="ERV1" FT repeat_region 5129759..5130033 FT /rpt_family="Alu" FT repeat_region 5130034..5130372 FT /rpt_family="ERV1" FT repeat_region 5130373..5130674 FT /rpt_family="Alu" FT repeat_region 5130675..5130703 FT /rpt_family="ERV1" FT repeat_region 5130704..5130791 FT /rpt_family="L1" FT repeat_region 5130792..5131077 FT /rpt_family="Alu" FT repeat_region 5131078..5131121 FT /rpt_family="L1" FT repeat_region 5131122..5131427 FT /rpt_family="Alu" FT repeat_region 5131428..5131540 FT /rpt_family="L1" FT repeat_region 5131541..5131707 FT /rpt_family="Alu" FT repeat_region 5131708..5132009 FT /rpt_family="Alu" FT repeat_region 5132010..5132151 FT /rpt_family="Alu" FT repeat_region 5132152..5132721 FT /rpt_family="L1" FT repeat_region 5132722..5133032 FT /rpt_family="Alu" FT repeat_region 5133033..5133296 FT /rpt_family="L1" FT repeat_region 5133297..5133578 FT /rpt_family="Alu" FT repeat_region 5133579..5133965 FT /rpt_family="L1" FT repeat_region 5133968..5134106 FT /rpt_family="Alu" FT repeat_region 5134110..5134207 FT /rpt_family="Alu" FT repeat_region 5134221..5134378 FT /rpt_family="Alu" FT repeat_region 5134379..5134661 FT /rpt_family="L1" FT repeat_region 5134662..5134965 FT /rpt_family="Alu" FT repeat_region 5134966..5135080 FT /rpt_family="L1" FT repeat_region 5135087..5135388 FT /rpt_family="Alu" FT repeat_region 5135443..5135617 FT /rpt_family="Alu" FT repeat_region 5135736..5135987 FT /rpt_family="L1" FT repeat_region 5135988..5136284 FT /rpt_family="Alu" FT repeat_region 5136285..5136377 FT /rpt_family="L1" FT repeat_region 5136378..5136639 FT /rpt_family="Alu" FT repeat_region 5136640..5137133 FT /rpt_family="L1" FT repeat_region 5137134..5137430 FT /rpt_family="Alu" FT repeat_region 5137436..5137750 FT /rpt_family="Alu" FT repeat_region 5137751..5138113 FT /rpt_family="L1" FT repeat_region 5138114..5138424 FT /rpt_family="Alu" FT repeat_region 5138425..5138681 FT /rpt_family="L1" FT repeat_region 5138682..5138982 FT /rpt_family="Alu" FT repeat_region 5138983..5139568 FT /rpt_family="L1" FT repeat_region 5139569..5139871 FT /rpt_family="Alu" FT repeat_region 5139872..5140348 FT /rpt_family="L1" FT repeat_region 5140349..5140646 FT /rpt_family="Alu" FT repeat_region 5140647..5140920 FT /rpt_family="L1" FT repeat_region 5140921..5141212 FT /rpt_family="Alu" FT repeat_region 5141129..5141212 FT /rpt_family="Alu" FT repeat_region 5141216..5141522 FT /rpt_family="Alu" FT repeat_region 5141527..5141761 FT /rpt_family="Alu" FT repeat_region 5141763..5142002 FT /rpt_family="L1" FT repeat_region 5142004..5142057 FT /rpt_family="Alu" FT repeat_region 5142118..5142414 FT /rpt_family="Alu" FT repeat_region 5142415..5142861 FT /rpt_family="L1" FT repeat_region 5143553..5143831 FT /rpt_family="Alu" FT repeat_region 5144279..5144467 FT /rpt_family="MIR" FT repeat_region 5144498..5144795 FT /rpt_family="Alu" FT repeat_region 5144807..5145110 FT /rpt_family="Alu" FT repeat_region 5145233..5145522 FT /rpt_family="Alu" FT repeat_region 5145524..5145583 FT /rpt_family="MaLR" FT repeat_region 5145600..5145902 FT /rpt_family="Alu" FT repeat_region 5146262..5146371 FT /rpt_family="MIR" FT repeat_region 5146377..5146534 FT /rpt_family="Alu" FT repeat_region 5146611..5146927 FT /rpt_family="Alu" FT repeat_region 5147442..5147737 FT /rpt_family="Alu" FT repeat_region 5147807..5148116 FT /rpt_family="Alu" FT repeat_region 5148117..5148419 FT /rpt_family="Alu" FT repeat_region 5148902..5149204 FT /rpt_family="Alu" FT repeat_region 5149218..5149517 FT /rpt_family="Alu" FT repeat_region 5149661..5149733 FT /rpt_family="Alu" FT repeat_region 5149739..5150218 FT /rpt_family="ERVK" FT repeat_region 5150304..5150586 FT /rpt_family="Alu" FT repeat_region 5150653..5150920 FT /rpt_family="Alu" FT repeat_region 5150958..5151267 FT /rpt_family="Alu" FT repeat_region 5151635..5151819 FT /rpt_family="L1" FT repeat_region 5151820..5152123 FT /rpt_family="Alu" FT repeat_region 5152124..5152512 FT /rpt_family="L1" FT repeat_region 5152897..5153183 FT /rpt_family="Alu" FT repeat_region 5153282..5153421 FT /rpt_family="L2" FT repeat_region 5153532..5153799 FT /rpt_family="Alu" FT repeat_region 5153993..5154258 FT /rpt_family="Alu" FT repeat_region 5154511..5154710 FT /rpt_family="Alu" FT repeat_region 5154712..5154759 FT /rpt_family="Alu" FT repeat_region 5154762..5154854 FT /rpt_family="AT_rich" FT repeat_region 5154883..5154925 FT /rpt_family="AT_rich" FT repeat_region 5154979..5155280 FT /rpt_family="Alu" FT repeat_region 5155288..5155419 FT /rpt_family="Alu" FT repeat_region 5155420..5155723 FT /rpt_family="Alu" FT repeat_region 5155724..5155877 FT /rpt_family="Alu" FT repeat_region 5157895..5158039 FT /rpt_family="MER1_type" FT repeat_region 5158045..5158326 FT /rpt_family="Alu" FT repeat_region 5158709..5159017 FT /rpt_family="Alu" FT repeat_region 5159029..5159125 FT /rpt_family="L1" FT repeat_region 5159242..5159564 FT /rpt_family="Alu" FT repeat_region 5159951..5159995 FT /rpt_family="Alu" FT repeat_region 5160042..5160333 FT /rpt_family="Alu" FT repeat_region 5160403..5160704 FT /rpt_family="Alu" FT misc_feature 5160651..5161264 FT /note="CpG_island (%GC=61.9, o/e=0.96, #CpGs=48)" FT repeat_region 5161890..5162185 FT /rpt_family="Alu" FT repeat_region 5162275..5162406 FT /rpt_family="Alu" FT repeat_region 5162547..5162828 FT /rpt_family="Alu" FT repeat_region 5163001..5163288 FT /rpt_family="Alu" FT repeat_region 5163310..5163437 FT /rpt_family="Alu" FT repeat_region 5163539..5163834 FT /rpt_family="Alu" FT repeat_region 5163841..5164139 FT /rpt_family="Alu" FT repeat_region 5164163..5164476 FT /rpt_family="Alu" FT repeat_region 5164525..5164589 FT /rpt_family="MER1_type" FT repeat_region 5164886..5165011 FT /rpt_family="Alu" FT repeat_region 5165030..5165172 FT /rpt_family="Alu" FT repeat_region 5165221..5165503 FT /rpt_family="Alu" FT repeat_region 5165637..5165889 FT /rpt_family="Alu" FT repeat_region 5166091..5166390 FT /rpt_family="Alu" FT repeat_region 5166745..5167041 FT /rpt_family="Alu" FT repeat_region 5167071..5167155 FT /rpt_family="Alu" FT repeat_region 5167568..5167866 FT /rpt_family="Alu" FT repeat_region 5168228..5168508 FT /rpt_family="Alu" FT repeat_region 5168511..5168691 FT /rpt_family="L1" FT repeat_region 5168913..5169217 FT /rpt_family="Alu" FT repeat_region 5169498..5169669 FT /rpt_family="MaLR" FT repeat_region 5169670..5169966 FT /rpt_family="Alu" FT repeat_region 5169967..5170081 FT /rpt_family="MaLR" FT repeat_region 5170082..5170361 FT /rpt_family="Alu" FT repeat_region 5170362..5170414 FT /rpt_family="MaLR" FT repeat_region 5170554..5170790 FT /rpt_family="Alu" FT repeat_region 5170829..5170870 FT /rpt_family="5S" FT repeat_region 5171292..5171574 FT /rpt_family="Alu" FT repeat_region 5171709..5172005 FT /rpt_family="Alu" FT repeat_region 5172324..5172485 FT /rpt_family="Alu" FT repeat_region 5172486..5172509 FT /rpt_family="(TA)n" FT repeat_region 5172510..5172809 FT /rpt_family="Alu" FT repeat_region 5172810..5172955 FT /rpt_family="Alu" FT repeat_region 5173071..5173378 FT /rpt_family="Alu" FT repeat_region 5173380..5173669 FT /rpt_family="Alu" FT repeat_region 5173690..5173846 FT /rpt_family="Alu" FT repeat_region 5173860..5173983 FT /rpt_family="Alu" FT repeat_region 5174067..5174365 FT /rpt_family="Alu" FT repeat_region 5174372..5174434 FT /rpt_family="L1" FT repeat_region 5174435..5174739 FT /rpt_family="Alu" FT repeat_region 5174740..5174781 FT /rpt_family="L1" FT repeat_region 5175118..5175361 FT /rpt_family="Alu" FT repeat_region 5175362..5175382 FT /rpt_family="AT_rich" FT repeat_region 5175671..5175957 FT /rpt_family="Alu" FT repeat_region 5176364..5176462 FT /rpt_family="Alu" FT repeat_region 5176524..5176600 FT /rpt_family="MaLR" FT repeat_region 5176601..5176892 FT /rpt_family="Alu" FT repeat_region 5176893..5177218 FT /rpt_family="MaLR" FT repeat_region 5177219..5177518 FT /rpt_family="Alu" FT repeat_region 5177571..5177878 FT /rpt_family="Alu" FT repeat_region 5178061..5178211 FT /rpt_family="L1" FT repeat_region 5178212..5178527 FT /rpt_family="Alu" FT repeat_region 5178528..5178839 FT /rpt_family="Alu" FT repeat_region 5178840..5178894 FT /rpt_family="L1" FT repeat_region 5178895..5179200 FT /rpt_family="Alu" FT repeat_region 5179201..5179285 FT /rpt_family="L1" FT repeat_region 5179323..5179643 FT /rpt_family="Alu" FT repeat_region 5179670..5179781 FT /rpt_family="L1" FT repeat_region 5179968..5180249 FT /rpt_family="Alu" FT repeat_region 5180280..5180386 FT /rpt_family="ERV" FT repeat_region 5180391..5180522 FT /rpt_family="Alu" FT repeat_region 5180523..5180830 FT /rpt_family="Alu" FT repeat_region 5180831..5180968 FT /rpt_family="Alu" FT repeat_region 5180969..5181266 FT /rpt_family="Alu" FT repeat_region 5181269..5181326 FT /rpt_family="L1" FT repeat_region 5181455..5181761 FT /rpt_family="Alu" FT misc_feature 5181493..5181714 FT /note="CpG_island (%GC=60.4, o/e=0.85, #CpGs=17)" FT repeat_region 5182071..5182389 FT /rpt_family="Alu" FT repeat_region 5182423..5182732 FT /rpt_family="Alu" FT misc_feature 5183879..5184223 FT /note="CpG_island (%GC=70.4, o/e=0.70, #CpGs=28)" FT repeat_region 5184614..5184906 FT /rpt_family="Alu" FT repeat_region 5184912..5185186 FT /rpt_family="Alu" FT repeat_region 5185342..5185484 FT /rpt_family="Alu" FT repeat_region 5185510..5185790 FT /rpt_family="Alu" FT repeat_region 5185791..5186090 FT /rpt_family="Alu" FT repeat_region 5186493..5186654 FT /rpt_family="Alu" FT repeat_region 5186718..5186989 FT /rpt_family="Alu" FT repeat_region 5187186..5187496 FT /rpt_family="Alu" FT repeat_region 5187583..5187725 FT /rpt_family="Alu" FT repeat_region 5187726..5188022 FT /rpt_family="Alu" FT repeat_region 5188023..5188212 FT /rpt_family="Alu" FT repeat_region 5188425..5188621 FT /rpt_family="MER2_type" FT repeat_region 5188622..5188676 FT /rpt_family="MaLR" FT repeat_region 5188677..5188981 FT /rpt_family="Alu" FT repeat_region 5188982..5189325 FT /rpt_family="MaLR" FT repeat_region 5189326..5189374 FT /rpt_family="MER2_type" FT repeat_region 5189405..5189553 FT /rpt_family="Alu" FT repeat_region 5189563..5189866 FT /rpt_family="Alu" FT repeat_region 5190282..5190418 FT /rpt_family="Alu" FT repeat_region 5190419..5190715 FT /rpt_family="Alu" FT repeat_region 5190716..5190881 FT /rpt_family="Alu" FT repeat_region 5190963..5191081 FT /rpt_family="Alu" FT repeat_region 5191092..5191367 FT /rpt_family="Alu" FT repeat_region 5191374..5191750 FT /rpt_family="L1" FT repeat_region 5191943..5192004 FT /rpt_family="(TA)n" FT repeat_region 5192009..5192038 FT /rpt_family="L1" FT repeat_region 5192039..5192328 FT /rpt_family="Alu" FT repeat_region 5192329..5192539 FT /rpt_family="L1" FT repeat_region 5192544..5192609 FT /rpt_family="(TA)n" FT repeat_region 5192610..5192901 FT /rpt_family="Alu" FT repeat_region 5192906..5193078 FT /rpt_family="Alu" FT repeat_region 5193079..5193377 FT /rpt_family="Alu" FT repeat_region 5193378..5193513 FT /rpt_family="Alu" FT repeat_region 5193514..5193558 FT /rpt_family="(TA)n" FT repeat_region 5193566..5193849 FT /rpt_family="Alu" FT repeat_region 5193946..5193965 FT /rpt_family="(T)n" FT repeat_region 5194148..5194186 FT /rpt_family="MaLR" FT repeat_region 5194187..5194498 FT /rpt_family="Alu" FT repeat_region 5194499..5194526 FT /rpt_family="MaLR" FT repeat_region 5194527..5194835 FT /rpt_family="Alu" FT repeat_region 5194846..5195154 FT /rpt_family="Alu" FT repeat_region 5195155..5195510 FT /rpt_family="MaLR" FT repeat_region 5195863..5195910 FT /rpt_family="MER2_type" FT repeat_region 5195960..5196260 FT /rpt_family="Alu" FT repeat_region 5196264..5196325 FT /rpt_family="Alu" FT repeat_region 5196427..5196556 FT /rpt_family="L1" FT repeat_region 5196806..5197099 FT /rpt_family="Alu" FT repeat_region 5197775..5198083 FT /rpt_family="Alu" FT repeat_region 5198357..5198645 FT /rpt_family="Alu" FT repeat_region 5198695..5198764 FT /rpt_family="L2" FT repeat_region 5198766..5199070 FT /rpt_family="Alu" FT repeat_region 5199080..5199380 FT /rpt_family="Alu" FT repeat_region 5199381..5199406 FT /rpt_family="(TA)n" FT repeat_region 5199407..5199420 FT /rpt_family="Alu" FT repeat_region 5199421..5199576 FT /rpt_family="Alu" FT repeat_region 5199577..5199691 FT /rpt_family="Alu" FT repeat_region 5199884..5200184 FT /rpt_family="L1" FT repeat_region 5200185..5200477 FT /rpt_family="Alu" FT misc_feature 5200188..5200502 FT /note="CpG_island (%GC=60.3, o/e=0.82, #CpGs=23)" FT repeat_region 5200478..5200881 FT /rpt_family="L1" FT repeat_region 5200892..5201188 FT /rpt_family="Alu" FT repeat_region 5201196..5201325 FT /rpt_family="Alu" FT repeat_region 5201334..5201496 FT /rpt_family="L1" FT repeat_region 5201534..5201849 FT /rpt_family="Alu" FT repeat_region 5201858..5201948 FT /rpt_family="L1" FT repeat_region 5201949..5202240 FT /rpt_family="Alu" FT repeat_region 5202241..5202355 FT /rpt_family="L1" FT repeat_region 5202357..5202650 FT /rpt_family="Alu" FT repeat_region 5202691..5202767 FT /rpt_family="L1" FT repeat_region 5202768..5202896 FT /rpt_family="Alu" FT repeat_region 5202897..5203241 FT /rpt_family="L1" FT repeat_region 5203242..5203553 FT /rpt_family="Alu" FT repeat_region 5203554..5203689 FT /rpt_family="L1" FT repeat_region 5203690..5203993 FT /rpt_family="Alu" FT repeat_region 5203994..5204112 FT /rpt_family="L1" FT repeat_region 5204113..5204407 FT /rpt_family="Alu" FT repeat_region 5204408..5204529 FT /rpt_family="L1" FT repeat_region 5204530..5204830 FT /rpt_family="Alu" FT repeat_region 5204841..5205004 FT /rpt_family="Alu" FT repeat_region 5205008..5205472 FT /rpt_family="L1" FT repeat_region 5205646..5205938 FT /rpt_family="Alu" FT repeat_region 5206126..5206422 FT /rpt_family="Alu" FT repeat_region 5206474..5206639 FT /rpt_family="Alu" FT repeat_region 5206677..5206989 FT /rpt_family="Alu" FT repeat_region 5207166..5207296 FT /rpt_family="Alu" FT repeat_region 5207297..5207574 FT /rpt_family="Alu" FT repeat_region 5207575..5207739 FT /rpt_family="Alu" FT repeat_region 5207740..5207815 FT /rpt_family="ERV1" FT repeat_region 5207817..5208118 FT /rpt_family="Alu" FT repeat_region 5208151..5208483 FT /rpt_family="ERV1" FT repeat_region 5208485..5208794 FT /rpt_family="Alu" FT repeat_region 5208816..5209107 FT /rpt_family="Alu" FT repeat_region 5209110..5209387 FT /rpt_family="Alu" FT repeat_region 5209601..5209916 FT /rpt_family="Alu" FT repeat_region 5210253..5210561 FT /rpt_family="Alu" FT repeat_region 5210583..5210657 FT /rpt_family="Tc2" FT repeat_region 5210661..5210787 FT /rpt_family="Alu" FT repeat_region 5210788..5211113 FT /rpt_family="Alu" FT repeat_region 5211114..5211313 FT /rpt_family="Alu" FT repeat_region 5211493..5211566 FT /rpt_family="Alu" FT repeat_region 5211573..5211724 FT /rpt_family="Alu" FT repeat_region 5211752..5212054 FT /rpt_family="Alu" FT repeat_region 5212273..5212577 FT /rpt_family="Alu" FT repeat_region 5212581..5212842 FT /rpt_family="L1" FT repeat_region 5212870..5213179 FT /rpt_family="Alu" FT repeat_region 5213180..5213352 FT /rpt_family="Alu" FT repeat_region 5213356..5213434 FT /rpt_family="Alu" FT repeat_region 5213447..5213548 FT /rpt_family="L1" FT repeat_region 5213549..5213842 FT /rpt_family="Alu" FT repeat_region 5213843..5213862 FT /rpt_family="L1" FT repeat_region 5213846..5213914 FT /rpt_family="L1" FT repeat_region 5213981..5214015 FT /rpt_family="(TG)n" FT repeat_region 5214404..5214701 FT /rpt_family="Alu" FT repeat_region 5214702..5214857 FT /rpt_family="Alu" FT repeat_region 5214867..5215160 FT /rpt_family="Alu" FT repeat_region 5215187..5215310 FT /rpt_family="Alu" FT repeat_region 5215437..5215748 FT /rpt_family="Alu" FT repeat_region 5215846..5215908 FT /rpt_family="L1" FT repeat_region 5215957..5216253 FT /rpt_family="Alu" FT repeat_region 5216291..5216600 FT /rpt_family="Alu" FT repeat_region 5217076..5217375 FT /rpt_family="Alu" FT repeat_region 5217296..5217375 FT /rpt_family="Alu" FT repeat_region 5217466..5217647 FT /rpt_family="L1" FT repeat_region 5217648..5217963 FT /rpt_family="Alu" FT repeat_region 5217964..5218007 FT /rpt_family="L1" FT repeat_region 5218010..5218311 FT /rpt_family="Alu" FT repeat_region 5218313..5218421 FT /rpt_family="L1" FT repeat_region 5218422..5218553 FT /rpt_family="Alu" FT repeat_region 5218554..5218926 FT /rpt_family="L1" FT repeat_region 5218932..5219226 FT /rpt_family="L1" FT repeat_region 5219228..5219340 FT /rpt_family="MER2_type" FT repeat_region 5219342..5219474 FT /rpt_family="Alu" FT repeat_region 5219475..5219688 FT /rpt_family="L1" FT ncRNA 5219689..5219793 FT /product="snRNA-U6-related" FT /ncRNA_class="snRNA" FT repeat_region 5219689..5219793 FT /rpt_family="U6" FT repeat_region 5219808..5220129 FT /rpt_family="L1" FT repeat_region 5220130..5220274 FT /rpt_family="Alu" FT repeat_region 5220276..5220397 FT /rpt_family="ERV1" FT repeat_region 5220398..5220904 FT /rpt_family="L1" FT repeat_region 5220970..5221116 FT /rpt_family="L1" FT repeat_region 5221117..5221432 FT /rpt_family="Alu" FT repeat_region 5221433..5221538 FT /rpt_family="L1" FT repeat_region 5221539..5221848 FT /rpt_family="Alu" FT repeat_region 5221854..5222159 FT /rpt_family="Alu" FT repeat_region 5222161..5222205 FT /rpt_family="MIR" FT repeat_region 5222206..5222507 FT /rpt_family="Alu" FT repeat_region 5222508..5222651 FT /rpt_family="MIR" FT repeat_region 5223162..5223241 FT /rpt_family="ERV1" FT repeat_region 5223250..5223559 FT /rpt_family="Alu" FT repeat_region 5223914..5224212 FT /rpt_family="Alu" FT repeat_region 5224498..5224521 FT /rpt_family="ERV1" FT repeat_region 5224522..5224791 FT /rpt_family="Alu" FT repeat_region 5224792..5224829 FT /rpt_family="ERV1" FT repeat_region 5224830..5224869 FT /rpt_family="Alu" FT repeat_region 5224870..5225012 FT /rpt_family="L1" FT repeat_region 5225030..5225285 FT /rpt_family="Alu" FT repeat_region 5225287..5225341 FT /rpt_family="L1" FT repeat_region 5225343..5225404 FT /rpt_family="Alu" FT repeat_region 5225407..5225524 FT /rpt_family="L1" FT repeat_region 5225525..5225838 FT /rpt_family="Alu" FT repeat_region 5225839..5226034 FT /rpt_family="L1" FT repeat_region 5226035..5226343 FT /rpt_family="Alu" FT repeat_region 5226345..5226397 FT /rpt_family="(TA)n" FT repeat_region 5226398..5226497 FT /rpt_family="L1" FT repeat_region 5226498..5226789 FT /rpt_family="Alu" FT repeat_region 5226790..5226813 FT /rpt_family="L1" FT repeat_region 5226814..5227103 FT /rpt_family="Alu" FT repeat_region 5227104..5227269 FT /rpt_family="L1" FT repeat_region 5227685..5227991 FT /rpt_family="Alu" FT repeat_region 5227992..5228021 FT /rpt_family="(TA)n" FT repeat_region 5228054..5228355 FT /rpt_family="Alu" FT repeat_region 5228358..5228658 FT /rpt_family="Alu" FT repeat_region 5228850..5228950 FT /rpt_family="MIR" FT repeat_region 5228951..5229259 FT /rpt_family="Alu" FT repeat_region 5229260..5229322 FT /rpt_family="MIR" FT repeat_region 5229323..5229632 FT /rpt_family="Alu" FT repeat_region 5229633..5229645 FT /rpt_family="MIR" FT misc_feature 5229658..5230341 FT /note="CpG_island (%GC=76.8, o/e=0.85, #CpGs=90)" FT gene 5229834..5271360 FT /gene="DKFZP434J154" FT mRNA join(5229834..5230124,5232749..5232802,5239207..5239289, FT 5254166..5254335,5256194..5256290,5256721..5256818, FT 5257553..5257645,5262233..5262303,5265454..5265561, FT 5266811..5266975,5267735..5267842,5269239..5269369, FT 5270466..5271360) FT /gene="DKFZP434J154" FT mRNA join(5229868..5230124,5239207..5239289,5254166..5254335, FT 5256194..5256290,5256721..5256818,5257553..5257645, FT 5262233..5262303,5265454..5265561,5266811..5266975, FT 5267735..5267842,5269239..5269369,5270466..5270708) FT /gene="DKFZP434J154" FT mRNA join(5229892..5230124,5232749..5232802,5239207..5239289, FT 5254166..5254335,5256194..5256290,5256721..5256818, FT 5257553..5257645,5262233..5262303,5265454..5265561, FT 5266811..5266975,5267735..5267842,5269239..5269369, FT 5270466..5270708) FT /gene="DKFZP434J154" FT mRNA join(5229894..5230124,5232749..5232802,5239207..5239289, FT 5254166..5254335,5256194..5256290,5256721..5256818, FT 5257553..5257645,5262233..5262303,5265454..5265561, FT 5266811..5266975,5267735..5267842,5269239..5269369, FT 5270466..5270715) FT /gene="DKFZP434J154" FT repeat_region 5229996..5230046 FT /rpt_family="GC_rich" FT CDS join(5230051..5230124,5232749..5232802,5239207..5239289, FT 5254166..5254335,5256194..5256290,5256721..5256818, FT 5257553..5257645,5262233..5262303,5265454..5265561, FT 5266811..5266975,5267735..5267842,5269239..5269369, FT 5270466..5270578) FT /codon_start=1 FT /gene="DKFZP434J154" FT /product="unknown" FT /note="Homo sapiens DKFZP434J154 protein (DKFZP434J154), FT mRNA.; H_NH0147A22.1.1" FT /protein_id="AAQ96865.1" FT /translation="MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSL FT AVGSKSGYKFFSLSSVDKLEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHF FT KKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPAGLCA FT LSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASE FT KGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVK FT EKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQ FT KIPRLLVGAADGYLYMYNLDPQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQT FT YGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD" FT CDS join(5230051..5230124,5239207..5239289,5254166..5254335, FT 5256194..5256290,5256721..5256818,5257553..5257645, FT 5262233..5262303,5265454..5265561,5266811..5266975, FT 5267735..5267842,5269239..5269369,5270466..5270578) FT /codon_start=1 FT /gene="DKFZP434J154" FT /product="unknown" FT /note="Homo sapiens, Similar to DKFZP434J154 protein, clone FT MGC:15650 IMAGE:3346710, mRNA, complete cds.; FT H_NH0147A22.1.3" FT /protein_id="AAQ96867.1" FT /translation="MNLASQSGEAGAGQLLFANFNQDNTSLAVGSKSGYKFFSLSSVDK FT LEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTILAV FT KLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATI FT GEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVFSIPEGQKLFE FT FRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVKEKPPEEPTTWTGYFGKVL FT MASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQKIPRLLVGAADGYLYMYN FT LDPQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRL FT AYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD" FT repeat_region 5230636..5230952 FT /rpt_family="Alu" FT repeat_region 5231520..5231685 FT /rpt_family="MIR" FT repeat_region 5233164..5233206 FT /rpt_family="MIR" FT repeat_region 5233207..5233507 FT /rpt_family="Alu" FT repeat_region 5233508..5233555 FT /rpt_family="MIR" FT repeat_region 5234150..5234220 FT /rpt_family="L1" FT repeat_region 5234272..5234396 FT /rpt_family="Alu" FT repeat_region 5234399..5234648 FT /rpt_family="L1" FT repeat_region 5234661..5234779 FT /rpt_family="L1" FT repeat_region 5234836..5235141 FT /rpt_family="Alu" FT repeat_region 5235391..5235679 FT /rpt_family="Alu" FT repeat_region 5235690..5235993 FT /rpt_family="Alu" FT repeat_region 5236461..5236772 FT /rpt_family="Alu" FT repeat_region 5237950..5238244 FT /rpt_family="Alu" FT repeat_region 5238412..5238645 FT /rpt_family="L1" FT repeat_region 5238650..5238972 FT /rpt_family="Alu" FT repeat_region 5239711..5239925 FT /rpt_family="MIR" FT repeat_region 5239976..5240166 FT /rpt_family="L1" FT repeat_region 5240180..5240295 FT /rpt_family="Alu" FT repeat_region 5241093..5241396 FT /rpt_family="Alu" FT repeat_region 5242033..5242316 FT /rpt_family="Alu" FT repeat_region 5242329..5242366 FT /rpt_family="Alu" FT repeat_region 5243257..5243553 FT /rpt_family="Alu" FT repeat_region 5243816..5244103 FT /rpt_family="Alu" FT repeat_region 5244328..5244606 FT /rpt_family="Alu" FT repeat_region 5244613..5244906 FT /rpt_family="Alu" FT repeat_region 5245203..5245438 FT /rpt_family="Alu" FT repeat_region 5245498..5245837 FT /rpt_family="L1" FT repeat_region 5245902..5246087 FT /rpt_family="L1" FT repeat_region 5246393..5246703 FT /rpt_family="Alu" FT repeat_region 5246785..5247399 FT /rpt_family="L1" FT repeat_region 5247400..5247696 FT /rpt_family="Alu" FT repeat_region 5247697..5249170 FT /rpt_family="L1" FT repeat_region 5249444..5249526 FT /rpt_family="L2" FT repeat_region 5249527..5249839 FT /rpt_family="Alu" FT repeat_region 5249840..5250169 FT /rpt_family="L2" FT repeat_region 5250329..5250820 FT /rpt_family="MER2_type" FT repeat_region 5250821..5251115 FT /rpt_family="Alu" FT repeat_region 5251116..5251233 FT /rpt_family="MER2_type" FT repeat_region 5251431..5251468 FT /rpt_family="MIR" FT repeat_region 5251766..5251891 FT /rpt_family="L2" FT repeat_region 5252184..5252448 FT /rpt_family="Alu" FT repeat_region 5253017..5253259 FT /rpt_family="MER2_type" FT repeat_region 5253286..5253615 FT /rpt_family="Alu" FT mRNA join(5253900..5254335,5256194..5256290,5256721..5256818, FT 5257553..5257645,5262233..5262303,5265454..5265561, FT 5266811..5266975,5267735..5267842,5269239..5269336, FT 5270466..5270695) FT /gene="DKFZP434J154" FT CDS join(5254132..5254335,5256194..5256290,5256721..5256818, FT 5257553..5257645,5262233..5262303,5265454..5265561, FT 5266811..5266975,5267735..5267842,5269239..5269336, FT 5270466..5270578) FT /codon_start=1 FT /gene="DKFZP434J154" FT /product="unknown" FT /note="Homo sapiens DKFZP434J154 protein (DKFZP434J154), FT mRNA.; H_NH0147A22.1.2" FT /protein_id="AAQ96866.1" FT /translation="MFTHVLPFVISADTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHF FT KKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPAGLCA FT LSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASE FT KGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVK FT EKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQ FT KIPRLLVGAADGYLYMYNLDPQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQT FT YGAAAGKAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD" FT repeat_region 5254660..5254952 FT /rpt_family="Alu" FT repeat_region 5255817..5256091 FT /rpt_family="Alu" FT repeat_region 5256930..5257226 FT /rpt_family="Alu" FT repeat_region 5258126..5258320 FT /rpt_family="L1" FT repeat_region 5258711..5258930 FT /rpt_family="MIR" FT repeat_region 5259467..5259766 FT /rpt_family="Alu" FT repeat_region 5259774..5259867 FT /rpt_family="L1" FT repeat_region 5259868..5260169 FT /rpt_family="Alu" FT repeat_region 5260170..5260190 FT /rpt_family="L1" FT repeat_region 5260198..5260235 FT /rpt_family="Alu" FT repeat_region 5260238..5260406 FT /rpt_family="Alu" FT repeat_region 5260417..5260591 FT /rpt_family="Alu" FT repeat_region 5260592..5260891 FT /rpt_family="Alu" FT repeat_region 5260892..5261000 FT /rpt_family="Alu" FT repeat_region 5261578..5261879 FT /rpt_family="Alu" FT repeat_region 5264033..5264395 FT /rpt_family="ERV1" FT repeat_region 5264386..5264527 FT /rpt_family="ERV1" FT repeat_region 5264757..5265071 FT /rpt_family="Alu" FT repeat_region 5265997..5266225 FT /rpt_family="Alu" FT misc_feature 5266922..5267306 FT /gene="DKFZP434J154" FT /note="CpG_island (%GC=61.0, o/e=0.82, #CpGs=28)" FT misc_feature 5267749..5268110 FT /gene="DKFZP434J154" FT /note="CpG_island (%GC=66.3, o/e=0.71, #CpGs=30)" FT repeat_region 5268368..5268648 FT /rpt_family="Alu" FT repeat_region 5268649..5268943 FT /rpt_family="Alu" FT repeat_region 5269563..5269702 FT /rpt_family="Alu" FT repeat_region 5273206..5273442 FT /rpt_family="MIR" FT repeat_region 5273552..5273855 FT /rpt_family="Alu" FT repeat_region 5274230..5274543 FT /rpt_family="Alu" FT repeat_region 5274685..5274974 FT /rpt_family="Alu" FT repeat_region 5275402..5275702 FT /rpt_family="Alu" FT repeat_region 5275843..5275893 FT /rpt_family="(TG)n" FT repeat_region 5275991..5276119 FT /rpt_family="Alu" FT repeat_region 5276166..5276471 FT /rpt_family="Alu" FT repeat_region 5276572..5276880 FT /rpt_family="Alu" FT repeat_region 5277399..5277635 FT /rpt_family="Alu" FT repeat_region 5277636..5277917 FT /rpt_family="Alu" FT repeat_region 5277918..5277950 FT /rpt_family="(CAAA)n" FT repeat_region 5277951..5278027 FT /rpt_family="Alu" FT misc_feature 5278624..5279019 FT /note="CpG_island (%GC=59.1, o/e=0.76, #CpGs=28)" FT repeat_region 5278628..5278754 FT /rpt_family="Alu" FT repeat_region 5278760..5279067 FT /rpt_family="Alu" FT repeat_region 5279105..5279250 FT /rpt_family="Alu" FT repeat_region 5279251..5279559 FT /rpt_family="Alu" FT repeat_region 5279560..5279690 FT /rpt_family="Alu" FT repeat_region 5280469..5280780 FT /rpt_family="Alu" FT repeat_region 5280874..5280927 FT /rpt_family="(CA)n" FT repeat_region 5281199..5281230 FT /rpt_family="(TCCC)n" FT repeat_region 5281231..5281538 FT /rpt_family="Alu" FT repeat_region 5281542..5281826 FT /rpt_family="Alu" FT repeat_region 5281888..5282195 FT /rpt_family="Alu" FT repeat_region 5282198..5282245 FT /rpt_family="GA-rich" FT repeat_region 5282246..5282359 FT /rpt_family="L1" FT repeat_region 5282380..5282563 FT /rpt_family="(GAAA)n" FT repeat_region 5283690..5283840 FT /rpt_family="Alu" FT repeat_region 5283841..5283873 FT /rpt_family="(CAA)n" FT repeat_region 5283882..5284194 FT /rpt_family="Alu" FT repeat_region 5284195..5284211 FT /rpt_family="Alu" FT repeat_region 5284506..5284811 FT /rpt_family="Alu" FT repeat_region 5284815..5284982 FT /rpt_family="Alu" FT repeat_region 5285312..5285437 FT /rpt_family="Alu" FT repeat_region 5285438..5285702 FT /rpt_family="Alu" FT repeat_region 5286302..5286611 FT /rpt_family="Alu" FT repeat_region 5286888..5287167 FT /rpt_family="Alu" FT repeat_region 5287168..5287470 FT /rpt_family="Alu" FT repeat_region 5287480..5287779 FT /rpt_family="Alu" FT repeat_region 5288657..5288845 FT /rpt_family="Alu" FT repeat_region 5288846..5288883 FT /rpt_family="ERV1" FT repeat_region 5288884..5289184 FT /rpt_family="Alu" FT repeat_region 5289185..5289275 FT /rpt_family="ERV1" FT repeat_region 5289276..5289312 FT /rpt_family="(CAGA)n" FT repeat_region 5289313..5289344 FT /rpt_family="ERV1" FT repeat_region 5289345..5289508 FT /rpt_family="Alu" FT repeat_region 5289509..5289531 FT /rpt_family="(TTTC)n" FT repeat_region 5289532..5289816 FT /rpt_family="Alu" FT repeat_region 5289817..5289828 FT /rpt_family="Alu" FT repeat_region 5289829..5289840 FT /rpt_family="Alu" FT repeat_region 5289841..5289871 FT /rpt_family="(TG)n" FT repeat_region 5289872..5290173 FT /rpt_family="Alu" FT repeat_region 5290174..5290311 FT /rpt_family="Alu" FT repeat_region 5290312..5290608 FT /rpt_family="ERV1" FT repeat_region 5290643..5290874 FT /rpt_family="MaLR" FT repeat_region 5290901..5290982 FT /rpt_family="MaLR" FT repeat_region 5290987..5291297 FT /rpt_family="Alu" FT repeat_region 5291303..5291587 FT /rpt_family="Alu" FT repeat_region 5291598..5291726 FT /rpt_family="Alu" FT repeat_region 5291727..5291986 FT /rpt_family="ERV1" FT repeat_region 5291987..5292273 FT /rpt_family="Alu" FT repeat_region 5292274..5292325 FT /rpt_family="ERV1" FT repeat_region 5292327..5292646 FT /rpt_family="Alu" FT repeat_region 5292652..5292840 FT /rpt_family="ERV1" FT repeat_region 5293691..5293984 FT /rpt_family="Alu" FT repeat_region 5294059..5294257 FT /rpt_family="L1" FT repeat_region 5294266..5294569 FT /rpt_family="Alu" FT repeat_region 5294615..5294906 FT /rpt_family="Alu" FT repeat_region 5294992..5295246 FT /rpt_family="L1" FT repeat_region 5295247..5295550 FT /rpt_family="Alu" FT repeat_region 5295551..5295575 FT /rpt_family="L1" FT repeat_region 5295774..5295876 FT /rpt_family="L1" FT repeat_region 5295877..5296196 FT /rpt_family="Alu" FT repeat_region 5296197..5296450 FT /rpt_family="L1" FT repeat_region 5296483..5296647 FT /rpt_family="L1" FT repeat_region 5296648..5296946 FT /rpt_family="Alu" FT repeat_region 5296947..5297328 FT /rpt_family="L1" FT repeat_region 5297329..5297503 FT /rpt_family="Alu" FT repeat_region 5297509..5297819 FT /rpt_family="Alu" FT repeat_region 5297820..5297855 FT /rpt_family="L1" FT repeat_region 5297856..5298152 FT /rpt_family="Alu" FT repeat_region 5298153..5298232 FT /rpt_family="L1" FT repeat_region 5298293..5298387 FT /rpt_family="Alu" FT repeat_region 5298388..5298487 FT /rpt_family="Alu" FT repeat_region 5298488..5298782 FT /rpt_family="Alu" FT repeat_region 5298783..5298949 FT /rpt_family="Alu" FT repeat_region 5298962..5299160 FT /rpt_family="L1" FT repeat_region 5299163..5299297 FT /rpt_family="Alu" FT repeat_region 5299298..5299613 FT /rpt_family="Alu" FT repeat_region 5299614..5299790 FT /rpt_family="Alu" FT repeat_region 5300006..5300220 FT /rpt_family="MIR" FT repeat_region 5300246..5300370 FT /rpt_family="L2" FT repeat_region 5300442..5300726 FT /rpt_family="Alu" FT repeat_region 5300738..5301042 FT /rpt_family="Alu" FT repeat_region 5301428..5301730 FT /rpt_family="Alu" FT repeat_region 5301750..5301824 FT /rpt_family="Alu" FT repeat_region 5301825..5302101 FT /rpt_family="Alu" FT repeat_region 5302104..5302185 FT /rpt_family="GA-rich" FT repeat_region 5303692..5303999 FT /rpt_family="Alu" FT repeat_region 5304000..5304282 FT /rpt_family="Alu" FT repeat_region 5304283..5304368 FT /rpt_family="Alu" FT repeat_region 5304371..5304707 FT /rpt_family="Alu" FT repeat_region 5305081..5305195 FT /rpt_family="MIR" FT repeat_region 5305346..5305420 FT /rpt_family="MER1_type" FT repeat_region 5305488..5305535 FT /rpt_family="(TG)n" FT repeat_region 5305618..5305792 FT /rpt_family="(TG)n" FT repeat_region 5306451..5306516 FT /rpt_family="MaLR" FT repeat_region 5306560..5306661 FT /rpt_family="Alu" FT repeat_region 5306675..5306717 FT /rpt_family="MIR" FT repeat_region 5306929..5307231 FT /rpt_family="Alu" FT repeat_region 5307642..5307918 FT /rpt_family="Alu" FT repeat_region 5307919..5308216 FT /rpt_family="Alu" FT repeat_region 5308298..5308610 FT /rpt_family="Alu" FT repeat_region 5308997..5309306 FT /rpt_family="Alu" FT repeat_region 5309309..5309651 FT /rpt_family="MaLR" FT repeat_region 5309732..5310101 FT /rpt_family="MaLR" FT repeat_region 5310186..5310324 FT /rpt_family="Alu" FT repeat_region 5310362..5310498 FT /rpt_family="MIR" FT repeat_region 5310826..5311135 FT /rpt_family="Alu" FT repeat_region 5311162..5311275 FT /rpt_family="AcHobo" FT repeat_region 5311280..5311410 FT /rpt_family="Alu" FT repeat_region 5311437..5311745 FT /rpt_family="Alu" FT repeat_region 5311750..5311970 FT /rpt_family="MER1_type" FT repeat_region 5311971..5312247 FT /rpt_family="Alu" FT repeat_region 5312248..5312293 FT /rpt_family="(TAAAA)n" FT repeat_region 5312294..5312382 FT /rpt_family="MER1_type" FT repeat_region 5312574..5312750 FT /rpt_family="MIR" FT repeat_region 5312887..5313020 FT /rpt_family="CT-rich" FT repeat_region 5313034..5313332 FT /rpt_family="Alu" FT repeat_region 5313771..5313910 FT /rpt_family="MIR" FT repeat_region 5314161..5314298 FT /rpt_family="MIR" FT repeat_region 5314552..5314607 FT /rpt_family="MIR" FT repeat_region 5314690..5314749 FT /rpt_family="L2" FT repeat_region 5315255..5315388 FT /rpt_family="MIR" FT repeat_region 5315542..5315852 FT /rpt_family="Alu" FT repeat_region 5316608..5316910 FT /rpt_family="Alu" FT repeat_region 5316928..5317184 FT /rpt_family="Alu" FT repeat_region 5317223..5317354 FT /rpt_family="Alu" FT repeat_region 5317355..5317660 FT /rpt_family="Alu" FT repeat_region 5317661..5317754 FT /rpt_family="Alu" FT repeat_region 5318059..5318369 FT /rpt_family="Alu" FT repeat_region 5318493..5318526 FT /rpt_family="(T)n" FT repeat_region 5318775..5318939 FT /rpt_family="L1" FT repeat_region 5318962..5318986 FT /rpt_family="(A)n" FT repeat_region 5318996..5319273 FT /rpt_family="Alu" FT repeat_region 5319293..5319727 FT /rpt_family="L2" FT repeat_region 5319730..5320059 FT /rpt_family="Alu" FT repeat_region 5320168..5320191 FT /rpt_family="(TTTTA)n" FT repeat_region 5320196..5320477 FT /rpt_family="Alu" FT repeat_region 5320713..5320982 FT /rpt_family="L2" FT repeat_region 5321744..5321918 FT /rpt_family="G-rich" FT repeat_region 5321957..5322048 FT /rpt_family="GA-rich" FT repeat_region 5322081..5322258 FT /rpt_family="G-rich" FT repeat_region 5322223..5322518 FT /rpt_family="GA-rich" FT repeat_region 5322521..5322680 FT /rpt_family="(CGGGG)n" FT misc_feature 5322525..5323566 FT /note="CpG_island (%GC=76.9, o/e=0.90, #CpGs=122)" FT repeat_region 5322774..5322818 FT /rpt_family="GC_rich" FT repeat_region 5323201..5323244 FT /rpt_family="GC_rich" FT repeat_region 5323682..5323726 FT /rpt_family="MIR" FT repeat_region 5323735..5323871 FT /rpt_family="Alu" FT repeat_region 5325361..5325666 FT /rpt_family="Alu" FT repeat_region 5325874..5326180 FT /rpt_family="Alu" FT repeat_region 5326256..5326366 FT /rpt_family="CR1" FT repeat_region 5326401..5326514 FT /rpt_family="MIR" FT repeat_region 5326557..5326757 FT /rpt_family="L2" FT repeat_region 5326780..5327074 FT /rpt_family="Alu" FT repeat_region 5327177..5327273 FT /rpt_family="MIR" FT repeat_region 5327281..5327382 FT /rpt_family="MaLR" FT repeat_region 5327927..5328222 FT /rpt_family="Alu" FT repeat_region 5328224..5328318 FT /rpt_family="MaLR" FT repeat_region 5328331..5328454 FT /rpt_family="MIR" FT repeat_region 5328455..5328692 FT /rpt_family="MIR" FT repeat_region 5328746..5329040 FT /rpt_family="Alu" FT repeat_region 5329159..5329275 FT /rpt_family="MaLR" FT repeat_region 5329276..5329325 FT /rpt_family="ERVL" FT repeat_region 5329327..5329516 FT /rpt_family="ERVL" FT repeat_region 5329517..5329683 FT /rpt_family="Alu" FT repeat_region 5329684..5329993 FT /rpt_family="Alu" FT repeat_region 5329994..5330113 FT /rpt_family="Alu" FT repeat_region 5330586..5330664 FT /rpt_family="MIR" FT repeat_region 5330935..5331004 FT /rpt_family="MIR" FT repeat_region 5331045..5331170 FT /rpt_family="L2" FT repeat_region 5331767..5332044 FT /rpt_family="Alu" FT repeat_region 5332056..5332319 FT /rpt_family="L1" FT repeat_region 5332322..5332629 FT /rpt_family="Alu" FT repeat_region 5332692..5332777 FT /rpt_family="L1" FT repeat_region 5332784..5333100 FT /rpt_family="Alu" FT repeat_region 5333110..5333238 FT /rpt_family="MER1_type" FT repeat_region 5333281..5333461 FT /rpt_family="Alu" FT repeat_region 5333462..5333750 FT /rpt_family="Alu" FT repeat_region 5333751..5333871 FT /rpt_family="Alu" FT repeat_region 5333996..5334324 FT /rpt_family="MaLR" FT repeat_region 5334425..5334465 FT /rpt_family="MER1_type" FT repeat_region 5336066..5336245 FT /rpt_family="(CTGGGG)n" FT repeat_region 5336132..5336293 FT /rpt_family="(CGGGG)n" FT repeat_region 5336342..5336513 FT /rpt_family="G-rich" FT misc_feature 5336462..5336894 FT /note="CpG_island (%GC=69.1, o/e=0.79, #CpGs=42)" FT repeat_region 5337950..5338044 FT /rpt_family="L2" FT repeat_region 5338141..5338446 FT /rpt_family="Alu" FT misc_feature 5338675..5339002 FT /note="CpG_island (%GC=69.8, o/e=0.62, #CpGs=25)" FT repeat_region 5339400..5339709 FT /rpt_family="Alu" FT repeat_region 5339714..5339875 FT /rpt_family="Alu" FT misc_feature 5340145..5340354 FT /note="CpG_island (%GC=70.5, o/e=0.57, #CpGs=17)" FT repeat_region 5340475..5340607 FT /rpt_family="L2" FT repeat_region 5340608..5340909 FT /rpt_family="Alu" FT repeat_region 5340910..5341161 FT /rpt_family="L2" FT repeat_region 5341170..5341585 FT /rpt_family="L2" FT repeat_region 5341586..5341881 FT /rpt_family="Alu" FT repeat_region 5341882..5341905 FT /rpt_family="L2" FT repeat_region 5341912..5342186 FT /rpt_family="Alu" FT misc_feature 5342300..5342599 FT /note="CpG_island (%GC=70.3, o/e=0.66, #CpGs=23)" FT misc_feature 5342751..5342989 FT /note="CpG_island (%GC=66.9, o/e=0.78, #CpGs=18)" FT misc_feature 5343566..5343782 FT /note="CpG_island (%GC=65.4, o/e=0.77, #CpGs=17)" FT repeat_region 5344047..5344131 FT /rpt_family="MIR" FT repeat_region 5344132..5344434 FT /rpt_family="Alu" FT repeat_region 5344444..5344746 FT /rpt_family="Alu" FT repeat_region 5345184..5345486 FT /rpt_family="Alu" FT repeat_region 5345492..5345775 FT /rpt_family="Alu" FT repeat_region 5345819..5346125 FT /rpt_family="Alu" FT repeat_region 5346132..5346264 FT /rpt_family="Alu" FT repeat_region 5346885..5346922 FT /rpt_family="(TA)n" FT repeat_region 5347543..5347656 FT /rpt_family="(CACG)n" FT misc_feature 5347556..5347956 FT /note="CpG_island (%GC=66.1, o/e=0.72, #CpGs=36)" FT repeat_region 5348012..5348121 FT /rpt_family="(CAGAGA)n" FT repeat_region 5348126..5348309 FT /rpt_family="GA-rich" FT repeat_region 5348177..5348347 FT /rpt_family="(CAGAGA)n" FT repeat_region 5348480..5348502 FT /rpt_family="(CCA)n" FT misc_feature 5348697..5349073 FT /note="CpG_island (%GC=68.2, o/e=0.63, #CpGs=29)" FT repeat_region 5349241..5349531 FT /rpt_family="Alu" FT repeat_region 5349532..5349833 FT /rpt_family="Alu" FT repeat_region 5349856..5350165 FT /rpt_family="Alu" FT repeat_region 5350173..5350328 FT /rpt_family="Alu" FT repeat_region 5350526..5350706 FT /rpt_family="(TG)n" FT repeat_region 5350676..5350844 FT /rpt_family="(TATG)n" FT repeat_region 5350750..5350891 FT /rpt_family="(TG)n" FT repeat_region 5350957..5351118 FT /rpt_family="MaLR" FT repeat_region 5351178..5351480 FT /rpt_family="Alu" FT repeat_region 5351482..5351787 FT /rpt_family="Alu" FT repeat_region 5352509..5352684 FT /rpt_family="(GGA)n" FT repeat_region 5352788..5352847 FT /rpt_family="(CTG)n" FT repeat_region 5353584..5353899 FT /rpt_family="Alu" FT repeat_region 5354095..5354156 FT /rpt_family="MIR" FT repeat_region 5354192..5354503 FT /rpt_family="Alu" FT repeat_region 5355048..5355352 FT /rpt_family="Alu" FT repeat_region 5355904..5356209 FT /rpt_family="Alu" FT repeat_region 5356230..5356538 FT /rpt_family="L1" FT repeat_region 5356831..5356938 FT /rpt_family="L1" FT repeat_region 5356939..5357252 FT /rpt_family="Alu" FT repeat_region 5357253..5357342 FT /rpt_family="L1" FT repeat_region 5357343..5357506 FT /rpt_family="Alu" FT repeat_region 5357507..5357802 FT /rpt_family="Alu" FT repeat_region 5357803..5357941 FT /rpt_family="Alu" FT repeat_region 5357942..5358746 FT /rpt_family="L1" FT repeat_region 5359108..5359140 FT /rpt_family="MaLR" FT repeat_region 5359141..5359440 FT /rpt_family="Alu" FT repeat_region 5359441..5359580 FT /rpt_family="MaLR" FT repeat_region 5359720..5359906 FT /rpt_family="MaLR" FT repeat_region 5360328..5360427 FT /rpt_family="MIR" FT misc_feature 5360641..5360869 FT /note="CpG_island (%GC=67.7, o/e=0.83, #CpGs=20)" FT repeat_region 5361271..5361601 FT /rpt_family="Alu" FT repeat_region 5361629..5361912 FT /rpt_family="Alu" FT repeat_region 5361915..5361940 FT /rpt_family="(CAT)n" FT repeat_region 5361948..5362218 FT /rpt_family="Alu" FT repeat_region 5362986..5363199 FT /rpt_family="L2" FT repeat_region 5363200..5363498 FT /rpt_family="Alu" FT repeat_region 5363499..5363737 FT /rpt_family="L2" FT repeat_region 5365050..5365353 FT /rpt_family="Alu" FT repeat_region 5365356..5365644 FT /rpt_family="Alu" FT repeat_region 5366064..5366243 FT /rpt_family="Alu" FT repeat_region 5366288..5366471 FT /rpt_family="Alu" FT repeat_region 5366474..5366776 FT /rpt_family="Alu" FT repeat_region 5366778..5366934 FT /rpt_family="L1" FT repeat_region 5366989..5367051 FT /rpt_family="(TG)n" FT repeat_region 5367571..5367864 FT /rpt_family="Alu" FT repeat_region 5367874..5368002 FT /rpt_family="Alu" FT repeat_region 5368017..5368143 FT /rpt_family="Alu" FT repeat_region 5368144..5368440 FT /rpt_family="Alu" FT repeat_region 5368441..5368640 FT /rpt_family="Alu" FT repeat_region 5368652..5368961 FT /rpt_family="Alu" FT repeat_region 5369033..5369338 FT /rpt_family="Alu" FT repeat_region 5369343..5369451 FT /rpt_family="MIR" FT repeat_region 5369704..5369854 FT /rpt_family="Alu" FT repeat_region 5369863..5370169 FT /rpt_family="Alu" FT repeat_region 5370306..5370605 FT /rpt_family="Alu" FT repeat_region 5371001..5371270 FT /rpt_family="MER1_type" FT repeat_region 5371271..5371560 FT /rpt_family="Alu" FT repeat_region 5371561..5371750 FT /rpt_family="MER1_type" FT repeat_region 5371786..5372077 FT /rpt_family="Alu" FT misc_feature 5372281..5372898 FT /note="CpG_island (%GC=72.2, o/e=0.77, #CpGs=64)" FT repeat_region 5373929..5374211 FT /rpt_family="Alu" FT repeat_region 5374651..5374955 FT /rpt_family="Alu" FT repeat_region 5374959..5375253 FT /rpt_family="Alu" FT repeat_region 5375257..5375562 FT /rpt_family="L1" FT repeat_region 5375563..5375855 FT /rpt_family="Alu" FT repeat_region 5375856..5376092 FT /rpt_family="L1" FT repeat_region 5376093..5376388 FT /rpt_family="Alu" FT repeat_region 5376389..5376479 FT /rpt_family="L1" FT repeat_region 5376558..5376968 FT /rpt_family="L1" FT repeat_region 5376969..5377139 FT /rpt_family="Alu" FT repeat_region 5377144..5377333 FT /rpt_family="L1" FT repeat_region 5377334..5377635 FT /rpt_family="Alu" FT repeat_region 5377636..5377753 FT /rpt_family="L1" FT repeat_region 5377766..5377931 FT /rpt_family="L1" FT repeat_region 5377936..5378078 FT /rpt_family="L1" FT repeat_region 5378079..5378270 FT /rpt_family="Alu" FT repeat_region 5378275..5378578 FT /rpt_family="Alu" FT repeat_region 5378647..5378771 FT /rpt_family="Alu" FT repeat_region 5378772..5378836 FT /rpt_family="MER2_type" FT repeat_region 5378856..5379170 FT /rpt_family="Alu" FT repeat_region 5379173..5379209 FT /rpt_family="(TG)n" FT repeat_region 5379215..5379500 FT /rpt_family="Alu" FT repeat_region 5380086..5380403 FT /rpt_family="Alu" FT repeat_region 5380761..5381071 FT /rpt_family="Alu" FT repeat_region 5381113..5381414 FT /rpt_family="Alu" FT repeat_region 5381778..5382085 FT /rpt_family="Alu" FT repeat_region 5382705..5382998 FT /rpt_family="Alu" FT repeat_region 5383049..5383357 FT /rpt_family="Alu" FT repeat_region 5383593..5383771 FT /rpt_family="L1" FT repeat_region 5383906..5384007 FT /rpt_family="L2" FT repeat_region 5385070..5385136 FT /rpt_family="MIR" FT repeat_region 5385388..5385431 FT /rpt_family="(TCC)n" FT repeat_region 5386039..5386148 FT /rpt_family="Alu" FT repeat_region 5386159..5386274 FT /rpt_family="Alu" FT repeat_region 5386341..5386394 FT /rpt_family="MIR" FT repeat_region 5386692..5386820 FT /rpt_family="Alu" FT repeat_region 5386821..5387126 FT /rpt_family="Alu" FT repeat_region 5387127..5387304 FT /rpt_family="Alu" FT repeat_region 5387312..5387608 FT /rpt_family="Alu" FT repeat_region 5388279..5388325 FT /rpt_family="GA-rich" FT repeat_region 5388393..5388425 FT /rpt_family="(CAGG)n" FT repeat_region 5389045..5389068 FT /rpt_family="AT_rich" FT repeat_region 5389745..5389789 FT /rpt_family="G-rich" FT repeat_region 5390061..5390081 FT /rpt_family="GC_rich" FT misc_feature 5391324..5391572 FT /note="CpG_island (%GC=61.4, o/e=0.96, #CpGs=22)" FT repeat_region 5392142..5392257 FT /rpt_family="MER1_type" FT repeat_region 5392886..5393212 FT /rpt_family="Alu" FT repeat_region 5393552..5393876 FT /rpt_family="Alu" FT repeat_region 5394397..5394479 FT /rpt_family="MIR" FT repeat_region 5394977..5395186 FT /rpt_family="Alu" FT repeat_region 5395235..5395514 FT /rpt_family="Alu" FT repeat_region 5395520..5395824 FT /rpt_family="Alu" FT misc_feature 5395873..5396300 FT /note="CpG_island (%GC=62.4, o/e=0.80, #CpGs=33)" FT repeat_region 5396426..5396457 FT /rpt_family="(GA)n" FT repeat_region 5396462..5396510 FT /rpt_family="GA-rich" FT repeat_region 5397046..5397179 FT /rpt_family="Alu" FT repeat_region 5397188..5397399 FT /rpt_family="Alu" FT repeat_region 5397431..5397549 FT /rpt_family="MIR" FT repeat_region 5398163..5398467 FT /rpt_family="Alu" FT repeat_region 5398779..5398888 FT /rpt_family="MIR" FT repeat_region 5399765..5399834 FT /rpt_family="MIR" FT repeat_region 5399835..5399878 FT /rpt_family="(TTTA)n" FT repeat_region 5399881..5400160 FT /rpt_family="Alu" FT repeat_region 5400161..5400302 FT /rpt_family="MIR" FT misc_feature 5400612..5401610 FT /note="CpG_island (%GC=69.0, o/e=0.70, #CpGs=86)" FT repeat_region 5401483..5401517 FT /rpt_family="GC_rich" FT repeat_region 5402074..5402188 FT /rpt_family="MIR" FT repeat_region 5402643..5402949 FT /rpt_family="Alu" FT repeat_region 5402952..5403232 FT /rpt_family="Alu" FT repeat_region 5403233..5403254 FT /rpt_family="(CAAT)n" FT repeat_region 5403647..5403949 FT /rpt_family="Alu" FT repeat_region 5403960..5404093 FT /rpt_family="Alu" FT repeat_region 5404094..5404145 FT /rpt_family="(CA)n" FT repeat_region 5404153..5404457 FT /rpt_family="Alu" FT repeat_region 5404553..5404621 FT /rpt_family="Mariner" FT repeat_region 5404746..5405043 FT /rpt_family="Alu" FT repeat_region 5405253..5405384 FT /rpt_family="Alu" FT repeat_region 5405419..5405654 FT /rpt_family="Alu" FT repeat_region 5405722..5405925 FT /rpt_family="MER1_type" FT repeat_region 5405948..5406254 FT /rpt_family="Alu" FT repeat_region 5406540..5406707 FT /rpt_family="MaLR" FT repeat_region 5406714..5407021 FT /rpt_family="Alu" FT repeat_region 5407052..5407358 FT /rpt_family="Alu" FT repeat_region 5407466..5407700 FT /rpt_family="L1" FT repeat_region 5407830..5407965 FT /rpt_family="Alu" FT repeat_region 5407974..5408013 FT /rpt_family="L1" FT repeat_region 5408014..5408319 FT /rpt_family="Alu" FT repeat_region 5408320..5408423 FT /rpt_family="L1" FT repeat_region 5408504..5408596 FT /rpt_family="MaLR" FT repeat_region 5408697..5409005 FT /rpt_family="Alu" FT repeat_region 5409200..5409226 FT /rpt_family="(GGGA)n" FT repeat_region 5409267..5409436 FT /rpt_family="MaLR" FT repeat_region 5409479..5409593 FT /rpt_family="L1" FT repeat_region 5409660..5409966 FT /rpt_family="Alu" FT misc_feature 5410673..5410989 FT /note="CpG_island (%GC=71.0, o/e=0.71, #CpGs=29)" FT repeat_region 5411421..5411531 FT /rpt_family="Alu" FT repeat_region 5411532..5411701 FT /rpt_family="Alu" FT repeat_region 5411702..5412007 FT /rpt_family="Alu" FT repeat_region 5412008..5412153 FT /rpt_family="Alu" FT repeat_region 5412154..5412359 FT /rpt_family="Alu" FT repeat_region 5412371..5412507 FT /rpt_family="Alu" FT repeat_region 5412508..5412806 FT /rpt_family="Alu" FT repeat_region 5412807..5412973 FT /rpt_family="Alu" FT repeat_region 5413392..5413490 FT /rpt_family="MIR" FT misc_feature 5413746..5414210 FT /note="CpG_island (%GC=74.0, o/e=0.69, #CpGs=40)" FT repeat_region 5414660..5414983 FT /rpt_family="Alu" FT repeat_region 5415031..5415191 FT /rpt_family="MIR" FT repeat_region 5418027..5418348 FT /rpt_family="Alu" FT repeat_region 5418534..5418855 FT /rpt_family="Alu" FT repeat_region 5418863..5419058 FT /rpt_family="Alu" FT repeat_region 5419807..5420063 FT /rpt_family="Alu" FT repeat_region 5421061..5421163 FT /rpt_family="L2" FT repeat_region 5421187..5421283 FT /rpt_family="Alu" FT repeat_region 5421315..5421634 FT /rpt_family="Alu" FT repeat_region 5421670..5421857 FT /rpt_family="MIR" FT repeat_region 5422530..5422832 FT /rpt_family="Alu" FT repeat_region 5423083..5423188 FT /rpt_family="MIR" FT repeat_region 5423427..5423588 FT /rpt_family="Alu" FT repeat_region 5423589..5423898 FT /rpt_family="Alu" FT repeat_region 5423899..5424031 FT /rpt_family="Alu" FT repeat_region 5424508..5424621 FT /rpt_family="L2" FT repeat_region 5424836..5425155 FT /rpt_family="Alu" FT repeat_region 5425156..5425322 FT /rpt_family="Alu" FT repeat_region 5425323..5425638 FT /rpt_family="Alu" FT repeat_region 5425639..5425937 FT /rpt_family="Alu" FT repeat_region 5425957..5426231 FT /rpt_family="Alu" FT repeat_region 5426232..5426415 FT /rpt_family="Alu" FT repeat_region 5426423..5426730 FT /rpt_family="Alu" FT repeat_region 5426873..5426976 FT /rpt_family="L2" FT repeat_region 5426997..5427250 FT /rpt_family="L1" FT misc_feature 5427456..5429037 FT /note="CpG_island (%GC=75.4, o/e=0.77, #CpGs=189)" FT repeat_region 5428429..5428450 FT /rpt_family="GC_rich" FT repeat_region 5429081..5429382 FT /rpt_family="Alu" FT repeat_region 5429520..5429573 FT /rpt_family="MIR" FT repeat_region 5429717..5430010 FT /rpt_family="Alu" FT repeat_region 5430545..5430724 FT /rpt_family="MIR" FT repeat_region 5430686..5430793 FT /rpt_family="MIR" FT repeat_region 5430948..5431241 FT /rpt_family="Alu" FT repeat_region 5431245..5431267 FT /rpt_family="AT_rich" FT repeat_region 5431346..5431481 FT /rpt_family="Alu" FT repeat_region 5431814..5431948 FT /rpt_family="Alu" FT repeat_region 5431950..5432269 FT /rpt_family="Alu" FT repeat_region 5432357..5432650 FT /rpt_family="Alu" FT repeat_region 5433512..5433638 FT /rpt_family="Alu" FT repeat_region 5433663..5433736 FT /rpt_family="L2" FT repeat_region 5433797..5433963 FT /rpt_family="L2" FT repeat_region 5434728..5434872 FT /rpt_family="MIR" FT repeat_region 5435341..5435643 FT /rpt_family="Alu" FT repeat_region 5435655..5435990 FT /rpt_family="Alu" FT repeat_region 5436015..5436178 FT /rpt_family="Alu" FT repeat_region 5436564..5436663 FT /rpt_family="MIR" FT repeat_region 5437152..5437185 FT /rpt_family="MIR" FT repeat_region 5437486..5437565 FT /rpt_family="L2" FT repeat_region 5437629..5437804 FT /rpt_family="Alu" FT repeat_region 5437805..5438100 FT /rpt_family="Alu" FT repeat_region 5438101..5438249 FT /rpt_family="Alu" FT repeat_region 5438250..5438554 FT /rpt_family="Alu" FT repeat_region 5439064..5439355 FT /rpt_family="Alu" FT repeat_region 5439372..5439577 FT /rpt_family="Alu" FT repeat_region 5439577..5439827 FT /rpt_family="Alu" FT repeat_region 5439959..5440253 FT /rpt_family="Alu" FT repeat_region 5440261..5440377 FT /rpt_family="L1" FT repeat_region 5440388..5440671 FT /rpt_family="Alu" FT repeat_region 5440672..5440743 FT /rpt_family="Alu" FT repeat_region 5441251..5441336 FT /rpt_family="MER1_type" FT repeat_region 5441439..5441524 FT /rpt_family="Alu" FT repeat_region 5441525..5441835 FT /rpt_family="Alu" FT repeat_region 5441836..5441873 FT /rpt_family="Alu" FT repeat_region 5441883..5442193 FT /rpt_family="Alu" FT repeat_region 5442203..5442495 FT /rpt_family="Alu" FT repeat_region 5442628..5442662 FT /rpt_family="MIR" FT repeat_region 5442785..5443088 FT /rpt_family="Alu" FT repeat_region 5443146..5443438 FT /rpt_family="Alu" FT repeat_region 5443722..5444016 FT /rpt_family="Alu" FT repeat_region 5444329..5444394 FT /rpt_family="L1" FT repeat_region 5444395..5444424 FT /rpt_family="(TG)n" FT repeat_region 5444425..5444462 FT /rpt_family="L1" FT repeat_region 5444463..5444762 FT /rpt_family="Alu" FT repeat_region 5444777..5444917 FT /rpt_family="Alu" FT repeat_region 5444918..5445226 FT /rpt_family="Alu" FT repeat_region 5445227..5445398 FT /rpt_family="Alu" FT repeat_region 5445415..5445552 FT /rpt_family="Alu" FT repeat_region 5445564..5445811 FT /rpt_family="L1" FT repeat_region 5445814..5446101 FT /rpt_family="Alu" FT repeat_region 5446120..5446191 FT /rpt_family="L1" FT repeat_region 5446200..5446511 FT /rpt_family="Alu" FT repeat_region 5447704..5447947 FT /rpt_family="Alu" FT repeat_region 5447998..5448294 FT /rpt_family="Alu" FT repeat_region 5448748..5449061 FT /rpt_family="L1" FT repeat_region 5449065..5449235 FT /rpt_family="Alu" FT repeat_region 5449239..5449326 FT /rpt_family="L1" FT repeat_region 5449327..5449636 FT /rpt_family="Alu" FT repeat_region 5449637..5449662 FT /rpt_family="L1" FT repeat_region 5449663..5449971 FT /rpt_family="Alu" FT repeat_region 5449972..5450200 FT /rpt_family="L1" FT repeat_region 5450215..5450515 FT /rpt_family="Alu" FT repeat_region 5450516..5450554 FT /rpt_family="GA-rich" FT repeat_region 5450555..5450876 FT /rpt_family="Alu" FT repeat_region 5450877..5450898 FT /rpt_family="GA-rich" FT repeat_region 5450900..5451001 FT /rpt_family="L1" FT repeat_region 5451003..5451168 FT /rpt_family="Alu" FT repeat_region 5451190..5451471 FT /rpt_family="L1" FT repeat_region 5451534..5451842 FT /rpt_family="Alu" FT repeat_region 5451876..5451897 FT /rpt_family="(A)n" FT repeat_region 5451925..5452247 FT /rpt_family="Alu" FT repeat_region 5452250..5452339 FT /rpt_family="MIR" FT repeat_region 5453160..5453463 FT /rpt_family="Alu" FT repeat_region 5453484..5453584 FT /rpt_family="L1" FT repeat_region 5453585..5453876 FT /rpt_family="Alu" FT repeat_region 5453877..5454039 FT /rpt_family="L1" FT repeat_region 5454040..5454342 FT /rpt_family="Alu" FT repeat_region 5454343..5454669 FT /rpt_family="L1" FT repeat_region 5454673..5454809 FT /rpt_family="L2" FT repeat_region 5454999..5455311 FT /rpt_family="Alu" FT repeat_region 5455456..5455761 FT /rpt_family="Alu" FT repeat_region 5455764..5456062 FT /rpt_family="Alu" FT repeat_region 5456072..5456193 FT /rpt_family="Alu" FT repeat_region 5456205..5456340 FT /rpt_family="Alu" FT repeat_region 5456341..5456624 FT /rpt_family="Alu" FT repeat_region 5456625..5456799 FT /rpt_family="Alu" FT repeat_region 5456817..5457129 FT /rpt_family="Alu" FT repeat_region 5457144..5457293 FT /rpt_family="L2" FT repeat_region 5458217..5458270 FT /rpt_family="MIR" FT misc_feature 5458504..5461651 FT /note="CpG_island (%GC=66.8, o/e=0.85, #CpGs=283)" FT repeat_region 5459359..5459397 FT /rpt_family="GC_rich" FT misc_feature 5460660..5461167 FT /note="similar to Mus musculus EST BG519107 FT (NID:g13514598)" FT misc_feature 5460668..5469256 FT /note="CpG_island (%GC=62.0, o/e=0.70, #CpGs=628)" FT misc_feature 5460690..5461120 FT /note="similar to Mus musculus EST BB620850 FT (NID:g16459753)" FT misc_feature 5460690..5461134 FT /note="similar to Mus musculus EST BB866308 FT (NID:g17112518)" FT repeat_region 5461026..5461087 FT /rpt_family="GC_rich" FT misc_feature 5462438..5462938 FT /note="similar to Bos taurus EST BF039304 (NID:g10756359)" FT misc_feature 5462641..5463160 FT /note="similar to Homo sapiens EST AA543060 (NID:g2291540) FT nf92h07.s1" FT misc_feature 5462821..5463155 FT /note="match to EST AI971902 (NID:g5768728) wv29h08.x1" FT repeat_region 5463032..5463052 FT /rpt_family="GC_rich" FT misc_feature 5463068..5463414 FT /note="similar to Mus musculus EST AA537572 (NID:g2283565) FT vk48g02.r1" FT misc_feature 5463072..5463253 FT /note="similar to Mus musculus EST BB620850 FT (NID:g16459753)" FT misc_feature 5463204..5463764 FT /note="similar to EST BM715441 (NID:g19028699)" FT repeat_region 5463562..5463600 FT /rpt_family="GC_rich" FT misc_feature 5463577..5463764 FT /note="similar to EST BM713340 (NID:g19026598)" FT misc_feature 5463668..5463987 FT /note="similar to Homo sapiens EST H78013 (NID:g1056102) FT yu85a11.r1" FT repeat_region 5463768..5463842 FT /rpt_family="C-rich" FT misc_feature 5464084..5464566 FT /note="match to EST AI333634 (NID:g4070193) qp91d05.x1" FT misc_feature 5464155..5464447 FT /note="similar to Bos taurus EST BE663876 (NID:g10022773)" FT misc_feature 5464241..5464768 FT /note="similar to Mus musculus EST BB621178 FT (NID:g16459968)" FT misc_feature 5464255..5465026 FT /note="match to EST BI753991 (NID:g15745569)" FT repeat_region 5464328..5464370 FT /rpt_family="GC_rich" FT misc_feature 5464408..5464574 FT /note="similar to Homo sapiens EST H78014 (NID:g1056103) FT yu85a11.s1" FT misc_feature 5464445..5465332 FT /note="match to EST BI915118 (NID:g16179204)" FT misc_feature 5464921..5465045 FT /note="match to EST BI918987 (NID:g16200041)" FT misc_feature 5465365..5466019 FT /note="similar to Mus musculus EST BB041769 FT (NID:g16258691)" FT misc_feature 5465543..5466028 FT /note="similar to Rattus norvegicus EST BF412475 FT (NID:g11400464)" FT misc_feature 5465587..5466031 FT /note="match to EST AI377535 (NID:g4187388) tc15f12.x1" FT misc_feature 5465808..5466032 FT /note="similar to EST BM685230 (NID:g18995126)" FT misc_feature 5465908..5466237 FT /note="similar to EST BM668076 (NID:g18975907)" FT misc_feature 5466734..5467115 FT /note="similar to EST BM697128 (NID:g19010386)" FT repeat_region 5466807..5466872 FT /rpt_family="(TG)n" FT misc_feature 5468212..5468690 FT /note="match to EST AA634064 (NID:g2557278) ac34c03.s1" FT misc_feature 5468341..5468930 FT /note="similar to EST BM693609 (NID:g19006867)" FT repeat_region 5468359..5468385 FT /rpt_family="(T)n" FT misc_feature 5468717..5469303 FT /note="similar to EST BM669195 (NID:g18979092)" FT misc_feature 5468784..5469205 FT /note="match to EST R50614 (NID:g812516) yj57a05.r1" FT misc_feature 5468921..5469244 FT /note="match to EST AI991409 (NID:g5838314) ws10a06.x1" FT repeat_region 5470091..5470217 FT /rpt_family="MIR" FT repeat_region 5470633..5470768 FT /rpt_family="Alu" FT repeat_region 5470779..5471107 FT /rpt_family="Alu" FT misc_feature 5471040..5471428 FT /note="match to EST BF871134 (NID:g12261264)" FT repeat_region 5471161..5471180 FT /rpt_family="(TC)n" FT repeat_region 5471180..5471211 FT /rpt_family="(CA)n" FT repeat_region 5471497..5471643 FT /rpt_family="(CA)n" FT repeat_region 5471684..5471984 FT /rpt_family="Alu" FT repeat_region 5472112..5472288 FT /rpt_family="MaLR" FT repeat_region 5472289..5472572 FT /rpt_family="Alu" FT repeat_region 5472573..5472808 FT /rpt_family="MaLR" FT misc_feature 5472898..5473252 FT /note="match to EST AW853693 (NID:g7949373)" FT repeat_region 5472929..5473003 FT /rpt_family="MaLR" FT repeat_region 5473383..5473687 FT /rpt_family="Alu" FT repeat_region 5473719..5473963 FT /rpt_family="Alu" FT repeat_region 5473964..5474296 FT /rpt_family="L1" FT repeat_region 5474340..5474721 FT /rpt_family="MaLR" FT repeat_region 5474733..5475019 FT /rpt_family="Alu" FT repeat_region 5475052..5475097 FT /rpt_family="L2" FT repeat_region 5475098..5475209 FT /rpt_family="L2" FT misc_feature 5475662..5476352 FT /note="match to EST AL048331 (NID:g4727471)" FT repeat_region 5475670..5475808 FT /rpt_family="MIR" FT repeat_region 5476058..5476341 FT /rpt_family="Alu" FT repeat_region 5476351..5476647 FT /rpt_family="Alu" FT misc_feature 5476381 FT /note="match to EST AL048331 (NID:g4727471)" FT repeat_region 5476717..5477014 FT /rpt_family="Alu" FT repeat_region 5477135..5477285 FT /rpt_family="MER1_type" FT repeat_region 5477280..5477455 FT /rpt_family="MaLR" FT misc_feature 5477990..5478258 FT /note="match to EST AA706367 (NID:g2716285) ag91g04.r1" FT repeat_region 5478136..5478307 FT /rpt_family="Alu" FT repeat_region 5478309..5478445 FT /rpt_family="MaLR" FT repeat_region 5478476..5478598 FT /rpt_family="Alu" FT repeat_region 5478599..5478671 FT /rpt_family="Alu" FT repeat_region 5478679..5478929 FT /rpt_family="Alu" FT misc_feature 5478876..5479182 FT /note="match to EST AA077393 (NID:g1836867)" FT misc_feature 5479712..5479967 FT /note="match to EST AA076682 (NID:g1836184)" FT repeat_region 5480111..5480150 FT /rpt_family="L1" FT repeat_region 5480151..5480444 FT /rpt_family="Alu" FT repeat_region 5480445..5480774 FT /rpt_family="L1" FT repeat_region 5480775..5481063 FT /rpt_family="Alu" FT repeat_region 5481064..5481109 FT /rpt_family="L1" FT repeat_region 5481326..5481592 FT /rpt_family="L2" FT repeat_region 5481661..5481761 FT /rpt_family="MIR" FT repeat_region 5481901..5482190 FT /rpt_family="Alu" FT repeat_region 5482191..5482322 FT /rpt_family="Alu" FT repeat_region 5483294..5483730 FT /rpt_family="MaLR" FT repeat_region 5483738..5483872 FT /rpt_family="Alu" FT repeat_region 5483873..5484167 FT /rpt_family="Alu" FT repeat_region 5484168..5484465 FT /rpt_family="Alu" FT repeat_region 5484467..5484600 FT /rpt_family="Alu" FT repeat_region 5484601..5484900 FT /rpt_family="Alu" FT repeat_region 5484901..5485085 FT /rpt_family="Alu" FT repeat_region 5485116..5485291 FT /rpt_family="MaLR" FT repeat_region 5485292..5485601 FT /rpt_family="Alu" FT repeat_region 5485602..5485843 FT /rpt_family="MaLR" FT repeat_region 5486749..5486904 FT /rpt_family="Alu" FT repeat_region 5486915..5487170 FT /rpt_family="(TGGA)n" FT repeat_region 5487171..5487209 FT /rpt_family="(TAGA)n" FT repeat_region 5487704..5487987 FT /rpt_family="Alu" FT repeat_region 5488458..5488492 FT /rpt_family="G-rich" FT repeat_region 5488707..5488833 FT /rpt_family="Alu" FT repeat_region 5488835..5489110 FT /rpt_family="(TA)n" FT repeat_region 5489381..5489688 FT /rpt_family="Alu" FT repeat_region 5489689..5489798 FT /rpt_family="Alu" FT repeat_region 5489799..5490102 FT /rpt_family="Alu" FT repeat_region 5490103..5490138 FT /rpt_family="Alu" FT repeat_region 5490186..5490214 FT /rpt_family="MIR" FT repeat_region 5491182..5491322 FT /rpt_family="L2" FT misc_feature 5491543..5491545 FT /note="match to EST BF818449 (NID:g12155767)" FT repeat_region 5491713..5491838 FT /rpt_family="MIR" FT repeat_region 5492364..5492489 FT /rpt_family="(TCTCTG)n" FT repeat_region 5492518..5492647 FT /rpt_family="Alu" FT misc_feature 5492596..5493047 FT /note="match to EST BF818449 (NID:g12155767)" FT repeat_region 5493363..5493485 FT /rpt_family="Alu" FT repeat_region 5493493..5493654 FT /rpt_family="Alu" FT repeat_region 5493655..5493678 FT /rpt_family="(TTTA)n" FT repeat_region 5493679..5493959 FT /rpt_family="Alu" FT repeat_region 5493960..5494070 FT /rpt_family="Alu" FT repeat_region 5494270..5494372 FT /rpt_family="MIR" FT misc_feature 5495358..5495661 FT /note="similar to Homo sapiens EST BG996492 FT (NID:g14400562)" FT repeat_region 5495383..5495418 FT /rpt_family="(CA)n" FT repeat_region 5496062..5496348 FT /rpt_family="L2" FT repeat_region 5496398..5496694 FT /rpt_family="Alu" FT repeat_region 5496892..5496959 FT /rpt_family="MaLR" FT repeat_region 5497021..5497148 FT /rpt_family="MaLR" FT repeat_region 5497921..5498048 FT /rpt_family="Alu" FT repeat_region 5498049..5498342 FT /rpt_family="Alu" FT repeat_region 5498343..5498422 FT /rpt_family="Alu" FT repeat_region 5498496..5498813 FT /rpt_family="Alu" FT repeat_region 5498952..5499089 FT /rpt_family="Alu" FT repeat_region 5499090..5499394 FT /rpt_family="Alu" FT repeat_region 5499395..5499564 FT /rpt_family="Alu" FT repeat_region 5499609..5499904 FT /rpt_family="Alu" FT repeat_region 5500085..5500381 FT /rpt_family="Alu" FT repeat_region 5500841..5500886 FT /rpt_family="L2" FT repeat_region 5500916..5501016 FT /rpt_family="Alu" FT repeat_region 5501020..5501096 FT /rpt_family="Mariner" FT repeat_region 5501100..5501287 FT /rpt_family="Alu" FT repeat_region 5501290..5501597 FT /rpt_family="Alu" FT repeat_region 5501600..5501886 FT /rpt_family="Alu" FT repeat_region 5501887..5501978 FT /rpt_family="MIR" FT repeat_region 5502302..5502600 FT /rpt_family="Alu" FT repeat_region 5502601..5502636 FT /rpt_family="(TA)n" FT repeat_region 5502646..5502968 FT /rpt_family="L1" FT repeat_region 5502970..5503266 FT /rpt_family="Alu" FT repeat_region 5503267..5503335 FT /rpt_family="L1" FT repeat_region 5503336..5503662 FT /rpt_family="Alu" FT repeat_region 5503695..5503829 FT /rpt_family="Alu" FT repeat_region 5503830..5504144 FT /rpt_family="Alu" FT repeat_region 5504145..5504314 FT /rpt_family="Alu" FT repeat_region 5504326..5504347 FT /rpt_family="AT_rich" FT repeat_region 5504413..5504720 FT /rpt_family="Alu" FT repeat_region 5504832..5505097 FT /rpt_family="Alu" FT repeat_region 5505098..5505127 FT /rpt_family="(ATTG)n" FT repeat_region 5505132..5505223 FT /rpt_family="Alu" FT repeat_region 5505224..5505293 FT /rpt_family="Alu" FT repeat_region 5505300..5505450 FT /rpt_family="L1" FT repeat_region 5505451..5505748 FT /rpt_family="Alu" FT repeat_region 5505749..5505774 FT /rpt_family="L1" FT repeat_region 5505801..5505833 FT /rpt_family="(A)n" FT repeat_region 5505874..5506344 FT /rpt_family="MaLR" FT repeat_region 5506574..5506700 FT /rpt_family="Alu" FT repeat_region 5506701..5507010 FT /rpt_family="Alu" FT repeat_region 5507011..5507194 FT /rpt_family="Alu" FT repeat_region 5507346..5507498 FT /rpt_family="L1" FT misc_feature 5507605..5507630 FT /note="match to EST AW504485 (NID:g7142152)" FT repeat_region 5507614..5507913 FT /rpt_family="Alu" FT repeat_region 5507917..5508047 FT /rpt_family="Alu" FT repeat_region 5508071..5508196 FT /rpt_family="L1" FT repeat_region 5508224..5508529 FT /rpt_family="Alu" FT misc_feature 5508407..5508480 FT /note="match to EST AW504485 (NID:g7142152)" FT repeat_region 5508605..5508735 FT /rpt_family="(TG)n" FT repeat_region 5508772..5509048 FT /rpt_family="Alu" FT repeat_region 5509063..5509185 FT /rpt_family="(TG)n" FT repeat_region 5509450..5509599 FT /rpt_family="(TG)n" FT misc_feature 5509543..5509874 FT /note="match to EST BF884468 (NID:g12274594)" FT repeat_region 5510662..5510734 FT /rpt_family="MIR" FT repeat_region 5510935..5511206 FT /rpt_family="Alu" FT misc_feature 5511122..5511542 FT /note="match to EST AA707289 (NID:g2717207) ag84f11.r1" FT repeat_region 5511207..5511308 FT /rpt_family="Alu" FT repeat_region 5511462..5511728 FT /rpt_family="Alu" FT repeat_region 5511872..5512186 FT /rpt_family="MaLR" FT repeat_region 5512235..5512498 FT /rpt_family="MaLR" FT misc_feature 5513053..5513060 FT /note="match to EST BF893043 (NID:g12284489)" FT repeat_region 5513112..5513410 FT /rpt_family="Alu" FT repeat_region 5513433..5513727 FT /rpt_family="Alu" FT repeat_region 5513730..5513941 FT /rpt_family="L1" FT repeat_region 5513942..5514246 FT /rpt_family="Alu" FT repeat_region 5514247..5514287 FT /rpt_family="L1" FT repeat_region 5514311..5514638 FT /rpt_family="Alu" FT repeat_region 5514670..5514974 FT /rpt_family="Alu" FT misc_feature 5515319..5515618 FT /note="match to EST AA077734 (NID:g1837222)" FT misc_feature 5515429..5515924 FT /note="match to EST BM129046 (NID:g17123598) if16g11.y1" FT misc_feature 5515432..5516132 FT /note="similar to EST BM681364 (NID:g18991260)" FT misc_feature 5515432..5515888 FT /note="similar to EST BM674550 (NID:g18984448)" FT misc_feature 5515435..5515684 FT /note="match to EST AA534800 (NID:g2279053) nf81g01.s1" FT misc_feature 5515481..5516200 FT /note="match to EST BG577160 (NID:g13584826)" FT misc_feature 5515528..5515635 FT /note="similar to EST BM698313 (NID:g19011571)" FT misc_feature 5515641..5515865 FT /note="match to EST BF737730 (NID:g12064406)" FT misc_feature 5515693..5516160 FT /note="similar to EST BM728187 (NID:g19049520)" FT misc_feature 5515695..5516401 FT /note="match to EST BG255934 (NID:g12765750)" FT misc_feature 5515962..5516579 FT /note="similar to Homo sapiens EST BI600082 FT (NID:g15493021)" FT repeat_region 5516089..5516399 FT /rpt_family="Alu" FT misc_feature 5516456..5516944 FT /note="match to EST BG403329 (NID:g13296777)" FT repeat_region 5516515..5516817 FT /rpt_family="Alu" FT misc_feature 5516549..5516780 FT /note="match to EST AA114172 (NID:g1668058) zn75d03.s1" FT repeat_region 5517053..5517350 FT /rpt_family="Alu" FT misc_feature 5517076..5517140 FT /note="match to EST BG110372 (NID:g12603878)" FT misc_feature 5517228..5517570 FT /note="match to EST AA114172 (NID:g1668058) zn75d03.s1" FT misc_feature 5517261..5517937 FT /note="match to EST BG750330 (NID:g14060983)" FT misc_feature 5517665..5518116 FT /note="match to EST AA114208 (NID:g1668101) zn75d03.r1" FT misc_feature 5518264..5518266 FT /note="match to EST BG750330 (NID:g14060983)" FT repeat_region 5518324..5518512 FT /rpt_family="(CACG)n" FT misc_feature 5518452..5519148 FT /note="match to EST BI194572 (NID:g14649592)" FT misc_feature 5518470..5518916 FT /note="similar to Sus scrofa EST BF188985 (NID:g11072354)" FT misc_feature 5518754..5519442 FT /note="match to EST AU132673 (NID:g10993212)" FT misc_feature 5518996..5519255 FT /note="similar to Homo sapiens EST BF765943 FT (NID:g12113843)" FT repeat_region 5520059..5520146 FT /rpt_family="Alu" FT misc_feature 5520151..5520593 FT /note="match to EST AW504485 (NID:g7142152)" FT repeat_region 5520159..5520180 FT /rpt_family="(TA)n" FT repeat_region 5520183..5520492 FT /rpt_family="Alu" FT misc_feature 5520200..5520586 FT /note="match to EST AA879053 (NID:g2988018) nw87h03.s1" FT misc_feature 5520549..5520843 FT /note="match to EST BG110372 (NID:g12603878)" FT misc_feature 5520605..5521212 FT /note="match to EST BM045673 (NID:g16774940)" FT misc_feature 5520723..5521438 FT /note="match to EST BG393508 (NID:g13286956)" FT misc_feature 5521139 FT /note="match to EST AI205037 (NID:g3758099) an04a11.x1" FT misc_feature 5521253..5521506 FT /note="match to EST AI205037 (NID:g3758099) an04a11.x1" FT misc_feature 5521369..5521562 FT /note="similar to Mus musculus EST BI683602 FT (NID:g15646230)" FT misc_feature 5521424..5521562 FT /note="match to EST BE277573 (NID:g9152544)" FT repeat_region 5522203..5522279 FT /rpt_family="MIR" FT repeat_region 5522397..5522697 FT /rpt_family="Alu" FT repeat_region 5522790..5523089 FT /rpt_family="Alu" FT repeat_region 5523094..5523396 FT /rpt_family="Alu" FT misc_feature 5523442..5523686 FT /note="similar to Homo sapiens EST BF878482 FT (NID:g12268612)" FT repeat_region 5523817..5524120 FT /rpt_family="Alu" FT repeat_region 5524146..5524270 FT /rpt_family="Alu" FT repeat_region 5524271..5524569 FT /rpt_family="Alu" FT repeat_region 5524570..5524712 FT /rpt_family="Alu" FT repeat_region 5525025..5525134 FT /rpt_family="U13" FT repeat_region 5525136..5525158 FT /rpt_family="AT_rich" FT repeat_region 5525163..5525256 FT /rpt_family="Alu" FT repeat_region 5525257..5525400 FT /rpt_family="Alu" FT repeat_region 5525401..5525732 FT /rpt_family="Alu" FT repeat_region 5525738..5526078 FT /rpt_family="Alu" FT repeat_region 5526080..5526312 FT /rpt_family="Alu" FT repeat_region 5527238..5527339 FT /rpt_family="MIR" FT repeat_region 5528984..5529119 FT /rpt_family="Alu" FT repeat_region 5529120..5529437 FT /rpt_family="Alu" FT repeat_region 5529438..5529598 FT /rpt_family="Alu" FT misc_feature 5529651..5529898 FT /note="match to EST H77667 (NID:g1055756) yu24g09.s1" FT misc_feature 5529839..5530318 FT /note="match to EST BE066632 (NID:g8411282)" FT misc_feature 5530078..5530505 FT /note="match to EST H77666 (NID:g1055755) yu24g09.r1" FT repeat_region 5530314..5530617 FT /rpt_family="Alu" FT misc_feature 5530513 FT /note="match to EST H77666 (NID:g1055755) yu24g09.r1" FT misc_feature 5530621..5530955 FT /note="match to EST BF880876 (NID:g12271002)" FT misc_feature 5530862..5531080 FT /note="match to EST BE277573 (NID:g9152544)" FT /note="similar to Mus musculus EST BI683602 FT (NID:g15646230)" FT misc_feature 5530892..5531080 FT /note="match to EST AU117545 (NID:g10932521)" FT repeat_region 5532153..5532603 FT /rpt_family="MaLR" FT repeat_region 5532687..5532957 FT /rpt_family="Alu" FT repeat_region 5532958..5533225 FT /rpt_family="Alu" FT repeat_region 5533276..5533286 FT /rpt_family="Alu" FT repeat_region 5533287..5533328 FT /rpt_family="(TG)n" FT repeat_region 5533329..5533443 FT /rpt_family="Alu" FT repeat_region 5533483..5533621 FT /rpt_family="Alu" FT repeat_region 5533622..5533920 FT /rpt_family="Alu" FT repeat_region 5533921..5534086 FT /rpt_family="Alu" FT repeat_region 5534087..5534108 FT /rpt_family="AT_rich" FT misc_feature 5534131..5534518 FT /note="match to EST AA730130 (NID:g2751412) nx38c08.s1" FT misc_feature 5534593..5534926 FT /note="match to EST BF893043 (NID:g12284489)" FT repeat_region 5535759..5535901 FT /rpt_family="MIR" FT repeat_region 5535949..5536186 FT /rpt_family="L2" FT repeat_region 5536231..5536374 FT /rpt_family="Alu" FT repeat_region 5536375..5536682 FT /rpt_family="Alu" FT repeat_region 5536683..5536842 FT /rpt_family="Alu" FT repeat_region 5537358..5537499 FT /rpt_family="MIR" FT repeat_region 5537698..5538016 FT /rpt_family="Alu" FT repeat_region 5538122..5538190 FT /rpt_family="Alu" FT repeat_region 5538199..5538222 FT /rpt_family="(TTTTC)n" FT repeat_region 5538226..5538499 FT /rpt_family="Alu" FT repeat_region 5539078..5539391 FT /rpt_family="Alu" FT repeat_region 5539403..5539717 FT /rpt_family="Alu" FT repeat_region 5539768..5539807 FT /rpt_family="MIR" FT misc_feature 5539956..5540165 FT /note="similar to Homo sapiens EST BF756774 FT (NID:g12104674)" FT misc_feature 5540119..5540630 FT /note="match to EST AU117545 (NID:g10932521)" FT misc_feature 5540119..5540480 FT /note="match to EST BE277573 (NID:g9152544)" FT misc_feature 5540119..5540264 FT /note="similar to Mus musculus EST BI683602 FT (NID:g15646230)" FT misc_feature 5540299..5540727 FT /note="similar to Rattus norvegicus EST BF563222 FT (NID:g11672952)" FT repeat_region 5540580..5540617 FT /rpt_family="GC_rich" FT misc_feature 5540635..5541379 FT /note="match to EST BF568161 (NID:g11641456)" FT misc_feature 5540649..5541563 FT /note="similar to Mus musculus EST BI853840 FT (NID:g15994587)" FT misc_feature 5541083..5541606 FT /note="match to EST BF881238 (NID:g12271364)" FT misc_feature 5541156..5541662 FT /note="match to EST BG830625 (NID:g14178212)" FT misc_feature 5541185..5541662 FT /note="match to EST BE728487 (NID:g10142479)" FT misc_feature 5541514..5541662 FT /note="similar to Homo sapiens EST BF027561 FT (NID:g10735273)" FT misc_feature 5541534..5541662 FT /note="similar to Mus musculus EST AW762027 (NID:g7693944) FT ur52g09.y1" FT repeat_region 5541839..5541887 FT /rpt_family="L1" FT repeat_region 5541888..5542179 FT /rpt_family="Alu" FT repeat_region 5542180..5542479 FT /rpt_family="Alu" FT repeat_region 5542480..5542726 FT /rpt_family="L1" FT repeat_region 5542731..5542989 FT /rpt_family="Alu" FT repeat_region 5542990..5543290 FT /rpt_family="Alu" FT repeat_region 5543291..5543311 FT /rpt_family="AT_rich" FT repeat_region 5543318..5543612 FT /rpt_family="Alu" FT repeat_region complement(5738063..5738323) FT /rpt_family="Alu" FT repeat_region complement(5738016..5738060) FT /rpt_family="(TG)n" FT repeat_region complement(5737226..5737277) FT /rpt_family="Alu" FT repeat_region complement(5737177..5737242) FT /rpt_family="Alu" FT repeat_region complement(5734768..5734861) FT /rpt_family="MIR" FT variation complement(5734457) FT /allele="T" FT /allele="C" FT repeat_region complement(5732750..5732969) FT /rpt_family="MER1_type" FT repeat_region complement(5732622..5732749) FT /rpt_family="L1" FT repeat_region complement(5730216..5730361) FT /rpt_family="MIR" FT repeat_region complement(5729674..5729976) FT /rpt_family="Alu" FT repeat_region complement(5729302..5729590) FT /rpt_family="Alu" FT repeat_region complement(5728994..5729025) FT /rpt_family="(T)n" FT repeat_region complement(5727423..5727543) FT /rpt_family="MIR" FT repeat_region complement(5727136..5727220) FT /rpt_family="CR1" FT repeat_region complement(5726745..5727055) FT /rpt_family="Alu" FT repeat_region complement(5726360..5726611) FT /rpt_family="MER1_type" FT repeat_region complement(5725980..5726086) FT /rpt_family="MIR" FT repeat_region complement(5725572..5725879) FT /rpt_family="Alu" FT repeat_region complement(5725177..5725262) FT /rpt_family="L2" FT repeat_region complement(5723723..5724037) FT /rpt_family="Alu" FT repeat_region complement(5723267..5723383) FT /rpt_family="MIR" FT repeat_region complement(5722927..5723023) FT /rpt_family="Alu" FT repeat_region complement(5722759..5722786) FT /rpt_family="(TTTG)n" FT repeat_region complement(5722387..5722758) FT /rpt_family="L1" FT repeat_region complement(5722030..5722336) FT /rpt_family="Alu" FT repeat_region complement(5720332..5720551) FT /rpt_family="L2" FT repeat_region complement(5720033..5720331) FT /rpt_family="Alu" FT repeat_region complement(5719626..5719744) FT /rpt_family="L2" FT repeat_region complement(5718721..5718920) FT /rpt_family="MIR" FT repeat_region complement(5718114..5718248) FT /rpt_family="MIR" FT repeat_region complement(5715641..5715934) FT /rpt_family="Alu" FT repeat_region complement(5715343..5715639) FT /rpt_family="Alu" FT repeat_region complement(5715271..5715301) FT /rpt_family="(TTTG)n" FT repeat_region complement(5714991..5715269) FT /rpt_family="Alu" FT repeat_region complement(5714799..5714881) FT /rpt_family="MIR" FT repeat_region complement(5714381..5714648) FT /rpt_family="Alu" FT repeat_region complement(5714088..5714285) FT /rpt_family="Alu" FT repeat_region complement(5713954..5714087) FT /rpt_family="Alu" FT variation complement(5714023) FT /allele="C" FT /allele="A" FT repeat_region complement(5713665..5713953) FT /rpt_family="Alu" FT repeat_region complement(5713480..5713664) FT /rpt_family="Alu" FT variation complement(5713515) FT /allele="A" FT /allele="G" FT repeat_region complement(5713362..5713479) FT /rpt_family="Alu" FT repeat_region complement(5713311..5713361) FT /rpt_family="Alu" FT repeat_region complement(5711461..5711676) FT /rpt_family="MaLR" FT variation complement(5711463) FT /allele="C" FT /allele="A" FT repeat_region complement(5711154..5711460) FT /rpt_family="Alu" FT repeat_region complement(5710982..5711153) FT /rpt_family="MaLR" FT repeat_region complement(5709743..5709864) FT /rpt_family="Alu" FT repeat_region complement(5709722..5709742) FT /rpt_family="(TAAA)n" FT repeat_region complement(5709563..5709721) FT /rpt_family="Alu" FT repeat_region complement(5709242..5709527) FT /rpt_family="Alu" FT repeat_region complement(5707856..5708153) FT /rpt_family="Alu" FT repeat_region complement(5706821..5706972) FT /rpt_family="MER1_type" FT repeat_region complement(5706446..5706736) FT /rpt_family="Alu" FT repeat_region complement(5705883..5706097) FT /rpt_family="L2" FT repeat_region complement(5705515..5705816) FT /rpt_family="Alu" FT repeat_region complement(5704423..5704728) FT /rpt_family="Alu" FT repeat_region complement(5703250..5703553) FT /rpt_family="Alu" FT repeat_region complement(5702930..5703239) FT /rpt_family="Alu" FT repeat_region complement(5702349..5702547) FT /rpt_family="L2" FT repeat_region complement(5701455..5701511) FT /rpt_family="MIR" FT repeat_region complement(5701152..5701454) FT /rpt_family="Alu" FT repeat_region complement(5701067..5701151) FT /rpt_family="MIR" FT repeat_region complement(5700882..5701018) FT /rpt_family="Alu" FT repeat_region complement(5700575..5700870) FT /rpt_family="Alu" FT repeat_region complement(5700226..5700500) FT /rpt_family="Alu" FT repeat_region complement(5699912..5700208) FT /rpt_family="Alu" FT repeat_region complement(5699584..5699883) FT /rpt_family="Alu" FT variation complement(5699555) FT /allele="C" FT /allele="A" FT repeat_region complement(5698965..5699130) FT /rpt_family="L2" FT repeat_region complement(5698814..5698959) FT /rpt_family="L2" FT repeat_region complement(5698307..5698500) FT /rpt_family="MER1_type" FT repeat_region complement(5698006..5698306) FT /rpt_family="Alu" FT variation complement(5698056) FT /allele="T" FT /allele="C" FT repeat_region complement(5697764..5698005) FT /rpt_family="MER1_type" FT variation complement(5697928) FT /allele="C" FT /allele="T" FT variation complement(5697579) FT /allele="T" FT /allele="G" FT variation complement(5697329) FT /allele="T" FT /allele="C" FT repeat_region complement(5696917..5697222) FT /rpt_family="Alu" FT variation complement(5696125) FT /allele="C" FT /allele="T" FT repeat_region complement(5695950..5695964) FT /rpt_family="Alu" FT repeat_region complement(5695915..5695949) FT /rpt_family="Alu" FT repeat_region complement(5695634..5695914) FT /rpt_family="Alu" FT repeat_region complement(5695497..5695627) FT /rpt_family="Alu" FT variation complement(5695267) FT /allele="C" FT /allele="A" FT repeat_region complement(5694979..5695265) FT /rpt_family="Alu" FT repeat_region complement(5694032..5694344) FT /rpt_family="Alu" FT repeat_region complement(5693569..5693836) FT /rpt_family="L2" FT variation complement(5693543) FT /allele="A" FT /allele="G" FT repeat_region complement(5693359..5693514) FT /rpt_family="L2" FT repeat_region complement(5692940..5693258) FT /rpt_family="Alu" FT variation complement(5692486) FT /allele="A" FT /allele="G" FT repeat_region complement(5692323..5692436) FT /rpt_family="Alu" FT variation complement(5691940) FT /allele="G" FT /allele="A" FT repeat_region complement(5691878..5691925) FT /rpt_family="MIR" FT repeat_region complement(5691277..5691577) FT /rpt_family="Alu" FT repeat_region complement(5690854..5691162) FT /rpt_family="Alu" FT variation complement(5690690) FT /allele="C" FT /allele="T" FT repeat_region complement(5690461..5690505) FT /rpt_family="MIR" FT repeat_region complement(5690106..5690441) FT /rpt_family="MaLR" FT repeat_region complement(5689564..5689947) FT /rpt_family="ERVL" FT variation complement(5689622) FT /allele="T" FT /allele="C" FT repeat_region complement(5689377..5689522) FT /rpt_family="ERVL" FT repeat_region complement(5689047..5689155) FT /rpt_family="Alu" FT variation complement(5689118) FT /allele="T" FT /allele="G" FT repeat_region complement(5688731..5689041) FT /rpt_family="Alu" FT repeat_region complement(5688477..5688706) FT /rpt_family="L1" FT repeat_region complement(5688389..5688471) FT /rpt_family="L1" FT repeat_region complement(5688075..5688388) FT /rpt_family="Alu" FT repeat_region complement(5688035..5688074) FT /rpt_family="L1" FT repeat_region complement(5687740..5688034) FT /rpt_family="Alu" FT repeat_region complement(5687664..5687739) FT /rpt_family="L1" FT repeat_region complement(5687255..5687609) FT /rpt_family="L2" FT repeat_region complement(5686953..5687254) FT /rpt_family="Alu" FT repeat_region complement(5686918..5686952) FT /rpt_family="L2" FT repeat_region complement(5686764..5686851) FT /rpt_family="L1" FT repeat_region complement(5686631..5686759) FT /rpt_family="L1" FT repeat_region complement(5686343..5686627) FT /rpt_family="L1" FT repeat_region complement(5686043..5686340) FT /rpt_family="Alu" FT repeat_region complement(5686004..5686038) FT /rpt_family="(TTTTG)n" FT repeat_region complement(5685848..5686002) FT /rpt_family="Alu" FT repeat_region complement(5685521..5685847) FT /rpt_family="L1" FT repeat_region complement(5685215..5685520) FT /rpt_family="Alu" FT variation complement(5685254) FT /allele="G" FT /allele="C" FT repeat_region complement(5684749..5685214) FT /rpt_family="L1" FT repeat_region complement(5684446..5684745) FT /rpt_family="Alu" FT repeat_region complement(5684143..5684436) FT /rpt_family="Alu" FT variation complement(5684201) FT /allele="A" FT /allele="G" FT repeat_region complement(5683303..5684142) FT /rpt_family="L1" FT variation complement(5684019) FT /allele="C" FT /allele="T" FT repeat_region complement(5682158..5682409) FT /rpt_family="Alu" FT variation complement(5682193) FT /allele="G" FT /allele="A" FT repeat_region complement(5681839..5682145) FT /rpt_family="Alu" FT repeat_region complement(5681384..5681692) FT /rpt_family="Alu" FT variation complement(5681677) FT /allele="G" FT /allele="A" FT repeat_region complement(5681130..5681322) FT /rpt_family="MIR" FT repeat_region complement(5680279..5680484) FT /rpt_family="L1" FT repeat_region complement(5679693..5679828) FT /rpt_family="Alu" FT repeat_region complement(5679395..5679689) FT /rpt_family="Alu" FT variation complement(5679483) FT /allele="T" FT /allele="C" FT repeat_region complement(5679102..5679390) FT /rpt_family="Alu" FT repeat_region complement(5679054..5679096) FT /rpt_family="Alu" FT repeat_region complement(5678693..5679037) FT /rpt_family="MaLR" FT repeat_region complement(5678265..5678558) FT /rpt_family="Alu" FT repeat_region complement(5677892..5678074) FT /rpt_family="L1" FT repeat_region complement(5677482..5677613) FT /rpt_family="Alu" FT repeat_region complement(5677179..5677471) FT /rpt_family="Alu" FT variation complement(5676119) FT /allele="T" FT /allele="C" FT variation complement(5675700) FT /allele="A" FT /allele="G" FT variation complement(5675305) FT /allele="T" FT /allele="C" FT variation complement(5675101) FT /allele="A" FT /allele="G" FT repeat_region complement(5674661..5674773) FT /rpt_family="MIR" FT variation complement(5674709) FT /allele="C" FT /allele="T" FT repeat_region complement(5672925..5673233) FT /rpt_family="Alu" FT repeat_region complement(5672615..5672907) FT /rpt_family="Alu" FT variation complement(5672469) FT /allele="T" FT /allele="C" FT repeat_region complement(5672185..5672420) FT /rpt_family="Alu" FT repeat_region complement(5671331..5671458) FT /rpt_family="L1" FT repeat_region complement(5670742..5670774) FT /rpt_family="T-rich" FT repeat_region complement(5670360..5670552) FT /rpt_family="MIR" FT repeat_region complement(5670016..5670323) FT /rpt_family="Alu" FT repeat_region complement(5669178..5669482) FT /rpt_family="Alu" FT repeat_region complement(5669112..5669171) FT /rpt_family="L1" FT repeat_region complement(5668852..5669102) FT /rpt_family="Alu" FT repeat_region complement(5668545..5668843) FT /rpt_family="Alu" FT repeat_region complement(5668155..5668453) FT /rpt_family="Alu" FT repeat_region complement(5668089..5668118) FT /rpt_family="AT_rich" FT repeat_region complement(5667106..5667391) FT /rpt_family="Alu" FT repeat_region complement(5666740..5666851) FT /rpt_family="MIR" FT repeat_region complement(5666367..5666500) FT /rpt_family="MIR" FT repeat_region complement(5666247..5666330) FT /rpt_family="Alu" FT repeat_region complement(5666116..5666245) FT /rpt_family="Alu" FT repeat_region complement(5666031..5666069) FT /rpt_family="T-rich" FT repeat_region complement(5665730..5665872) FT /rpt_family="CR1" FT repeat_region complement(5665504..5665586) FT /rpt_family="MIR" FT repeat_region complement(5665282..5665371) FT /rpt_family="L2" FT repeat_region complement(5663146..5663364) FT /rpt_family="Alu" FT repeat_region complement(5663097..5663145) FT /rpt_family="Alu" FT variation complement(5661636) FT /allele="C" FT /allele="T" FT variation complement(5661411) FT /allele="C" FT /allele="G" FT repeat_region complement(5660803..5661081) FT /rpt_family="Alu" FT variation complement(5661028) FT /allele="C" FT /allele="T" FT variation complement(5660934) FT /allele="T" FT /allele="C" FT variation complement(5660803) FT /allele="A" FT /allele="T" FT variation complement(5660686) FT /allele="A" FT /allele="G" FT variation complement(5660057) FT /allele="T" FT /allele="A" FT variation complement(5659785) FT /allele="A" FT /allele="T" FT variation complement(5659385) FT /allele="A" FT /allele="G" FT repeat_region complement(5658629..5658921) FT /rpt_family="Alu" FT repeat_region complement(5657983..5658278) FT /rpt_family="Alu" FT variation complement(5658105) FT /allele="G" FT /allele="A" FT repeat_region complement(5657849..5657980) FT /rpt_family="Alu" FT repeat_region complement(5657632..5657786) FT /rpt_family="Alu" FT repeat_region complement(5657341..5657631) FT /rpt_family="Alu" FT repeat_region complement(5657238..5657340) FT /rpt_family="Alu" FT repeat_region complement(5656901..5657201) FT /rpt_family="Alu" FT repeat_region complement(5656809..5656887) FT /rpt_family="Alu" FT variation complement(5656875) FT /allele="C" FT /allele="T" FT repeat_region complement(5656494..5656785) FT /rpt_family="Alu" FT repeat_region complement(5655988..5656288) FT /rpt_family="Alu" FT repeat_region complement(5653819..5654104) FT /rpt_family="Alu" FT repeat_region complement(5653242..5653276) FT /rpt_family="(TC)n" FT repeat_region complement(5652885..5653196) FT /rpt_family="Alu" FT repeat_region complement(5651819..5652116) FT /rpt_family="Alu" FT repeat_region complement(5651527..5651818) FT /rpt_family="Alu" FT repeat_region complement(5651448..5651459) FT /rpt_family="Alu" FT repeat_region complement(5651148..5651447) FT /rpt_family="Alu" FT repeat_region complement(5650905..5651146) FT /rpt_family="Alu" FT repeat_region complement(5650729..5650904) FT /rpt_family="Alu" FT variation complement(5650826) FT /allele="A" FT /allele="G" FT variation complement(5650785) FT /allele="T" FT /allele="G" FT variation complement(5650610) FT /allele="C" FT /allele="G" FT repeat_region complement(5649774..5650061) FT /rpt_family="Alu" FT repeat_region complement(5649694..5649737) FT /rpt_family="Alu" FT repeat_region complement(5649481..5649693) FT /rpt_family="Alu" FT repeat_region complement(5649444..5649480) FT /rpt_family="Alu" FT variation complement(5649416) FT /allele="C" FT /allele="G" FT repeat_region complement(5648818..5649036) FT /rpt_family="Alu" FT repeat_region complement(5648603..5648773) FT /rpt_family="Alu" FT repeat_region complement(5648152..5648275) FT /rpt_family="(CGTG)n" FT variation complement(5647988) FT /allele="A" FT /allele="G" FT misc_feature complement(5647658..5647984) FT /note="CpG_island (%GC=68.5, o/e=0.81, #CpGs=25)" FT variation complement(5647422) FT /allele="C" FT /allele="T" FT variation complement(5647351) FT /allele="G" FT /allele="A" FT variation complement(5647349) FT /allele="T" FT /allele="G" FT misc_feature complement(5647105..5647340) FT /note="CpG_island (%GC=70.8, o/e=0.71, #CpGs=22)" FT variation complement(5646756) FT /allele="G" FT /allele="T" FT mRNA join(5632457..5633399,5642888..5643044,5643127..5643248, FT 5643494..5643661,5644903..5646279) FT variation complement(5646192) FT /allele="A" FT /allele="T" FT variation complement(5645617) FT /allele="T" FT /allele="A" FT misc_feature complement(5644924..5645142) FT /note="CpG_island (%GC=67.1, o/e=0.95, #CpGs=21)" FT repeat_region complement(5644568..5644700) FT /rpt_family="Alu" FT repeat_region complement(5644307..5644567) FT /rpt_family="Alu" FT repeat_region complement(5644105..5644306) FT /rpt_family="Alu" FT repeat_region complement(5643899..5643996) FT /rpt_family="C-rich" FT variation complement(5643935) FT /allele="G" FT /allele="A" FT variation complement(5643479) FT /allele="T" FT /allele="C" FT misc_feature complement(5642949..5643184) FT /note="CpG_island (%GC=66.5, o/e=0.83, #CpGs=19)" FT variation complement(5643145) FT /allele="T" FT /allele="C" FT variation complement(5642746) FT /allele="T" FT /allele="C" FT repeat_region complement(5642322..5642640) FT /rpt_family="Alu" FT variation complement(5642631) FT /allele="G" FT /allele="A" FT repeat_region complement(5642137..5642313) FT /rpt_family="L1" FT repeat_region complement(5641839..5641970) FT /rpt_family="Alu" FT variation complement(5641932) FT /allele="T" FT /allele="G" FT repeat_region complement(5641587..5641836) FT /rpt_family="Alu" FT variation complement(5641669) FT /allele="A" FT /allele="C" FT variation complement(5641575) FT /allele="C" FT /allele="T" FT repeat_region complement(5641185..5641483) FT /rpt_family="Alu" FT variation complement(5641302) FT /allele="G" FT /allele="A" FT repeat_region complement(5640822..5641126) FT /rpt_family="Alu" FT variation complement(5640979) FT /allele="G" FT /allele="A" FT repeat_region complement(5640585..5640719) FT /rpt_family="Alu" FT repeat_region complement(5640290..5640584) FT /rpt_family="Alu" FT misc_feature complement(5640315..5640537) FT /note="CpG_island (%GC=57.4, o/e=0.85, #CpGs=17)" FT repeat_region complement(5640138..5640289) FT /rpt_family="Alu" FT repeat_region complement(5639761..5640056) FT /rpt_family="Alu" FT variation complement(5640035) FT /allele="T" FT /allele="A" FT repeat_region complement(5639161..5639448) FT /rpt_family="Alu" FT variation complement(5639233) FT /allele="T" FT /allele="A" FT variation complement(5639126) FT /allele="C" FT /allele="A" FT repeat_region complement(5639027..5639125) FT /rpt_family="MIR" FT variation complement(5638657) FT /allele="G" FT /allele="A" FT variation complement(5638496) FT /allele="T" FT /allele="C" FT variation complement(5638408) FT /allele="G" FT /allele="A" FT variation complement(5638405) FT /allele="G" FT /allele="A" FT variation complement(5637725) FT /allele="T" FT /allele="G" FT variation complement(5637682) FT /allele="G" FT /allele="C" FT repeat_region complement(5637346..5637386) FT /rpt_family="Alu" FT repeat_region complement(5637301..5637345) FT /rpt_family="T-rich" FT repeat_region complement(5637015..5637300) FT /rpt_family="Alu" FT variation complement(5637067) FT /allele="T" FT /allele="C" FT variation complement(5637007) FT /allele="T" FT /allele="A" FT repeat_region complement(5636695..5637006) FT /rpt_family="Alu" FT variation complement(5636618) FT /allele="G" FT /allele="A" FT variation complement(5636611) FT /allele="G" FT /allele="T" FT repeat_region complement(5636348..5636513) FT /rpt_family="L2" FT repeat_region complement(5635996..5636033) FT /rpt_family="MIR" FT repeat_region complement(5635184..5635336) FT /rpt_family="L2" FT repeat_region complement(5634908..5635004) FT /rpt_family="MIR" FT misc_feature complement(5632080..5634555) FT /note="CpG_island (%GC=72.7, o/e=0.87, #CpGs=284)" FT repeat_region complement(5634206..5634229) FT /rpt_family="GC_rich" FT repeat_region complement(5632249..5632329) FT /rpt_family="(CCG)n" FT repeat_region complement(5630834..5630969) FT /rpt_family="Alu" FT repeat_region complement(5630730..5630832) FT /rpt_family="Alu" FT repeat_region complement(5630671..5630729) FT /rpt_family="(TAGA)n" FT repeat_region complement(5630157..5630455) FT /rpt_family="Alu" FT repeat_region complement(5629272..5629451) FT /rpt_family="Alu" FT repeat_region complement(5629106..5629271) FT /rpt_family="Alu" FT misc_feature complement(5628862..5629212) FT /note="CpG_island (%GC=56.4, o/e=0.96, #CpGs=26)" FT repeat_region complement(5628809..5629105) FT /rpt_family="Alu" FT repeat_region complement(5628675..5628808) FT /rpt_family="Alu" FT repeat_region complement(5628542..5628674) FT /rpt_family="Alu" FT variation complement(5628134) FT /allele="C" FT /allele="G" FT variation complement(5628133) FT /allele="G" FT /allele="C" FT repeat_region complement(5627711..5628029) FT /rpt_family="Alu" FT repeat_region complement(5627362..5627677) FT /rpt_family="Alu" FT repeat_region complement(5627079..5627361) FT /rpt_family="Alu" FT variation complement(5626244) FT /allele="C" FT /allele="A" FT repeat_region complement(5625746..5626040) FT /rpt_family="Alu" FT variation complement(5625975) FT /allele="G" FT /allele="A" FT repeat_region complement(5625177..5625215) FT /rpt_family="MER1_type" FT repeat_region complement(5624860..5625176) FT /rpt_family="Alu" FT repeat_region complement(5624795..5624851) FT /rpt_family="Alu" FT repeat_region complement(5624607..5624678) FT /rpt_family="ERV1" FT repeat_region complement(5624073..5624367) FT /rpt_family="Alu" FT repeat_region complement(5623826..5624072) FT /rpt_family="ERV1" FT variation complement(5624052) FT /allele="G" FT /allele="A" FT repeat_region complement(5623687..5623815) FT /rpt_family="Alu" FT repeat_region complement(5623577..5623669) FT /rpt_family="Alu" FT repeat_region complement(5623122..5623576) FT /rpt_family="ERV1" FT repeat_region complement(5622915..5623121) FT /rpt_family="Alu" FT variation complement(5622944) FT /allele="C" FT /allele="T" FT repeat_region complement(5622583..5622891) FT /rpt_family="Alu" FT repeat_region complement(5622205..5622480) FT /rpt_family="MaLR" FT repeat_region complement(5622117..5622191) FT /rpt_family="MER1_type" FT repeat_region complement(5621996..5622095) FT /rpt_family="Alu" FT repeat_region complement(5621696..5621987) FT /rpt_family="Alu" FT repeat_region complement(5621385..5621686) FT /rpt_family="Alu" FT repeat_region complement(5621140..5621359) FT /rpt_family="Alu" FT variation complement(5621289) FT /allele="C" FT /allele="G" FT repeat_region complement(5620431..5620560) FT /rpt_family="MIR" FT repeat_region complement(5620061..5620356) FT /rpt_family="Alu" FT repeat_region complement(5619883..5620057) FT /rpt_family="Alu" FT repeat_region complement(5619579..5619882) FT /rpt_family="Alu" FT repeat_region complement(5619450..5619578) FT /rpt_family="Alu" FT repeat_region complement(5619047..5619257) FT /rpt_family="ERVL" FT repeat_region complement(5618577..5618884) FT /rpt_family="Alu" FT variation complement(5618375) FT /allele="T" FT /allele="C" FT variation complement(5618237) FT /allele="T" FT /allele="C" FT repeat_region complement(5618053..5618091) FT /rpt_family="A-rich" FT repeat_region complement(5617881..5617953) FT /rpt_family="Alu" FT repeat_region complement(5617685..5617785) FT /rpt_family="Alu" FT repeat_region complement(5617357..5617684) FT /rpt_family="Alu" FT repeat_region complement(5617177..5617356) FT /rpt_family="Alu" FT repeat_region complement(5616875..5617167) FT /rpt_family="Alu" FT repeat_region complement(5616773..5616868) FT /rpt_family="Alu" FT repeat_region complement(5616625..5616772) FT /rpt_family="Alu" FT repeat_region complement(5616578..5616604) FT /rpt_family="MER1_type" FT repeat_region complement(5616278..5616577) FT /rpt_family="Alu" FT misc_feature complement(5616281..5616547) FT /note="CpG_island (%GC=59.2, o/e=0.86, #CpGs=19)" FT repeat_region complement(5616176..5616277) FT /rpt_family="MER1_type" FT repeat_region complement(5615850..5616008) FT /rpt_family="Alu" FT repeat_region complement(5615544..5615849) FT /rpt_family="Alu" FT repeat_region complement(5615492..5615543) FT /rpt_family="Alu" FT repeat_region complement(5615394..5615447) FT /rpt_family="Alu" FT repeat_region complement(5615166..5615393) FT /rpt_family="Alu" FT repeat_region complement(5614909..5615165) FT /rpt_family="Alu" FT repeat_region complement(5614490..5614566) FT /rpt_family="C-rich" FT repeat_region complement(5613635..5613928) FT /rpt_family="Alu" FT variation complement(5613750) FT /allele="T" FT /allele="C" FT repeat_region complement(5613492..5613626) FT /rpt_family="Alu" FT repeat_region complement(5613187..5613491) FT /rpt_family="Alu" FT variation complement(5613449) FT /allele="T" FT /allele="C" FT repeat_region complement(5613023..5613186) FT /rpt_family="Alu" FT repeat_region complement(5612691..5612867) FT /rpt_family="Alu" FT repeat_region complement(5612557..5612686) FT /rpt_family="Alu" FT repeat_region complement(5612250..5612550) FT /rpt_family="Alu" FT repeat_region complement(5612073..5612249) FT /rpt_family="L1" FT repeat_region complement(5611787..5612072) FT /rpt_family="Alu" FT repeat_region complement(5611475..5611780) FT /rpt_family="Alu" FT variation complement(5611675) FT /allele="G" FT /allele="C" FT repeat_region complement(5611346..5611474) FT /rpt_family="L1" FT repeat_region complement(5611171..5611344) FT /rpt_family="Alu" FT repeat_region complement(5610791..5611096) FT /rpt_family="Alu" FT repeat_region complement(5610490..5610790) FT /rpt_family="Alu" FT repeat_region complement(5610272..5610344) FT /rpt_family="MIR" FT misc_feature complement(5609726..5610105) FT /note="CpG_island (%GC=68.2, o/e=0.71, #CpGs=34)" FT repeat_region complement(5608684..5608835) FT /rpt_family="Alu" FT repeat_region complement(5608392..5608683) FT /rpt_family="Alu" FT variation complement(5608587) FT /allele="A" FT /allele="G" FT repeat_region complement(5608380..5608391) FT /rpt_family="Alu" FT repeat_region complement(5608069..5608379) FT /rpt_family="Alu" FT variation complement(5608274) FT /allele="C" FT /allele="T" FT repeat_region complement(5607927..5608068) FT /rpt_family="Alu" FT repeat_region complement(5607708..5607840) FT /rpt_family="MIR" FT repeat_region complement(5607071..5607273) FT /rpt_family="Alu" FT repeat_region complement(5606787..5607070) FT /rpt_family="Alu" FT variation complement(5607018) FT /allele="G" FT /allele="A" FT variation complement(5606945) FT /allele="A" FT /allele="G" FT variation complement(5606929) FT /allele="A" FT /allele="G" FT repeat_region complement(5606686..5606786) FT /rpt_family="Alu" FT repeat_region complement(5606526..5606663) FT /rpt_family="Alu" FT variation complement(5606640) FT /allele="C" FT /allele="T" FT repeat_region complement(5606387..5606522) FT /rpt_family="Alu" FT repeat_region complement(5606252..5606386) FT /rpt_family="Alu" FT variation complement(5606274) FT /allele="C" FT /allele="A" FT repeat_region complement(5605972..5606251) FT /rpt_family="Alu" FT repeat_region complement(5605794..5605971) FT /rpt_family="Alu" FT repeat_region complement(5605621..5605793) FT /rpt_family="Alu" FT repeat_region complement(5605320..5605620) FT /rpt_family="Alu" FT variation complement(5605411) FT /allele="G" FT /allele="A" FT repeat_region complement(5605175..5605319) FT /rpt_family="Alu" FT repeat_region complement(5605141..5605174) FT /rpt_family="(TAAA)n" FT repeat_region complement(5604907..5605095) FT /rpt_family="ERV1" FT repeat_region complement(5604806..5604871) FT /rpt_family="CT-rich" FT repeat_region complement(5604626..5604805) FT /rpt_family="Alu" FT repeat_region complement(5604328..5604625) FT /rpt_family="Alu" FT variation complement(5604561) FT /allele="T" FT /allele="C" FT repeat_region complement(5604085..5604262) FT /rpt_family="Alu" FT repeat_region complement(5603780..5604082) FT /rpt_family="Alu" FT variation complement(5603877) FT /allele="C" FT /allele="T" FT misc_feature complement(5603314..5603858) FT /note="CpG_island (%GC=61.5, o/e=0.72, #CpGs=38)" FT repeat_region complement(5603467..5603753) FT /rpt_family="Alu" FT misc_feature complement(5601803..5602652) FT /note="CpG_island (%GC=63.9, o/e=0.71, #CpGs=58)" FT variation complement(5602012) FT /allele="T" FT /allele="A" FT repeat_region complement(5601699..5601855) FT /rpt_family="ERVL" FT repeat_region complement(5601600..5601642) FT /rpt_family="L1" FT repeat_region complement(5601352..5601598) FT /rpt_family="Alu" FT repeat_region complement(5600884..5601176) FT /rpt_family="Alu" FT repeat_region complement(5600848..5600868) FT /rpt_family="AT_rich" FT variation complement(5600683) FT /allele="A" FT /allele="C" FT repeat_region complement(5600217..5600331) FT /rpt_family="Alu" FT repeat_region complement(5599910..5600214) FT /rpt_family="Alu" FT repeat_region complement(5599721..5599887) FT /rpt_family="Alu" FT repeat_region complement(5599248..5599322) FT /rpt_family="MIR" FT repeat_region complement(5598942..5599246) FT /rpt_family="Alu" FT repeat_region complement(5598898..5598941) FT /rpt_family="MIR" FT repeat_region complement(5598037..5598335) FT /rpt_family="Alu" FT repeat_region complement(5597591..5597628) FT /rpt_family="(CAGGA)n" FT repeat_region complement(5597266..5597414) FT /rpt_family="MIR" FT repeat_region complement(5596938..5597215) FT /rpt_family="Alu" FT variation complement(5596849) FT /allele="G" FT /allele="A" FT repeat_region complement(5596644..5596782) FT /rpt_family="L1" FT misc_feature complement(5594654..5596540) FT /note="CpG_island (%GC=70.0, o/e=0.80, #CpGs=164)" FT repeat_region complement(5595918..5595986) FT /rpt_family="GC_rich" FT repeat_region complement(5595365..5595450) FT /rpt_family="MIR" FT variation complement(5595166) FT /allele="A" FT /allele="G" FT repeat_region complement(5594810..5594871) FT /rpt_family="GC_rich" FT repeat_region complement(5594421..5594459) FT /rpt_family="(CA)n" FT repeat_region complement(5593795..5594104) FT /rpt_family="Alu" FT repeat_region complement(5593652..5593785) FT /rpt_family="Alu" FT repeat_region complement(5593352..5593647) FT /rpt_family="Alu" FT variation complement(5593624) FT /allele="C" FT /allele="A" FT repeat_region complement(5593285..5593351) FT /rpt_family="Alu" FT repeat_region complement(5592685..5592966) FT /rpt_family="Alu" FT variation complement(5592436) FT /allele="G" FT /allele="A" FT repeat_region complement(5591998..5592317) FT /rpt_family="Alu" FT repeat_region complement(5591966..5591997) FT /rpt_family="MIR" FT repeat_region complement(5591967..5591995) FT /rpt_family="MIR" FT repeat_region complement(5591636..5591747) FT /rpt_family="Alu" FT repeat_region complement(5591202..5591512) FT /rpt_family="Alu" FT variation complement(5591498) FT /allele="T" FT /allele="A" FT variation complement(5591495) FT /allele="T" FT /allele="A" FT repeat_region complement(5590884..5591189) FT /rpt_family="Alu" FT variation complement(5590842) FT /allele="G" FT /allele="C" FT variation complement(5590841) FT /allele="G" FT /allele="C" FT repeat_region complement(5590683..5590745) FT /rpt_family="L2" FT repeat_region complement(5590517..5590575) FT /rpt_family="MIR" FT variation complement(5590478) FT /allele="C" FT /allele="A" FT repeat_region complement(5589701..5589998) FT /rpt_family="Alu" FT variation complement(5589955) FT /allele="C" FT /allele="G" FT variation complement(5589843) FT /allele="A" FT /allele="G" FT repeat_region complement(5589516..5589699) FT /rpt_family="Alu" FT repeat_region complement(5589253..5589373) FT /rpt_family="L2" FT variation complement(5589247) FT /allele="C" FT /allele="G" FT repeat_region complement(5588711..5588840) FT /rpt_family="(TCCC)n" FT repeat_region complement(5588528..5588710) FT /rpt_family="(TCCC)n" FT variation complement(5588584) FT /allele="A" FT /allele="G" FT variation complement(5588558) FT /allele="G" FT /allele="A" FT repeat_region complement(5588169..5588304) FT /rpt_family="Alu" FT repeat_region complement(5587858..5588168) FT /rpt_family="Alu" FT repeat_region complement(5587692..5587857) FT /rpt_family="Alu" FT repeat_region complement(5587510..5587586) FT /rpt_family="L2" FT repeat_region complement(5587313..5587497) FT /rpt_family="L2" FT repeat_region complement(5587036..5587308) FT /rpt_family="Alu" FT repeat_region complement(5586971..5587017) FT /rpt_family="(TGGA)n" FT repeat_region complement(5586667..5586968) FT /rpt_family="Alu" FT repeat_region complement(5586420..5586630) FT /rpt_family="ERVL" FT repeat_region complement(5585485..5585775) FT /rpt_family="Alu" FT variation complement(5585775) FT /allele="T" FT /allele="A" FT repeat_region complement(5584811..5584836) FT /rpt_family="(TTCA)n" FT repeat_region complement(5584659..5584799) FT /rpt_family="Alu" FT variation complement(5584599) FT /allele="A" FT /allele="G" FT repeat_region complement(5584288..5584598) FT /rpt_family="Alu" FT repeat_region complement(5583848..5584144) FT /rpt_family="Alu" FT repeat_region complement(5583550..5583841) FT /rpt_family="Alu" FT variation complement(5583447) FT /allele="A" FT /allele="C" FT repeat_region complement(5583166..5583446) FT /rpt_family="Alu" FT variation complement(5583056) FT /allele="C" FT /allele="T" FT variation complement(5583045) FT /allele="A" FT /allele="T" FT variation complement(5582974) FT /allele="G" FT /allele="A" FT variation complement(5582940) FT /allele="G" FT /allele="C" FT repeat_region complement(5582630..5582933) FT /rpt_family="Alu" FT repeat_region complement(5582051..5582344) FT /rpt_family="Alu" FT repeat_region complement(5581724..5582012) FT /rpt_family="Alu" FT repeat_region complement(5581068..5581128) FT /rpt_family="MIR" FT repeat_region complement(5580812..5581011) FT /rpt_family="MIR" FT repeat_region complement(5580585..5580610) FT /rpt_family="AT_rich" FT repeat_region complement(5580297..5580563) FT /rpt_family="Alu" FT repeat_region complement(5580163..5580283) FT /rpt_family="Alu" FT repeat_region complement(5579920..5580161) FT /rpt_family="Alu" FT repeat_region complement(5579423..5579735) FT /rpt_family="Alu" FT repeat_region complement(5579096..5579414) FT /rpt_family="Alu" FT variation complement(5579230) FT /allele="T" FT /allele="C" FT repeat_region complement(5578302..5578483) FT /rpt_family="(TG)n" FT repeat_region complement(5577652..5577948) FT /rpt_family="Alu" FT repeat_region complement(5577337..5577622) FT /rpt_family="Alu" FT repeat_region complement(5577185..5577322) FT /rpt_family="Alu" FT repeat_region complement(5576866..5577173) FT /rpt_family="Alu" FT repeat_region complement(5576452..5576526) FT /rpt_family="L2" FT repeat_region complement(5576415..5576436) FT /rpt_family="AT_rich" FT repeat_region complement(5576078..5576414) FT /rpt_family="Alu" FT repeat_region complement(5575783..5576077) FT /rpt_family="Alu" FT repeat_region complement(5575483..5575780) FT /rpt_family="Alu" FT variation complement(5575772) FT /allele="T" FT /allele="C" FT variation complement(5575542) FT /allele="A" FT /allele="G" FT variation complement(5575520) FT /allele="A" FT /allele="G" FT variation complement(5575511) FT /allele="T" FT /allele="C" FT repeat_region complement(5575457..5575479) FT /rpt_family="(TAAA)n" FT repeat_region complement(5575114..5575452) FT /rpt_family="Alu" FT repeat_region complement(5574800..5575109) FT /rpt_family="Alu" FT repeat_region complement(5574758..5574780) FT /rpt_family="AT_rich" FT repeat_region complement(5574432..5574737) FT /rpt_family="Alu" FT repeat_region complement(5574092..5574393) FT /rpt_family="Alu" FT repeat_region complement(5573773..5574066) FT /rpt_family="Alu" FT variation complement(5573946) FT /allele="A" FT /allele="G" FT variation complement(5573616) FT /allele="G" FT /allele="A" FT repeat_region complement(5573044..5573329) FT /rpt_family="Alu" FT variation complement(5571625) FT /allele="T" FT /allele="C" FT variation complement(5571088) FT /allele="C" FT /allele="A" FT misc_feature complement(5569063..5570594) FT /note="CpG_island (%GC=74.5, o/e=0.84, #CpGs=204)" FT repeat_region complement(5570471..5570512) FT /rpt_family="GC_rich" FT variation complement(5570128) FT /allele="C" FT /allele="A" FT repeat_region complement(5570092..5570119) FT /rpt_family="GC_rich" FT variation complement(5569843) FT /allele="C" FT /allele="A" FT variation complement(5569827) FT /allele="G" FT /allele="A" FT variation complement(5569715) FT /allele="A" FT /allele="G" FT repeat_region complement(5569369..5569396) FT /rpt_family="GC_rich" FT variation complement(5569327) FT /allele="G" FT /allele="A" FT CDS complement(join(5567379..5567522,5567635..5567816, FT 5567912..5568350,5568792..5569031,5569166..5569288)) FT /codon_start=1 FT /gene="ACTB" FT /product="unknown" FT /note="Homo sapiens actin, beta (ACTB), mRNA.; FT H_RG161C01.1" FT /protein_id="AAP22343.1" FT /translation="MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV FT GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL FT LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTV FT PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD FT FEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNS FT IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVW FT IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF" FT variation complement(5568213) FT /gene="ACTB" FT /allele="C" FT /allele="T" FT variation complement(5567493) FT /gene="ACTB" FT /allele="G" FT /allele="C" FT repeat_region complement(5567255..5567298) FT /rpt_family="(T)n" FT variation complement(5567292) FT /allele="A" FT /allele="C" FT variation complement(5567064) FT /allele="G" FT /allele="A" FT repeat_region complement(5565836..5565999) FT /rpt_family="Alu" FT repeat_region complement(5565347..5565458) FT /rpt_family="L2" FT repeat_region complement(5565221..5565341) FT /rpt_family="(TTCA)n" FT repeat_region complement(5565132..5565215) FT /rpt_family="L2" FT repeat_region complement(5564971..5565037) FT /rpt_family="L1" FT repeat_region complement(5564811..5564962) FT /rpt_family="Alu" FT repeat_region complement(5564697..5564801) FT /rpt_family="Alu" FT repeat_region complement(5564393..5564694) FT /rpt_family="Alu" FT repeat_region complement(5564104..5564392) FT /rpt_family="MER1_type" FT repeat_region complement(5563719..5563918) FT /rpt_family="Alu" FT repeat_region complement(5563617..5563696) FT /rpt_family="Alu" FT repeat_region complement(5563343..5563616) FT /rpt_family="Alu" FT repeat_region complement(5563327..5563342) FT /rpt_family="Alu" FT repeat_region complement(5563150..5563282) FT /rpt_family="Alu" FT repeat_region complement(5562985..5563147) FT /rpt_family="Alu" FT repeat_region complement(5562387..5562679) FT /rpt_family="Alu" FT repeat_region complement(5562073..5562382) FT /rpt_family="Alu" FT repeat_region complement(5561902..5562071) FT /rpt_family="Alu" FT repeat_region complement(5561600..5561901) FT /rpt_family="Alu" FT repeat_region complement(5561482..5561599) FT /rpt_family="Alu" FT repeat_region complement(5561344..5561480) FT /rpt_family="Alu" FT repeat_region complement(5561279..5561327) FT /rpt_family="(TTAA)n" FT repeat_region complement(5560669..5560964) FT /rpt_family="Alu" FT repeat_region complement(5560504..5560668) FT /rpt_family="Alu" FT repeat_region complement(5560284..5560485) FT /rpt_family="L1" FT repeat_region complement(5559987..5560283) FT /rpt_family="Alu" FT variation complement(5560237) FT /allele="G" FT /allele="A" FT repeat_region complement(5559964..5559986) FT /rpt_family="L1" FT repeat_region complement(5559911..5559963) FT /rpt_family="Alu" FT repeat_region complement(5559564..5559877) FT /rpt_family="Alu" FT repeat_region complement(5559416..5559549) FT /rpt_family="Alu" FT variation complement(5559336) FT /allele="A" FT /allele="G" FT repeat_region complement(5558896..5559081) FT /rpt_family="Alu" FT variation complement(5558937) FT /allele="A" FT /allele="G" FT repeat_region complement(5558855..5558894) FT /rpt_family="Alu" FT repeat_region complement(5558640..5558693) FT /rpt_family="L2" FT repeat_region complement(5558322..5558614) FT /rpt_family="Alu" FT repeat_region complement(5558277..5558315) FT /rpt_family="G-rich" FT repeat_region complement(5558114..5558245) FT /rpt_family="Alu" FT misc_feature complement(5557896..5558114) FT /note="CpG_island (%GC=61.6, o/e=0.78, #CpGs=18)" FT repeat_region complement(5557822..5558113) FT /rpt_family="Alu" FT repeat_region complement(5557653..5557821) FT /rpt_family="Alu" FT repeat_region complement(5557402..5557588) FT /rpt_family="L2" FT repeat_region complement(5556996..5557290) FT /rpt_family="Alu" FT variation complement(5557255) FT /allele="G" FT /allele="C" FT variation complement(5557170) FT /allele="G" FT /allele="C" FT variation complement(5556807) FT /allele="C" FT /allele="T" FT repeat_region complement(5556727..5556788) FT /rpt_family="MaLR" FT repeat_region complement(5556411..5556726) FT /rpt_family="Alu" FT repeat_region complement(5556344..5556410) FT /rpt_family="MaLR" FT repeat_region complement(5556299..5556342) FT /rpt_family="MaLR" FT repeat_region complement(5555995..5556298) FT /rpt_family="Alu" FT variation complement(5556062) FT /allele="A" FT /allele="G" FT repeat_region complement(5555833..5555994) FT /rpt_family="MaLR" FT repeat_region complement(5555697..5555828) FT /rpt_family="Alu" FT repeat_region complement(5555406..5555696) FT /rpt_family="Alu" FT repeat_region complement(5555366..5555405) FT /rpt_family="(TA)n" FT repeat_region complement(5555193..5555358) FT /rpt_family="MaLR" FT repeat_region complement(5554822..5555148) FT /rpt_family="Alu" FT repeat_region complement(5554671..5554800) FT /rpt_family="Alu" FT variation complement(5554748) FT /allele="T" FT /allele="C" FT repeat_region complement(5554347..5554607) FT /rpt_family="Alu" FT repeat_region complement(5554286..5554333) FT /rpt_family="(TATG)n" FT repeat_region complement(5554003..5554285) FT /rpt_family="Alu" FT variation complement(5553996) FT /allele="T" FT /allele="C" FT repeat_region complement(5553558..5553954) FT /rpt_family="L2" FT misc_feature complement(5553169..5553776) FT /note="CpG_island (%GC=67.6, o/e=0.93, #CpGs=62)" FT variation complement(5552436) FT /allele="A" FT /allele="G" FT variation complement(5552276) FT /allele="A" FT /allele="G" FT repeat_region complement(5551964..5552262) FT /rpt_family="Alu" FT repeat_region complement(5551929..5551954) FT /rpt_family="(T)n" FT repeat_region complement(5551585..5551901) FT /rpt_family="Alu" FT repeat_region complement(5551469..5551567) FT /rpt_family="Alu" FT repeat_region complement(5551250..5551412) FT /rpt_family="Alu" FT repeat_region complement(5550928..5551249) FT /rpt_family="Alu" FT repeat_region complement(5550786..5550927) FT /rpt_family="Alu" FT variation complement(5550805) FT /allele="T" FT /allele="C" FT variation complement(5550789) FT /allele="C" FT /allele="T" FT repeat_region complement(5550668..5550731) FT /rpt_family="Alu" FT repeat_region complement(5550033..5550336) FT /rpt_family="Alu" FT repeat_region complement(5549977..5550032) FT /rpt_family="Alu" FT repeat_region complement(5549655..5549963) FT /rpt_family="Alu" FT variation complement(5549539) FT /allele="C" FT /allele="G" FT repeat_region complement(5549043..5549355) FT /rpt_family="Alu" FT repeat_region complement(5548556..5548841) FT /rpt_family="Alu" FT variation complement(5548658) FT /allele="T" FT /allele="C" FT variation complement(5548651) FT /allele="T" FT /allele="C" FT repeat_region complement(5547933..5548268) FT /rpt_family="Alu" FT variation complement(5548098) FT /allele="A" FT /allele="G" FT repeat_region complement(5547618..5547928) FT /rpt_family="Alu" FT repeat_region complement(5547485..5547617) FT /rpt_family="Alu" FT repeat_region complement(5547185..5547473) FT /rpt_family="Alu" FT variation complement(5546870) FT /allele="G" FT /allele="A" FT repeat_region complement(5546185..5546476) FT /rpt_family="Alu" FT repeat_region complement(5545875..5546184) FT /rpt_family="Alu" FT repeat_region complement(5545763..5545874) FT /rpt_family="Alu" FT repeat_region complement(5545496..5545758) FT /rpt_family="Alu" FT variation complement(5545532) FT /allele="T" FT /allele="C" FT variation complement(5545427) FT /allele="T" FT /allele="C" FT repeat_region complement(5544581..5544764) FT /rpt_family="L1" FT repeat_region complement(5544265..5544576) FT /rpt_family="Alu" FT repeat_region complement(5544039..5544236) FT /rpt_family="Alu" FT repeat_region complement(5543780..5544038) FT /rpt_family="Alu" FT repeat_region complement(5878246..5878312) FT /rpt_family="(TA)n" FT repeat_region complement(5877938..5878231) FT /rpt_family="Alu" FT repeat_region complement(5877742..5877930) FT /rpt_family="Alu" FT repeat_region complement(5877400..5877702) FT /rpt_family="Alu" FT repeat_region complement(5876765..5877037) FT /rpt_family="Alu" FT repeat_region complement(5876662..5876751) FT /rpt_family="(TA)n" FT repeat_region complement(5876066..5876368) FT /rpt_family="Alu" FT repeat_region complement(5875614..5875831) FT /rpt_family="MaLR" FT repeat_region complement(5875313..5875613) FT /rpt_family="Alu" FT repeat_region complement(5875198..5875312) FT /rpt_family="MaLR" FT repeat_region complement(5874920..5875197) FT /rpt_family="Alu" FT repeat_region complement(5874866..5874919) FT /rpt_family="MaLR" FT repeat_region complement(5874490..5874726) FT /rpt_family="Alu" FT repeat_region complement(5874468..5874489) FT /rpt_family="AT_rich" FT repeat_region complement(5874407..5874448) FT /rpt_family="5S" FT repeat_region complement(5873695..5873986) FT /rpt_family="Alu" FT repeat_region complement(5873274..5873570) FT /rpt_family="Alu" FT repeat_region complement(5872653..5872950) FT /rpt_family="Alu" FT repeat_region complement(5872262..5872537) FT /rpt_family="Alu" FT repeat_region complement(5872153..5872230) FT /rpt_family="Alu" FT repeat_region complement(5872020..5872149) FT /rpt_family="Alu" FT repeat_region complement(5871870..5871993) FT /rpt_family="Alu" FT repeat_region complement(5871483..5871786) FT /rpt_family="Alu" FT repeat_region complement(5871265..5871459) FT /rpt_family="L1" FT repeat_region complement(5870342..5870628) FT /rpt_family="Alu" FT repeat_region complement(5870015..5870136) FT /rpt_family="Alu" FT repeat_region complement(5869992..5870014) FT /rpt_family="(CA)n" FT repeat_region complement(5869810..5869991) FT /rpt_family="Alu" FT repeat_region complement(5869410..5869788) FT /rpt_family="L1" FT repeat_region complement(5868922..5869229) FT /rpt_family="Alu" FT repeat_region complement(5868244..5868555) FT /rpt_family="Alu" FT repeat_region complement(5867910..5868243) FT /rpt_family="Alu" FT repeat_region complement(5867626..5867735) FT /rpt_family="L1" FT repeat_region complement(5867151..5867443) FT /rpt_family="Alu" FT repeat_region complement(5867014..5867120) FT /rpt_family="ERV" FT repeat_region complement(5866878..5867009) FT /rpt_family="Alu" FT repeat_region complement(5866578..5866875) FT /rpt_family="Alu" FT repeat_region complement(5866518..5866573) FT /rpt_family="L1" FT repeat_region complement(5866091..5866393) FT /rpt_family="Alu" FT misc_feature complement(5866147..5866359) FT /note="CpG_island (%GC=59.2, o/e=0.85, #CpGs=17)" FT repeat_region complement(5865845..5866001) FT /rpt_family="L1" FT repeat_region complement(5865537..5865844) FT /rpt_family="Alu" FT repeat_region complement(5865430..5865536) FT /rpt_family="L1" FT repeat_region complement(5864898..5865156) FT /rpt_family="Alu" FT repeat_region complement(5864307..5864614) FT /rpt_family="Alu" FT misc_feature complement(5862831..5863066) FT /note="CpG_island (%GC=69.5, o/e=0.81, #CpGs=22)" FT repeat_region complement(5862113..5862421) FT /rpt_family="Alu" FT repeat_region complement(5861885..5862019) FT /rpt_family="Alu" FT repeat_region complement(5861567..5861884) FT /rpt_family="Alu" FT repeat_region complement(5861408..5861566) FT /rpt_family="Alu" FT repeat_region complement(5861350..5861407) FT /rpt_family="(TA)n" FT repeat_region complement(5861310..5861350) FT /rpt_family="(TG)n" FT repeat_region complement(5861285..5861309) FT /rpt_family="(CA)n" FT repeat_region complement(5860897..5861079) FT /rpt_family="MER2_type" FT repeat_region complement(5860554..5860855) FT /rpt_family="Alu" FT repeat_region complement(5860210..5860553) FT /rpt_family="MaLR" FT repeat_region complement(5859984..5860130) FT /rpt_family="Alu" FT repeat_region complement(5859669..5859974) FT /rpt_family="Alu" FT repeat_region complement(5859107..5859249) FT /rpt_family="Alu" FT repeat_region complement(5858820..5859106) FT /rpt_family="Alu" FT repeat_region complement(5858655..5858819) FT /rpt_family="Alu" FT repeat_region complement(5858447..5858573) FT /rpt_family="Alu" FT repeat_region complement(5858177..5858446) FT /rpt_family="Alu" FT repeat_region complement(5857991..5858176) FT /rpt_family="Alu" FT repeat_region complement(5857884..5857986) FT /rpt_family="MaLR" FT repeat_region complement(5857582..5857883) FT /rpt_family="Alu" FT repeat_region complement(5857360..5857581) FT /rpt_family="MaLR" FT repeat_region complement(5856797..5857111) FT /rpt_family="Alu" FT repeat_region complement(5856618..5856796) FT /rpt_family="Alu" FT repeat_region complement(5856592..5856617) FT /rpt_family="(TA)n" FT repeat_region complement(5856300..5856433) FT /rpt_family="Alu" FT repeat_region complement(5855932..5856293) FT /rpt_family="L1" FT repeat_region complement(5855645..5855724) FT /rpt_family="(TA)n" FT repeat_region complement(5855350..5855644) FT /rpt_family="Alu" FT repeat_region complement(5855268..5855349) FT /rpt_family="(TA)n" FT repeat_region complement(5855139..5855262) FT /rpt_family="Alu" FT repeat_region complement(5854953..5855120) FT /rpt_family="(TTATA)n" FT repeat_region complement(5854645..5854930) FT /rpt_family="Alu" FT repeat_region complement(5854482..5854641) FT /rpt_family="Alu" FT repeat_region complement(5854190..5854481) FT /rpt_family="Alu" FT repeat_region complement(5854053..5854189) FT /rpt_family="Alu" FT repeat_region complement(5854007..5854052) FT /rpt_family="AT_rich" FT repeat_region complement(5853708..5854000) FT /rpt_family="Alu" FT repeat_region complement(5853594..5853615) FT /rpt_family="AT_rich" FT repeat_region complement(5853415..5853503) FT /rpt_family="MIR" FT repeat_region complement(5853373..5853414) FT /rpt_family="MaLR" FT repeat_region complement(5853076..5853372) FT /rpt_family="Alu" FT repeat_region complement(5852770..5853071) FT /rpt_family="Alu" FT repeat_region complement(5852434..5852769) FT /rpt_family="MaLR" FT repeat_region complement(5852369..5852433) FT /rpt_family="MIR" FT repeat_region complement(5852035..5852082) FT /rpt_family="MER2_type" FT repeat_region complement(5851690..5851985) FT /rpt_family="Alu" FT repeat_region complement(5851620..5851681) FT /rpt_family="Alu" FT repeat_region complement(5851389..5851518) FT /rpt_family="L1" FT repeat_region complement(5850856..5851146) FT /rpt_family="Alu" FT repeat_region complement(5849895..5850185) FT /rpt_family="Alu" FT repeat_region complement(5849317..5849607) FT /rpt_family="Alu" FT repeat_region complement(5849210..5849267) FT /rpt_family="L2" FT repeat_region complement(5848903..5849196) FT /rpt_family="Alu" FT repeat_region complement(5848584..5848881) FT /rpt_family="Alu" FT repeat_region complement(5848559..5848583) FT /rpt_family="(TA)n" FT repeat_region complement(5848380..5848547) FT /rpt_family="Alu" FT repeat_region complement(5848270..5848379) FT /rpt_family="Alu" FT repeat_region complement(5847777..5848077) FT /rpt_family="L1" FT repeat_region complement(5847484..5847776) FT /rpt_family="Alu" FT misc_feature complement(5847459..5847773) FT /note="CpG_island (%GC=60.3, o/e=0.82, #CpGs=23)" FT repeat_region complement(5847080..5847483) FT /rpt_family="L1" FT repeat_region complement(5846779..5847069) FT /rpt_family="Alu" FT repeat_region complement(5846646..5846772) FT /rpt_family="Alu" FT repeat_region complement(5846471..5846633) FT /rpt_family="L1" FT repeat_region complement(5846131..5846433) FT /rpt_family="Alu" FT repeat_region complement(5845745..5846031) FT /rpt_family="Alu" FT repeat_region complement(5845627..5845742) FT /rpt_family="L1" FT repeat_region complement(5845329..5845626) FT /rpt_family="Alu" FT repeat_region complement(5845214..5845328) FT /rpt_family="L1" FT repeat_region complement(5845085..5845213) FT /rpt_family="Alu" FT repeat_region complement(5844740..5845084) FT /rpt_family="L1" FT repeat_region complement(5844433..5844739) FT /rpt_family="Alu" FT repeat_region complement(5844087..5844432) FT /rpt_family="L1" FT repeat_region complement(5843790..5844085) FT /rpt_family="Alu" FT repeat_region complement(5843618..5843779) FT /rpt_family="Alu" FT repeat_region complement(5843150..5843614) FT /rpt_family="L1" FT repeat_region complement(5842510..5842811) FT /rpt_family="Alu" FT repeat_region complement(5842025..5842322) FT /rpt_family="Alu" FT repeat_region complement(5841814..5841973) FT /rpt_family="Alu" FT repeat_region complement(5841467..5841776) FT /rpt_family="Alu" FT repeat_region complement(5841167..5841291) FT /rpt_family="Alu" FT repeat_region complement(5840905..5841166) FT /rpt_family="Alu" FT repeat_region complement(5840719..5840904) FT /rpt_family="Alu" FT repeat_region complement(5840642..5840716) FT /rpt_family="ERV1" FT repeat_region complement(5840336..5840640) FT /rpt_family="Alu" FT repeat_region complement(5840132..5840305) FT /rpt_family="ERV1" FT repeat_region complement(5839840..5840131) FT /rpt_family="Alu" FT repeat_region complement(5839660..5839839) FT /rpt_family="ERV1" FT repeat_region complement(5839353..5839656) FT /rpt_family="Alu" FT repeat_region complement(5839182..5839352) FT /rpt_family="ERV1" FT repeat_region complement(5838883..5839180) FT /rpt_family="Alu" FT repeat_region complement(5838539..5838827) FT /rpt_family="Alu" FT repeat_region complement(5838217..5838508) FT /rpt_family="Alu" FT repeat_region complement(5837948..5838216) FT /rpt_family="Alu" FT repeat_region complement(5837640..5837947) FT /rpt_family="Alu" FT repeat_region complement(5837422..5837626) FT /rpt_family="ERVL" FT repeat_region complement(5837141..5837421) FT /rpt_family="Alu" FT repeat_region complement(5837109..5837131) FT /rpt_family="AT_rich" FT repeat_region complement(5836955..5837071) FT /rpt_family="Alu" FT repeat_region complement(5836645..5836943) FT /rpt_family="Alu" FT repeat_region complement(5836138..5836438) FT /rpt_family="Alu" FT repeat_region complement(5835977..5836135) FT /rpt_family="GA-rich" FT repeat_region complement(5835729..5835871) FT /rpt_family="Alu" FT repeat_region complement(5835654..5835727) FT /rpt_family="MaLR" FT repeat_region complement(5835185..5835480) FT /rpt_family="Alu" FT repeat_region complement(5834987..5835172) FT /rpt_family="Alu" FT repeat_region complement(5834704..5834986) FT /rpt_family="Alu" FT repeat_region complement(5834577..5834703) FT /rpt_family="Alu" FT repeat_region complement(5834539..5834567) FT /rpt_family="AT_rich" FT repeat_region complement(5833040..5834518) FT /rpt_family="ERV1" FT misc_feature complement(5834262..5834512) FT /note="CpG_island (%GC=52.6, o/e=1.38, #CpGs=18)" FT misc_feature complement(5833226..5833558) FT /note="CpG_island (%GC=72.7, o/e=0.62, #CpGs=30)" FT repeat_region complement(5832953..5833039) FT /rpt_family="Alu" FT repeat_region complement(5832927..5832949) FT /rpt_family="(TTTA)n" FT repeat_region complement(5832890..5832925) FT /rpt_family="ERV1" FT repeat_region complement(5832772..5832880) FT /rpt_family="Alu" FT repeat_region complement(5832630..5832771) FT /rpt_family="ERV1" FT repeat_region complement(5832194..5832497) FT /rpt_family="Alu" FT repeat_region complement(5832045..5832128) FT /rpt_family="ERV1" FT repeat_region complement(5831608..5832036) FT /rpt_family="MER1_type" FT repeat_region complement(5831270..5831580) FT /rpt_family="Alu" FT repeat_region complement(5831112..5831176) FT /rpt_family="L1" FT repeat_region complement(5830741..5831043) FT /rpt_family="Alu" FT repeat_region complement(5830171..5830740) FT /rpt_family="L1" FT repeat_region complement(5830059..5830170) FT /rpt_family="Alu" FT repeat_region complement(5829846..5830058) FT /rpt_family="L1" FT repeat_region complement(5829557..5829844) FT /rpt_family="Alu" FT repeat_region complement(5829246..5829554) FT /rpt_family="Alu" FT repeat_region complement(5828955..5829216) FT /rpt_family="Alu" FT repeat_region complement(5828711..5828910) FT /rpt_family="L1" FT repeat_region complement(5828411..5828710) FT /rpt_family="Alu" FT repeat_region complement(5827959..5828410) FT /rpt_family="L1" FT repeat_region complement(5827823..5827958) FT /rpt_family="Alu" FT repeat_region complement(5827517..5827822) FT /rpt_family="Alu" FT repeat_region complement(5827355..5827516) FT /rpt_family="Alu" FT repeat_region complement(5827285..5827354) FT /rpt_family="L1" FT repeat_region complement(5826918..5827255) FT /rpt_family="Alu" FT repeat_region complement(5826751..5826917) FT /rpt_family="Alu" FT repeat_region complement(5826530..5826726) FT /rpt_family="L1" FT repeat_region complement(5825734..5826010) FT /rpt_family="Alu" FT repeat_region complement(5825707..5825730) FT /rpt_family="(CAAA)n" FT repeat_region complement(5825420..5825702) FT /rpt_family="Alu" FT repeat_region complement(5825082..5825384) FT /rpt_family="Alu" FT repeat_region complement(5824774..5824853) FT /rpt_family="MIR" FT repeat_region complement(5824651..5824767) FT /rpt_family="Alu" FT repeat_region complement(5824467..5824647) FT /rpt_family="Alu" FT repeat_region complement(5824137..5824447) FT /rpt_family="Alu" FT repeat_region complement(5823762..5824061) FT /rpt_family="Alu" FT repeat_region complement(5823178..5823456) FT /rpt_family="L2" FT repeat_region complement(5823061..5823176) FT /rpt_family="Alu" FT repeat_region complement(5822744..5823060) FT /rpt_family="Alu" FT repeat_region complement(5822549..5822743) FT /rpt_family="Alu" FT repeat_region complement(5822493..5822548) FT /rpt_family="L2" FT repeat_region complement(5822199..5822491) FT /rpt_family="Alu" FT repeat_region complement(5822070..5822190) FT /rpt_family="Alu" FT repeat_region complement(5822002..5822058) FT /rpt_family="L2" FT repeat_region complement(5821701..5822001) FT /rpt_family="Alu" FT repeat_region complement(5821609..5821700) FT /rpt_family="L2" FT misc_feature complement(5820473..5821444) FT /note="CpG_island (%GC=73.7, o/e=0.86, #CpGs=121)" FT repeat_region complement(5820990..5821084) FT /rpt_family="G-rich" FT repeat_region complement(5820078..5820365) FT /rpt_family="Alu" FT repeat_region complement(5819189..5819475) FT /rpt_family="Alu" FT repeat_region complement(5818664..5818798) FT /rpt_family="MIR" FT repeat_region complement(5818364..5818663) FT /rpt_family="Alu" FT repeat_region complement(5818262..5818363) FT /rpt_family="MIR" FT repeat_region complement(5818103..5818248) FT /rpt_family="L2" FT repeat_region complement(5817739..5817848) FT /rpt_family="L2" FT repeat_region complement(5816830..5816983) FT /rpt_family="MaLR" FT repeat_region complement(5816656..5816797) FT /rpt_family="MaLR" FT repeat_region complement(5816355..5816620) FT /rpt_family="Alu" FT repeat_region complement(5815933..5816245) FT /rpt_family="Alu" FT repeat_region complement(5815219..5815516) FT /rpt_family="Alu" FT repeat_region complement(5814391..5814676) FT /rpt_family="Alu" FT repeat_region complement(5814104..5814167) FT /rpt_family="MIR" FT repeat_region complement(5814081..5814101) FT /rpt_family="AT_rich" FT repeat_region complement(5813909..5814077) FT /rpt_family="Alu" FT repeat_region complement(5813783..5813898) FT /rpt_family="MIR" FT repeat_region complement(5813213..5813495) FT /rpt_family="Alu" FT repeat_region complement(5812878..5813171) FT /rpt_family="Alu" FT repeat_region complement(5812407..5812710) FT /rpt_family="Alu" FT repeat_region complement(5812065..5812145) FT /rpt_family="Alu" FT repeat_region complement(5811865..5811891) FT /rpt_family="(TTTTA)n" FT repeat_region complement(5811583..5811862) FT /rpt_family="Alu" FT repeat_region complement(5811427..5811580) FT /rpt_family="L1" FT repeat_region complement(5811146..5811426) FT /rpt_family="Alu" FT repeat_region complement(5810737..5811145) FT /rpt_family="L1" FT repeat_region complement(5810431..5810736) FT /rpt_family="Alu" FT repeat_region complement(5810290..5810430) FT /rpt_family="L1" FT repeat_region complement(5810108..5810234) FT /rpt_family="L1" FT repeat_region complement(5809811..5810106) FT /rpt_family="Alu" FT repeat_region complement(5809697..5809784) FT /rpt_family="Alu" FT repeat_region complement(5809386..5809684) FT /rpt_family="Alu" FT repeat_region complement(5809072..5809374) FT /rpt_family="Alu" FT repeat_region complement(5808753..5809046) FT /rpt_family="Alu" FT repeat_region complement(5808592..5808752) FT /rpt_family="L1" FT repeat_region complement(5808293..5808591) FT /rpt_family="Alu" FT repeat_region complement(5808077..5808292) FT /rpt_family="L1" FT repeat_region complement(5807978..5808024) FT /rpt_family="(TG)n" FT repeat_region complement(5807802..5807940) FT /rpt_family="Alu" FT repeat_region complement(5807234..5807529) FT /rpt_family="Alu" FT repeat_region complement(5806712..5807205) FT /rpt_family="L1" FT repeat_region complement(5806611..5806711) FT /rpt_family="MIR" FT repeat_region complement(5805971..5806357) FT /rpt_family="MaLR" FT repeat_region complement(5805627..5805950) FT /rpt_family="Alu" FT repeat_region complement(5805297..5805610) FT /rpt_family="Alu" FT repeat_region complement(5805119..5805287) FT /rpt_family="Alu" FT repeat_region complement(5804811..5805115) FT /rpt_family="Alu" FT repeat_region complement(5804716..5804809) FT /rpt_family="L1" FT repeat_region complement(5804416..5804715) FT /rpt_family="Alu" FT repeat_region complement(5804292..5804415) FT /rpt_family="L1" FT repeat_region complement(5803997..5804291) FT /rpt_family="Alu" FT repeat_region complement(5803920..5803996) FT /rpt_family="L1" FT repeat_region complement(5803538..5803856) FT /rpt_family="Alu" FT repeat_region complement(5803206..5803503) FT /rpt_family="Alu" FT repeat_region complement(5802980..5803204) FT /rpt_family="Alu" FT repeat_region complement(5802788..5802969) FT /rpt_family="L1" FT repeat_region complement(5802007..5802350) FT /rpt_family="Alu" FT repeat_region complement(5801872..5802000) FT /rpt_family="Alu" FT repeat_region complement(5801827..5801870) FT /rpt_family="AT_rich" FT repeat_region complement(5801431..5801767) FT /rpt_family="L1" FT repeat_region complement(5801137..5801430) FT /rpt_family="Alu" FT repeat_region complement(5801007..5801136) FT /rpt_family="L1" FT repeat_region complement(5799868..5800175) FT /rpt_family="Alu" FT repeat_region complement(5799256..5799561) FT /rpt_family="Alu" FT repeat_region complement(5798975..5799255) FT /rpt_family="MER2_type" FT repeat_region complement(5798562..5798972) FT /rpt_family="MaLR" FT repeat_region complement(5798165..5798558) FT /rpt_family="MaLR" FT repeat_region complement(5798073..5798164) FT /rpt_family="MER2_type" FT repeat_region complement(5797504..5797640) FT /rpt_family="Alu" FT repeat_region complement(5797173..5797502) FT /rpt_family="L1" FT repeat_region complement(5796759..5797168) FT /rpt_family="L1" FT repeat_region complement(5796568..5796711) FT /rpt_family="L1" FT repeat_region complement(5796243..5796566) FT /rpt_family="Alu" FT repeat_region complement(5796090..5796241) FT /rpt_family="Alu" FT repeat_region complement(5795981..5796085) FT /rpt_family="MER1_type" FT repeat_region complement(5795611..5795980) FT /rpt_family="MaLR" FT repeat_region complement(5795564..5795610) FT /rpt_family="MER1_type" FT repeat_region complement(5795242..5795563) FT /rpt_family="L1" FT repeat_region complement(5794999..5795215) FT /rpt_family="L1" FT repeat_region complement(5794723..5794900) FT /rpt_family="(TTCC)n" FT repeat_region complement(5794377..5794683) FT /rpt_family="Alu" FT repeat_region complement(5793794..5794095) FT /rpt_family="Alu" FT repeat_region complement(5793745..5793793) FT /rpt_family="(CA)n" FT repeat_region complement(5793346..5793640) FT /rpt_family="Alu" FT repeat_region complement(5792992..5793040) FT /rpt_family="AT_rich" FT repeat_region complement(5791831..5792318) FT /rpt_family="L1" FT repeat_region complement(5791537..5791830) FT /rpt_family="Alu" FT repeat_region complement(5791462..5791487) FT /rpt_family="(T)n" FT repeat_region complement(5790970..5791461) FT /rpt_family="ERV1" FT repeat_region complement(5790512..5790969) FT /rpt_family="ERV1" FT repeat_region complement(5790192..5790473) FT /rpt_family="ERV1" FT repeat_region complement(5789099..5790178) FT /rpt_family="ERV1" FT repeat_region complement(5788781..5789081) FT /rpt_family="Alu" FT repeat_region complement(5788502..5788780) FT /rpt_family="ERV1" FT repeat_region complement(5788290..5788500) FT /rpt_family="MER2_type" FT repeat_region complement(5788239..5788289) FT /rpt_family="(TG)n" FT repeat_region complement(5788172..5788238) FT /rpt_family="MER2_type" FT repeat_region complement(5788012..5788170) FT /rpt_family="Alu" FT repeat_region complement(5787579..5787949) FT /rpt_family="ERV1" FT repeat_region complement(5787450..5787552) FT /rpt_family="Alu" FT repeat_region complement(5787241..5787406) FT /rpt_family="Alu" FT repeat_region complement(5787150..5787205) FT /rpt_family="ERV1" FT repeat_region complement(5786286..5786393) FT /rpt_family="ERV1" FT repeat_region complement(5785680..5785882) FT /rpt_family="ERV1" FT repeat_region complement(5785553..5785658) FT /rpt_family="ERV1" FT repeat_region complement(5785249..5785543) FT /rpt_family="Alu" FT repeat_region complement(5784628..5785244) FT /rpt_family="L1" FT repeat_region complement(5784321..5784627) FT /rpt_family="Alu" FT repeat_region complement(5784302..5784320) FT /rpt_family="L1" FT repeat_region complement(5784270..5784294) FT /rpt_family="(TTTG)n" FT repeat_region complement(5783543..5784054) FT /rpt_family="L1" FT repeat_region complement(5783289..5783368) FT /rpt_family="L1" FT repeat_region complement(5782907..5783279) FT /rpt_family="L1" FT repeat_region complement(5782612..5782906) FT /rpt_family="Alu" FT repeat_region complement(5782527..5782611) FT /rpt_family="L1" FT repeat_region complement(5782218..5782526) FT /rpt_family="Alu" FT repeat_region complement(5781984..5782217) FT /rpt_family="L1" FT repeat_region complement(5781681..5781977) FT /rpt_family="Alu" FT repeat_region complement(5780081..5780266) FT /rpt_family="MER1_type" FT repeat_region complement(5779746..5780056) FT /rpt_family="Alu" FT repeat_region complement(5779350..5779665) FT /rpt_family="Alu" FT repeat_region complement(5779156..5779217) FT /rpt_family="MIR" FT repeat_region complement(5778862..5778881) FT /rpt_family="(TGG)n" FT repeat_region complement(5778575..5778861) FT /rpt_family="L1" FT repeat_region complement(5778058..5778363) FT /rpt_family="Alu" FT repeat_region complement(5777876..5778039) FT /rpt_family="Alu" FT repeat_region complement(5777852..5777875) FT /rpt_family="AT_rich" FT repeat_region complement(5777439..5777747) FT /rpt_family="Alu" FT repeat_region complement(5777236..5777288) FT /rpt_family="MER1_type" FT repeat_region complement(5777150..5777179) FT /rpt_family="(TTA)n" FT repeat_region complement(5775740..5777149) FT /rpt_family="SVA" FT misc_feature complement(5775895..5776569) FT /note="CpG_island (%GC=67.6, o/e=0.69, #CpGs=51)" FT repeat_region complement(5775444..5775736) FT /rpt_family="Alu" FT repeat_region complement(5774925..5775277) FT /rpt_family="L1" FT repeat_region complement(5774506..5774799) FT /rpt_family="Alu" FT repeat_region complement(5774308..5774499) FT /rpt_family="Alu" FT repeat_region complement(5774025..5774164) FT /rpt_family="L1" FT repeat_region complement(5773780..5774021) FT /rpt_family="L1" FT repeat_region complement(5773564..5773628) FT /rpt_family="L1" FT repeat_region complement(5773216..5773286) FT /rpt_family="L1" FT repeat_region complement(5770274..5770296) FT /rpt_family="(TTG)n" FT repeat_region complement(5769789..5770016) FT /rpt_family="L1" FT repeat_region complement(5769333..5769464) FT /rpt_family="MIR" FT gene complement(5751392..5769124) FT /gene="TRIAD3" FT mRNA complement(join(5751392..5751470,5752346..5752494, FT 5754684..5754821,5756347..5756397,5760664..5760803, FT 5764955..5765069,5769063..5769124)) FT /gene="TRIAD3" FT repeat_region complement(5767929..5768233) FT /rpt_family="Alu" FT repeat_region complement(5767087..5767369) FT /rpt_family="Alu" FT repeat_region complement(5766760..5766829) FT /rpt_family="MaLR" FT repeat_region complement(5766211..5766505) FT /rpt_family="Alu" FT repeat_region complement(5765626..5765918) FT /rpt_family="Alu" FT repeat_region complement(5765200..5765490) FT /rpt_family="Alu" FT repeat_region complement(5763862..5764084) FT /rpt_family="CR1" FT repeat_region complement(5763766..5763859) FT /rpt_family="CR1" FT repeat_region complement(5762998..5763301) FT /rpt_family="Alu" FT misc_feature complement(5763001..5763235) FT /gene="TRIAD3" FT /note="CpG_island (%GC=58.7, o/e=0.94, #CpGs=17)" FT repeat_region complement(5762628..5762863) FT /rpt_family="MIR" FT repeat_region complement(5762371..5762565) FT /rpt_family="Alu" FT repeat_region complement(5761999..5762320) FT /rpt_family="Alu" FT repeat_region complement(5761561..5761854) FT /rpt_family="Alu" FT repeat_region complement(5761062..5761371) FT /rpt_family="L1" FT mRNA complement(join(5751392..5751470,5752346..5752494, FT 5754684..5754821,5756347..5756397,5760664..5760790)) FT /gene="TRIAD3" FT CDS complement(join(<5751392..5751470,5752346..5752494, FT 5754684..5754821,5756347..5756397,5760664..5760780)) FT /codon_start=1 FT /gene="TRIAD3" FT /product="unknown" FT /note="Homo sapiens TRIAD3 protein (TRIAD3), mRNA.; FT H_NH0172O13.1 This gene was based on gi(9507204 12653980) FT Continues as H_RG161C01.4" FT /protein_id="AAS07532.1" FT /translation="MFFLENKRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLL FT ALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLE FT LSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLD FT SDVKRFSCPNPHCRK" FT repeat_region complement(5760217..5760314) FT /rpt_family="MER1_type" FT repeat_region complement(5759807..5760213) FT /rpt_family="MER2_type" FT repeat_region complement(5759319..5759798) FT /rpt_family="MER1_type" FT repeat_region complement(5759235..5759296) FT /rpt_family="MER1_type" FT repeat_region complement(5759037..5759211) FT /rpt_family="L1" FT repeat_region complement(5758730..5759032) FT /rpt_family="Alu" FT repeat_region complement(5758651..5758694) FT /rpt_family="AT_rich" FT repeat_region complement(5758503..5758587) FT /rpt_family="Alu" FT repeat_region complement(5758182..5758487) FT /rpt_family="Alu" FT repeat_region complement(5757730..5758030) FT /rpt_family="Alu" FT repeat_region complement(5757572..5757606) FT /rpt_family="Alu" FT repeat_region complement(5757427..5757566) FT /rpt_family="Alu" FT repeat_region complement(5757011..5757397) FT /rpt_family="L1" FT repeat_region complement(5756703..5757008) FT /rpt_family="Alu" FT repeat_region complement(5755861..5756003) FT /rpt_family="Alu" FT repeat_region complement(5755678..5755822) FT /rpt_family="Alu" FT repeat_region complement(5755365..5755671) FT /rpt_family="Alu" FT repeat_region complement(5754355..5754375) FT /rpt_family="AT_rich" FT repeat_region complement(5754206..5754273) FT /rpt_family="MaLR" FT repeat_region complement(5753894..5754178) FT /rpt_family="Alu" FT repeat_region complement(5753633..5753891) FT /rpt_family="Alu" FT repeat_region complement(5753396..5753617) FT /rpt_family="MIR" FT repeat_region complement(5753005..5753382) FT /rpt_family="L1" FT repeat_region complement(5752179..5752209) FT /rpt_family="AT_rich" FT repeat_region complement(5751831..5752119) FT /rpt_family="Alu" FT repeat_region complement(5749709..5750021) FT /rpt_family="Alu" FT repeat_region complement(5749377..5749678) FT /rpt_family="Alu" FT repeat_region complement(5748836..5749127) FT /rpt_family="L1" FT repeat_region complement(5748594..5748757) FT /rpt_family="L1" FT repeat_region complement(5748394..5748515) FT /rpt_family="L1" FT repeat_region complement(5748052..5748272) FT /rpt_family="MER2_type" FT repeat_region complement(5747662..5748051) FT /rpt_family="L1" FT repeat_region complement(5747350..5747655) FT /rpt_family="Alu" FT repeat_region complement(5746341..5747337) FT /rpt_family="L1" FT repeat_region complement(5745871..5746353) FT /rpt_family="L1" FT repeat_region complement(5745601..5745870) FT /rpt_family="Alu" FT repeat_region complement(5745543..5745599) FT /rpt_family="(TTTTG)n" FT repeat_region complement(5745259..5745540) FT /rpt_family="Alu" FT repeat_region complement(5745114..5745212) FT /rpt_family="MaLR" FT repeat_region complement(5744821..5744854) FT /rpt_family="L2" FT repeat_region complement(5741119..5741345) FT /rpt_family="MIR" FT repeat_region complement(5738960..5739023) FT /rpt_family="MIR" FT repeat_region complement(5738694..5738958) FT /rpt_family="L1" FT repeat_region complement(5738192..5738322) FT /rpt_family="Alu" FT repeat_region complement(6002555..6002856) FT /rpt_family="Alu" FT repeat_region complement(6001823..6002126) FT /rpt_family="Alu" FT repeat_region complement(6001601..6001758) FT /rpt_family="Alu" FT repeat_region complement(6001294..6001600) FT /rpt_family="Alu" FT repeat_region complement(6001281..6001293) FT /rpt_family="Alu" FT repeat_region complement(6000963..6001280) FT /rpt_family="Alu" FT repeat_region complement(6000837..6000962) FT /rpt_family="Alu" FT misc_feature complement(6000304..6000508) FT /note="CpG_island (%GC=60.0, o/e=0.94, #CpGs=17)" FT repeat_region complement(6000145..6000302) FT /rpt_family="G-rich" FT repeat_region complement(5999760..6000066) FT /rpt_family="Alu" FT repeat_region complement(5999676..5999710) FT /rpt_family="(TG)n" FT repeat_region complement(5998944..5999243) FT /rpt_family="Alu" FT repeat_region complement(5998380..5998493) FT /rpt_family="Alu" FT repeat_region complement(5998324..5998379) FT /rpt_family="Alu" FT repeat_region complement(5998267..5998288) FT /rpt_family="AT_rich" FT repeat_region complement(5997982..5998170) FT /rpt_family="Alu" FT repeat_region complement(5997804..5997941) FT /rpt_family="Alu" FT repeat_region complement(5997135..5997457) FT /rpt_family="Alu" FT repeat_region complement(5996827..5997132) FT /rpt_family="Alu" FT repeat_region complement(5996523..5996819) FT /rpt_family="Alu" FT repeat_region complement(5996191..5996492) FT /rpt_family="Alu" FT repeat_region complement(5996071..5996120) FT /rpt_family="Alu" FT repeat_region complement(5995916..5996069) FT /rpt_family="MIR" FT repeat_region complement(5995401..5995567) FT /rpt_family="L1" FT repeat_region complement(5995098..5995400) FT /rpt_family="Alu" FT repeat_region complement(5995027..5995097) FT /rpt_family="L1" FT repeat_region complement(5994901..5995023) FT /rpt_family="L1" FT repeat_region complement(5994520..5994813) FT /rpt_family="Alu" FT repeat_region complement(5994426..5994454) FT /rpt_family="(TG)n" FT repeat_region complement(5994189..5994356) FT /rpt_family="MaLR" FT repeat_region complement(5993775..5994069) FT /rpt_family="Alu" FT repeat_region complement(5993484..5993769) FT /rpt_family="Alu" FT repeat_region complement(5993328..5993379) FT /rpt_family="GA-rich" FT repeat_region complement(5992910..5993215) FT /rpt_family="Alu" FT repeat_region complement(5992357..5992670) FT /rpt_family="Alu" FT repeat_region complement(5992106..5992254) FT /rpt_family="Alu" FT repeat_region complement(5991810..5992105) FT /rpt_family="Alu" FT repeat_region complement(5991666..5991809) FT /rpt_family="Alu" FT repeat_region complement(5991509..5991644) FT /rpt_family="Alu" FT repeat_region complement(5991098..5991396) FT /rpt_family="Alu" FT repeat_region complement(5990550..5990850) FT /rpt_family="Alu" FT repeat_region complement(5989921..5990214) FT /rpt_family="Alu" FT repeat_region complement(5989652..5989908) FT /rpt_family="L1" FT repeat_region complement(5989468..5989651) FT /rpt_family="Alu" FT repeat_region complement(5989180..5989467) FT /rpt_family="Alu" FT repeat_region complement(5989033..5989179) FT /rpt_family="Alu" FT repeat_region complement(5988949..5989032) FT /rpt_family="L1" FT repeat_region complement(5988488..5988786) FT /rpt_family="Alu" FT repeat_region complement(5988082..5988374) FT /rpt_family="Alu" FT repeat_region complement(5987524..5987802) FT /rpt_family="Alu" FT repeat_region complement(5987492..5987523) FT /rpt_family="(CA)n" FT repeat_region complement(5987375..5987486) FT /rpt_family="MER1_type" FT repeat_region complement(5987063..5987374) FT /rpt_family="Alu" FT repeat_region complement(5986625..5987062) FT /rpt_family="MER1_type" FT repeat_region complement(5986221..5986433) FT /rpt_family="MER1_type" FT repeat_region complement(5985873..5986157) FT /rpt_family="Alu" FT repeat_region complement(5985578..5985871) FT /rpt_family="Alu" FT repeat_region complement(5984968..5985264) FT /rpt_family="Alu" FT repeat_region complement(5984308..5984607) FT /rpt_family="Alu" FT repeat_region complement(5983755..5984052) FT /rpt_family="Alu" FT repeat_region complement(5983651..5983748) FT /rpt_family="MaLR" FT repeat_region complement(5983181..5983477) FT /rpt_family="Alu" FT repeat_region complement(5982600..5982673) FT /rpt_family="Alu" FT repeat_region complement(5982512..5982558) FT /rpt_family="(TA)n" FT repeat_region complement(5982211..5982511) FT /rpt_family="Alu" FT repeat_region complement(5981888..5982160) FT /rpt_family="Alu" FT repeat_region complement(5981803..5981877) FT /rpt_family="ERV1" FT repeat_region complement(5981531..5981792) FT /rpt_family="Alu" FT repeat_region complement(5981094..5981384) FT /rpt_family="Alu" FT repeat_region complement(5980651..5980944) FT /rpt_family="Alu" FT repeat_region complement(5980574..5980603) FT /rpt_family="(TAA)n" FT repeat_region complement(5980553..5980573) FT /rpt_family="AT_rich" FT repeat_region complement(5980292..5980549) FT /rpt_family="Alu" FT repeat_region complement(5980158..5980291) FT /rpt_family="L1" FT repeat_region complement(5979940..5980156) FT /rpt_family="Alu" FT repeat_region complement(5979845..5979864) FT /rpt_family="MER2_type" FT repeat_region complement(5979546..5979844) FT /rpt_family="Alu" FT repeat_region complement(5979417..5979545) FT /rpt_family="MER2_type" FT repeat_region complement(5979217..5979268) FT /rpt_family="(TG)n" FT repeat_region complement(5978932..5979216) FT /rpt_family="Alu" FT repeat_region complement(5978568..5978868) FT /rpt_family="Alu" FT repeat_region complement(5977917..5978230) FT /rpt_family="Alu" FT repeat_region complement(5977769..5977894) FT /rpt_family="Alu" FT repeat_region complement(5977643..5977718) FT /rpt_family="(TG)n" FT repeat_region complement(5977026..5977336) FT /rpt_family="Alu" FT repeat_region complement(5976740..5976920) FT /rpt_family="Alu" FT repeat_region complement(5976439..5976739) FT /rpt_family="Alu" FT repeat_region complement(5976305..5976438) FT /rpt_family="Alu" FT repeat_region complement(5975850..5975979) FT /rpt_family="Alu" FT repeat_region complement(5975434..5975681) FT /rpt_family="L1" FT repeat_region complement(5975124..5975410) FT /rpt_family="Alu" FT repeat_region complement(5974980..5975108) FT /rpt_family="Alu" FT repeat_region complement(5974866..5974965) FT /rpt_family="L1" FT repeat_region complement(5974509..5974614) FT /rpt_family="L2" FT repeat_region complement(5974268..5974435) FT /rpt_family="MIR" FT repeat_region complement(5973757..5974126) FT /rpt_family="L2" FT repeat_region complement(5973459..5973754) FT /rpt_family="Alu" FT repeat_region complement(5973109..5973410) FT /rpt_family="Alu" FT repeat_region complement(5972969..5972991) FT /rpt_family="AT_rich" FT repeat_region complement(5972647..5972948) FT /rpt_family="Alu" FT repeat_region complement(5972573..5972607) FT /rpt_family="AT_rich" FT repeat_region complement(5972192..5972328) FT /rpt_family="Alu" FT repeat_region complement(5971354..5971647) FT /rpt_family="Alu" FT repeat_region complement(5971075..5971346) FT /rpt_family="Alu" FT repeat_region complement(5970863..5971063) FT /rpt_family="L2" FT repeat_region complement(5970557..5970862) FT /rpt_family="Alu" FT repeat_region complement(5970506..5970556) FT /rpt_family="L2" FT repeat_region complement(5969441..5969735) FT /rpt_family="Alu" FT repeat_region complement(5968828..5969098) FT /rpt_family="Alu" FT repeat_region complement(5968634..5968817) FT /rpt_family="Alu" FT repeat_region complement(5968252..5968556) FT /rpt_family="Alu" FT repeat_region complement(5967600..5967692) FT /rpt_family="ERV1" FT repeat_region complement(5967293..5967580) FT /rpt_family="Alu" FT repeat_region complement(5967017..5967279) FT /rpt_family="ERV1" FT repeat_region complement(5966730..5967014) FT /rpt_family="Alu" FT repeat_region complement(5966654..5966728) FT /rpt_family="(CA)n" FT repeat_region complement(5966390..5966650) FT /rpt_family="Alu" FT gene 5938383..5966190 FT /gene="CGI-43" FT mRNA join(5938383..5938550,5939915..5940012,5940104..5940197, FT 5940486..5940563,5941288..5941335,5942292..5942375, FT 5944725..5944900,5949666..5949747,5951492..5951553, FT 5952474..5952585,5958498..5958531,5959480..5959597, FT 5963018..5963176,5963466..5963593,5965263..5966190) FT /gene="CGI-43" FT repeat_region complement(5965665..5965850) FT /rpt_family="Alu" FT CDS join(5938431..5938550,5939915..5940012,5940104..5940197, FT 5940486..5940563,5941288..5941335,5942292..5942375, FT 5944725..5944900,5949666..5949747,5951492..5951553, FT 5952474..5952585,5958498..5958531,5959480..5959597, FT 5963018..5963176,5963466..5963593,5965263..5965318) FT /codon_start=1 FT /gene="CGI-43" FT /product="unknown" FT /note="Homo sapiens CGI-43 protein (CGI-43), mRNA.; FT H_DJ1163J12.1" FT /protein_id="AAQ96868.1" FT /translation="MAAAAAGAGSGPWAAQEKQFPPALLSFFIYNPRFGPREGQEENKI FT LFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVM FT VVRNPIIEKQSKDGKPVIEYQEEELLDKVYSSVLRQCYSMYKLFNGTFLKAMEDGGVKL FT LKERLEKFFHRYLQTLHLQSCDLLDIFGGISFFPLDKMTYLKIQSFINRMEESLNIVKY FT TAFLYNDQLIWSGLEQDDMRILYKYLTTSLFPRHIEPELAGRDSPIRAEMPGNLQHYGR FT FLTGPLNLNDPDAKCRFPKIFVNTDDTYEELHLIVYKAMSAAVCFMIDASVHPTLDFCR FT RLDSIVGPQLTVLASDICEQFNINKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPS FT VSLTSVHPDLMKILGDINSDFTRVDEDEEIIVKAMSDYWVVGKKSDRRELYVILNQKNA FT NLIEVNEEVKKLCATQFNNIFFLD" FT repeat_region complement(5964847..5965119) FT /rpt_family="Alu" FT repeat_region complement(5963866..5964164) FT /rpt_family="Alu" FT repeat_region complement(5962668..5962966) FT /rpt_family="Alu" FT repeat_region complement(5962485..5962662) FT /rpt_family="MER1_type" FT repeat_region complement(5961475..5961784) FT /rpt_family="Alu" FT repeat_region complement(5960986..5961300) FT /rpt_family="Alu" FT repeat_region complement(5960571..5960859) FT /rpt_family="Alu" FT repeat_region complement(5960102..5960402) FT /rpt_family="Alu" FT repeat_region complement(5959025..5959203) FT /rpt_family="MIR" FT repeat_region complement(5958634..5958918) FT /rpt_family="Alu" FT repeat_region complement(5957491..5957576) FT /rpt_family="L1" FT repeat_region complement(5957181..5957490) FT /rpt_family="Alu" FT repeat_region complement(5956748..5957180) FT /rpt_family="L1" FT repeat_region complement(5956623..5956747) FT /rpt_family="T2_type" FT repeat_region complement(5956421..5956622) FT /rpt_family="L1" FT repeat_region complement(5956184..5956393) FT /rpt_family="ERVL" FT repeat_region complement(5956119..5956158) FT /rpt_family="(A)n" FT repeat_region complement(5956080..5956112) FT /rpt_family="(CAAAC)n" FT repeat_region complement(5955967..5956055) FT /rpt_family="ERVL" FT repeat_region complement(5955814..5955920) FT /rpt_family="MER2_type" FT repeat_region complement(5955527..5955813) FT /rpt_family="Alu" FT repeat_region complement(5955372..5955526) FT /rpt_family="MER2_type" FT repeat_region complement(5955299..5955363) FT /rpt_family="ERVL" FT repeat_region complement(5955161..5955244) FT /rpt_family="L1" FT repeat_region complement(5954523..5954691) FT /rpt_family="L1" FT repeat_region complement(5954229..5954522) FT /rpt_family="Alu" FT repeat_region complement(5954100..5954228) FT /rpt_family="L1" FT repeat_region complement(5953805..5954077) FT /rpt_family="Alu" FT repeat_region complement(5952012..5952330) FT /rpt_family="Alu" FT repeat_region complement(5951588..5951888) FT /rpt_family="Alu" FT repeat_region complement(5951226..5951394) FT /rpt_family="Alu" FT repeat_region complement(5951014..5951225) FT /rpt_family="Alu" FT repeat_region complement(5950307..5950666) FT /rpt_family="Alu" FT repeat_region complement(5950051..5950256) FT /rpt_family="Alu" FT repeat_region complement(5949962..5950009) FT /rpt_family="(CAAA)n" FT repeat_region complement(5949051..5949349) FT /rpt_family="Alu" FT repeat_region complement(5948903..5949047) FT /rpt_family="Alu" FT repeat_region complement(5948012..5948310) FT /rpt_family="Alu" FT repeat_region complement(5947816..5947954) FT /rpt_family="Alu" FT repeat_region complement(5947460..5947751) FT /rpt_family="Alu" FT repeat_region complement(5946501..5946789) FT /rpt_family="Alu" FT repeat_region complement(5945943..5946253) FT /rpt_family="Alu" FT repeat_region complement(5945534..5945668) FT /rpt_family="Alu" FT repeat_region complement(5945133..5945438) FT /rpt_family="Alu" FT repeat_region complement(5944182..5944472) FT /rpt_family="Alu" FT repeat_region complement(5944042..5944175) FT /rpt_family="Alu" FT repeat_region complement(5943720..5944016) FT /rpt_family="Alu" FT repeat_region complement(5943343..5943624) FT /rpt_family="Alu" FT repeat_region complement(5942941..5943049) FT /rpt_family="Alu" FT repeat_region complement(5941643..5941954) FT /rpt_family="Alu" FT repeat_region complement(5940834..5941134) FT /rpt_family="Alu" FT repeat_region complement(5940582..5940604) FT /rpt_family="AT_rich" FT repeat_region complement(5939681..5939771) FT /rpt_family="Alu" FT repeat_region complement(5939107..5939411) FT /rpt_family="Alu" FT repeat_region complement(5938966..5939014) FT /rpt_family="(CA)n" FT misc_feature complement(5938174..5938748) FT /note="CpG_island (%GC=70.1, o/e=0.83, #CpGs=62)" FT repeat_region complement(5938560..5938588) FT /rpt_family="GC_rich" FT repeat_region complement(5938440..5938476) FT /rpt_family="GC_rich" FT repeat_region complement(5937872..5938166) FT /rpt_family="Alu" FT repeat_region complement(5937590..5937837) FT /rpt_family="Alu" FT repeat_region complement(5937051..5937561) FT /rpt_family="ERV1" FT repeat_region complement(5937010..5937045) FT /rpt_family="Alu" FT repeat_region complement(5936680..5936993) FT /rpt_family="Alu" FT repeat_region complement(5936321..5936614) FT /rpt_family="Alu" FT repeat_region complement(5935624..5935846) FT /rpt_family="MIR" FT repeat_region complement(5935229..5935551) FT /rpt_family="Alu" FT repeat_region complement(5934039..5934326) FT /rpt_family="Alu" FT repeat_region complement(5933117..5933137) FT /rpt_family="AT_rich" FT repeat_region complement(5933063..5933116) FT /rpt_family="U6" FT repeat_region complement(5932718..5933035) FT /rpt_family="Alu" FT repeat_region complement(5932242..5932531) FT /rpt_family="Alu" FT repeat_region complement(5931920..5932213) FT /rpt_family="Alu" FT repeat_region complement(5931263..5931575) FT /rpt_family="Alu" FT repeat_region complement(5930976..5931203) FT /rpt_family="Alu" FT repeat_region complement(5930948..5930975) FT /rpt_family="AT_rich" FT repeat_region complement(5930595..5930904) FT /rpt_family="Alu" FT repeat_region complement(5930473..5930550) FT /rpt_family="L1" FT repeat_region complement(5930350..5930370) FT /rpt_family="(T)n" FT repeat_region complement(5929997..5930274) FT /rpt_family="Alu" FT repeat_region complement(5929322..5929616) FT /rpt_family="Alu" FT repeat_region complement(5928851..5928983) FT /rpt_family="Alu" FT repeat_region complement(5928239..5928531) FT /rpt_family="Alu" FT repeat_region complement(5927668..5927687) FT /rpt_family="(T)n" FT repeat_region complement(5927338..5927596) FT /rpt_family="Alu" FT repeat_region complement(5927036..5927315) FT /rpt_family="Alu" FT repeat_region complement(5926725..5927031) FT /rpt_family="Alu" FT repeat_region complement(5926267..5926570) FT /rpt_family="Alu" FT repeat_region complement(5925232..5925539) FT /rpt_family="Alu" FT repeat_region complement(5924469..5924767) FT /rpt_family="Alu" FT repeat_region complement(5923730..5923779) FT /rpt_family="MIR" FT repeat_region complement(5923029..5923339) FT /rpt_family="Alu" FT repeat_region complement(5922818..5923009) FT /rpt_family="Alu" FT repeat_region complement(5922469..5922772) FT /rpt_family="Alu" FT repeat_region complement(5921437..5921746) FT /rpt_family="Alu" FT repeat_region complement(5920970..5921287) FT /rpt_family="Alu" FT repeat_region complement(5920668..5920966) FT /rpt_family="Alu" FT repeat_region complement(5920108..5920408) FT /rpt_family="Alu" FT repeat_region complement(5918530..5918844) FT /rpt_family="Alu" FT repeat_region complement(5918507..5918529) FT /rpt_family="(T)n" FT repeat_region complement(5918455..5918502) FT /rpt_family="L2" FT repeat_region complement(5918398..5918451) FT /rpt_family="L1" FT repeat_region complement(5918096..5918397) FT /rpt_family="Alu" FT repeat_region complement(5917894..5918095) FT /rpt_family="L1" FT repeat_region complement(5917608..5917893) FT /rpt_family="Alu" FT repeat_region complement(5917476..5917607) FT /rpt_family="L1" FT repeat_region complement(5917168..5917475) FT /rpt_family="Alu" FT repeat_region complement(5917142..5917167) FT /rpt_family="L1" FT repeat_region complement(5916814..5917125) FT /rpt_family="Alu" FT repeat_region complement(5916434..5916736) FT /rpt_family="Alu" FT repeat_region complement(5916159..5916243) FT /rpt_family="L2" FT repeat_region complement(5915934..5916077) FT /rpt_family="Alu" FT repeat_region complement(5915634..5915933) FT /rpt_family="Alu" FT repeat_region complement(5915468..5915633) FT /rpt_family="Alu" FT repeat_region complement(5915109..5915237) FT /rpt_family="Alu" FT repeat_region complement(5915085..5915108) FT /rpt_family="AT_rich" FT repeat_region complement(5914691..5914987) FT /rpt_family="Alu" FT repeat_region complement(5914660..5914690) FT /rpt_family="(TA)n" FT repeat_region complement(5914437..5914648) FT /rpt_family="L1" FT repeat_region complement(5914133..5914436) FT /rpt_family="Alu" FT repeat_region complement(5914099..5914132) FT /rpt_family="L1" FT repeat_region complement(5913986..5914025) FT /rpt_family="(TATATG)n" FT repeat_region complement(5913565..5913884) FT /rpt_family="Alu" FT repeat_region complement(5913306..5913448) FT /rpt_family="L2" FT repeat_region complement(5913145..5913275) FT /rpt_family="Alu" FT repeat_region complement(5913043..5913124) FT /rpt_family="Alu" FT repeat_region complement(5913023..5913042) FT /rpt_family="(TTAAA)n" FT repeat_region complement(5912724..5913016) FT /rpt_family="Alu" FT repeat_region complement(5912553..5912719) FT /rpt_family="Alu" FT repeat_region complement(5912257..5912505) FT /rpt_family="SVA" FT repeat_region complement(5911363..5911681) FT /rpt_family="7SLRNA" FT misc_RNA complement(5911384..5911681) FT /product="misc_RNA-SRP_RNA-related" FT repeat_region complement(5911235..5911361) FT /rpt_family="AcHobo" FT repeat_region complement(5911003..5911112) FT /rpt_family="Alu" FT repeat_region complement(5910696..5911002) FT /rpt_family="Alu" FT repeat_region complement(5910525..5910695) FT /rpt_family="Alu" FT repeat_region complement(5910410..5910477) FT /rpt_family="ERVL" FT repeat_region complement(5909769..5910043) FT /rpt_family="Alu" FT repeat_region complement(5909726..5909754) FT /rpt_family="(TAAAA)n" FT repeat_region complement(5909495..5909642) FT /rpt_family="AcHobo" FT repeat_region complement(5908947..5909251) FT /rpt_family="Alu" FT repeat_region complement(5908412..5908722) FT /rpt_family="Alu" FT repeat_region complement(5907784..5908077) FT /rpt_family="Alu" FT repeat_region complement(5907668..5907756) FT /rpt_family="L1" FT repeat_region complement(5907400..5907667) FT /rpt_family="Alu" FT repeat_region complement(5906960..5907399) FT /rpt_family="L1" FT repeat_region complement(5906845..5906959) FT /rpt_family="Alu" FT repeat_region complement(5906760..5906844) FT /rpt_family="L1" FT repeat_region complement(5906483..5906523) FT /rpt_family="ERVL" FT repeat_region complement(5906347..5906465) FT /rpt_family="ERVL" FT repeat_region complement(5905971..5906150) FT /rpt_family="CT-rich" FT repeat_region complement(5905671..5905947) FT /rpt_family="Alu" FT repeat_region complement(5905204..5905288) FT /rpt_family="Mariner" FT repeat_region complement(5904304..5904583) FT /rpt_family="Alu" FT repeat_region complement(5903689..5903999) FT /rpt_family="Alu" FT repeat_region complement(5903463..5903683) FT /rpt_family="L2" FT repeat_region complement(5903163..5903462) FT /rpt_family="Alu" FT repeat_region complement(5903008..5903162) FT /rpt_family="L2" FT repeat_region complement(5902689..5903002) FT /rpt_family="ERV1" FT repeat_region complement(5902617..5902686) FT /rpt_family="ERV1" FT repeat_region complement(5902572..5902647) FT /rpt_family="ERV1" FT repeat_region complement(5902308..5902569) FT /rpt_family="ERV1" FT repeat_region complement(5902012..5902339) FT /rpt_family="ERV1" FT repeat_region complement(5901817..5901929) FT /rpt_family="ERV1" FT repeat_region complement(5901692..5901768) FT /rpt_family="L1" FT repeat_region complement(5901530..5901691) FT /rpt_family="Alu" FT repeat_region complement(5901510..5901529) FT /rpt_family="L1" FT repeat_region complement(5901355..5901509) FT /rpt_family="Alu" FT repeat_region complement(5901250..5901354) FT /rpt_family="L1" FT repeat_region complement(5900777..5901068) FT /rpt_family="Alu" FT repeat_region complement(5900441..5900521) FT /rpt_family="L1" FT repeat_region complement(5900343..5900441) FT /rpt_family="L1" FT repeat_region complement(5900215..5900307) FT /rpt_family="L1" FT repeat_region complement(5900057..5900209) FT /rpt_family="(TA)n" FT repeat_region complement(5899978..5900049) FT /rpt_family="L1" FT repeat_region complement(5899345..5899618) FT /rpt_family="Alu" FT repeat_region complement(5899291..5899341) FT /rpt_family="(CAAAA)n" FT repeat_region complement(5898885..5899188) FT /rpt_family="Alu" FT repeat_region complement(5898754..5898837) FT /rpt_family="MIR" FT repeat_region complement(5898417..5898753) FT /rpt_family="Alu" FT repeat_region complement(5898344..5898416) FT /rpt_family="ERV1" FT repeat_region complement(5898274..5898343) FT /rpt_family="Alu" FT repeat_region complement(5897972..5898270) FT /rpt_family="Alu" FT repeat_region complement(5897807..5897951) FT /rpt_family="L1" FT repeat_region complement(5897507..5897806) FT /rpt_family="Alu" FT repeat_region complement(5897374..5897506) FT /rpt_family="L1" FT repeat_region complement(5897072..5897373) FT /rpt_family="Alu" FT repeat_region complement(5896700..5897071) FT /rpt_family="L1" FT repeat_region complement(5896396..5896699) FT /rpt_family="Alu" FT repeat_region complement(5896137..5896395) FT /rpt_family="L1" FT repeat_region complement(5895863..5896136) FT /rpt_family="Alu" FT repeat_region complement(5895469..5895765) FT /rpt_family="Alu" FT repeat_region complement(5895172..5895457) FT /rpt_family="Alu" FT repeat_region complement(5894704..5894980) FT /rpt_family="Alu" FT repeat_region complement(5894092..5894444) FT /rpt_family="Alu" FT repeat_region complement(5893698..5893794) FT /rpt_family="L2" FT repeat_region complement(5893352..5893645) FT /rpt_family="Alu" FT repeat_region complement(5892983..5893279) FT /rpt_family="Alu" FT repeat_region complement(5892573..5892753) FT /rpt_family="MIR" FT repeat_region complement(5892500..5892555) FT /rpt_family="Alu" FT repeat_region complement(5892219..5892499) FT /rpt_family="Alu" FT repeat_region complement(5892042..5892169) FT /rpt_family="MIR" FT repeat_region complement(5891614..5891900) FT /rpt_family="Alu" FT repeat_region complement(5890571..5890676) FT /rpt_family="L1" FT repeat_region complement(5890269..5890570) FT /rpt_family="Alu" FT repeat_region complement(5890079..5890268) FT /rpt_family="L1" FT repeat_region complement(5889795..5890075) FT /rpt_family="Alu" FT repeat_region complement(5889337..5889501) FT /rpt_family="L1" FT repeat_region complement(5889050..5889336) FT /rpt_family="Alu" FT repeat_region complement(5889003..5889049) FT /rpt_family="L1" FT repeat_region complement(5888690..5888985) FT /rpt_family="Alu" FT repeat_region complement(5888252..5888296) FT /rpt_family="Alu" FT repeat_region complement(5887924..5888205) FT /rpt_family="Alu" FT repeat_region complement(5887553..5887854) FT /rpt_family="Alu" FT misc_feature complement(5886993..5887606) FT /note="CpG_island (%GC=61.6, o/e=0.98, #CpGs=48)" FT repeat_region complement(5886061..5886367) FT /rpt_family="Alu" FT repeat_region complement(5885840..5885971) FT /rpt_family="Alu" FT repeat_region complement(5885404..5885699) FT /rpt_family="Alu" FT repeat_region complement(5884938..5885225) FT /rpt_family="Alu" FT repeat_region complement(5884789..5884920) FT /rpt_family="Alu" FT repeat_region complement(5884372..5884687) FT /rpt_family="Alu" FT repeat_region complement(5884073..5884362) FT /rpt_family="Alu" FT repeat_region complement(5883755..5884066) FT /rpt_family="Alu" FT repeat_region complement(5883209..5883334) FT /rpt_family="Alu" FT repeat_region complement(5883036..5883184) FT /rpt_family="Alu" FT repeat_region complement(5882703..5882987) FT /rpt_family="Alu" FT repeat_region complement(5882321..5882551) FT /rpt_family="Alu" FT repeat_region complement(5881669..5881963) FT /rpt_family="Alu" FT repeat_region complement(5881338..5881665) FT /rpt_family="Alu" FT repeat_region complement(5880905..5881195) FT /rpt_family="Alu" FT repeat_region complement(5880558..5880857) FT /rpt_family="Alu" FT repeat_region complement(5879913..5880204) FT /rpt_family="Alu" FT repeat_region complement(5879799..5879883) FT /rpt_family="Alu" FT repeat_region complement(5879093..5879385) FT /rpt_family="Alu" FT repeat_region complement(5878691..5879074) FT /rpt_family="L2" FT repeat_region complement(6083070..6083183) FT /rpt_family="Alu" FT repeat_region complement(6082931..6083059) FT /rpt_family="Alu" FT repeat_region complement(6082821..6082930) FT /rpt_family="MER1_type" FT gene complement(6063459..6082624) FT /gene="HRI" FT mRNA complement(join(6063459..6064432,6066359..6066592, FT 6068246..6068328,6068549..6068663,6077055..6077155, FT 6078191..6078302,6080523..6080850,6082564..6082624)) FT /gene="HRI" FT mRNA complement(join(6063462..6064432,6066359..6066592, FT 6068246..6068328,6068549..6068663,6077055..6077155, FT 6078191..6078302,6080523..6080850,6082564..6082624)) FT /gene="HRI" FT CDS complement(join(6064304..6064432,6066359..6066592, FT 6068246..6068328,6068549..6068663,6077055..6077155, FT 6078191..6078302,6080523..6080850,6082564..>6082624)) FT /codon_start=3 FT /gene="HRI" FT /product="unknown" FT /note="Homo sapiens heme-regulated initiation factor FT 2-alpha kinase (HRI), mRNA.; H_DJ0042M02.1 This gene was FT based on gi(11125767 13676375) Continues from FT H_DJ0810E06.1" FT /protein_id="AAS00388.1" FT /translation="DRAAIELPSLEVLSDQEEDREQCGVKNDESSSSSIIFAEPTPEKE FT KRFGESDTENQNNKSVKYTTNLVIRESGELESTLELQENGLAGLSASSIVEQQLPLRRN FT SHLEESFTSTEESSEENVNFLGQTEAQYHLMLHIQMQLCELSLWDWIVERNKRGREYVD FT ESACPYVMANVATKIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLAC FT TDILQKNTDWTNRNGKRTPTHTSRVGTCLYASPEQLEGSEYDAKSDMYSLGVVLLELFQ FT PFGTEMERAEVLTGLRTGQLPESLRKRCPVQAKYIQHLTRRNSSQRPSAIQLLQSELFQ FT NSGNVNLTLQMKIIEQEKEIAELKKQLNLLSQDKGVRDDGKDGGVG" FT repeat_region complement(6082216..6082513) FT /rpt_family="Alu" FT repeat_region complement(6081800..6082097) FT /rpt_family="Alu" FT repeat_region complement(6081498..6081797) FT /rpt_family="Alu" FT repeat_region complement(6081191..6081486) FT /rpt_family="Alu" FT repeat_region complement(6080888..6081187) FT /rpt_family="Alu" FT repeat_region complement(6079703..6079983) FT /rpt_family="Alu" FT repeat_region complement(6079288..6079579) FT /rpt_family="Alu" FT repeat_region complement(6078971..6079273) FT /rpt_family="Alu" FT repeat_region complement(6078354..6078397) FT /rpt_family="L2" FT repeat_region complement(6077779..6078098) FT /rpt_family="Alu" FT repeat_region complement(6077462..6077525) FT /rpt_family="MIR" FT repeat_region complement(6076579..6076876) FT /rpt_family="Alu" FT repeat_region complement(6074814..6074854) FT /rpt_family="AT_rich" FT repeat_region complement(6074153..6074290) FT /rpt_family="L2" FT repeat_region complement(6073667..6073941) FT /rpt_family="Alu" FT repeat_region complement(6073509..6073650) FT /rpt_family="L2" FT repeat_region complement(6073212..6073499) FT /rpt_family="Alu" FT repeat_region complement(6072592..6072900) FT /rpt_family="Alu" FT repeat_region complement(6071825..6071907) FT /rpt_family="L1" FT repeat_region complement(6071523..6071824) FT /rpt_family="Alu" FT repeat_region complement(6071468..6071522) FT /rpt_family="L1" FT repeat_region complement(6070428..6070489) FT /rpt_family="MER1_type" FT repeat_region complement(6070138..6070427) FT /rpt_family="Alu" FT repeat_region complement(6070123..6070137) FT /rpt_family="MER1_type" FT repeat_region complement(6069671..6070122) FT /rpt_family="ERV1" FT repeat_region complement(6069633..6069670) FT /rpt_family="MER1_type" FT repeat_region complement(6069332..6069632) FT /rpt_family="Alu" FT repeat_region complement(6069271..6069331) FT /rpt_family="MER1_type" FT repeat_region complement(6069138..6069232) FT /rpt_family="MER1_type" FT repeat_region complement(6068849..6069137) FT /rpt_family="Alu" FT repeat_region complement(6068787..6068848) FT /rpt_family="MER1_type" FT repeat_region complement(6067882..6068182) FT /rpt_family="Alu" FT repeat_region complement(6067415..6067721) FT /rpt_family="Alu" FT repeat_region complement(6065283..6065569) FT /rpt_family="Alu" FT repeat_region complement(6064952..6065086) FT /rpt_family="Alu" FT repeat_region complement(6064471..6064769) FT /rpt_family="Alu" FT gene 6048882..6063465 FT /gene="JTV1" FT mRNA join(6048882..6049129,6054777..6054983,6057445..6057676, FT 6062934..6063465) FT /gene="JTV1" FT mRNA join(6048922..6049129,6054777..6054983,6057445..6057676, FT 6062934..6063465) FT /gene="JTV1" FT mRNA join(6048914..6049129,6054777..6054983,6057445..6057676, FT 6062934..6063461) FT /gene="JTV1" FT CDS join(6048995..6049129,6054777..6054983,6057445..6057676, FT 6062934..6063322) FT /codon_start=1 FT /gene="JTV1" FT /product="unknown" FT /note="Homo sapiens JTV1 gene (JTV1), mRNA.; H_DJ0042M02.2 FT This gene was based on gi(11125769 12804002 14603414 FT 15489022)" FT /protein_id="AAS00389.1" FT /translation="MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQ FT EESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTN FT ALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPE FT NLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFG FT QKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVL FT WSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK" FT repeat_region complement(6062635..6062705) FT /rpt_family="CR1" FT repeat_region complement(6061872..6062097) FT /rpt_family="MER2_type" FT repeat_region complement(6061713..6061870) FT /rpt_family="Alu" FT repeat_region complement(6060829..6060995) FT /rpt_family="Alu" FT repeat_region complement(6059770..6060070) FT /rpt_family="Alu" FT repeat_region complement(6059373..6059668) FT /rpt_family="Alu" FT repeat_region complement(6058867..6059134) FT /rpt_family="Alu" FT repeat_region complement(6058600..6058622) FT /rpt_family="(TG)n" FT repeat_region complement(6058185..6058487) FT /rpt_family="Alu" FT repeat_region complement(6057766..6058076) FT /rpt_family="Alu" FT repeat_region complement(6057245..6057393) FT /rpt_family="MIR" FT repeat_region complement(6056865..6057168) FT /rpt_family="Alu" FT repeat_region complement(6055074..6055369) FT /rpt_family="Alu" FT repeat_region complement(6054339..6054650) FT /rpt_family="Alu" FT repeat_region complement(6053882..6054190) FT /rpt_family="Alu" FT repeat_region complement(6053298..6053608) FT /rpt_family="Alu" FT repeat_region complement(6053192..6053267) FT /rpt_family="L2" FT repeat_region complement(6052887..6053191) FT /rpt_family="Alu" FT repeat_region complement(6052582..6052886) FT /rpt_family="L2" FT repeat_region complement(6052193..6052482) FT /rpt_family="Alu" FT repeat_region complement(6051602..6051905) FT /rpt_family="Alu" FT repeat_region complement(6050599..6051103) FT /rpt_family="L1" FT repeat_region complement(6050504..6050597) FT /rpt_family="Alu" FT repeat_region complement(6050073..6050379) FT /rpt_family="Alu" FT repeat_region complement(6049858..6050072) FT /rpt_family="L1" FT repeat_region complement(6049639..6049758) FT /rpt_family="Alu" FT repeat_region complement(6049606..6049631) FT /rpt_family="(TA)n" FT repeat_region complement(6049300..6049605) FT /rpt_family="Alu" FT misc_feature complement(6048397..6049357) FT /note="CpG_island (%GC=66.2, o/e=0.83, #CpGs=89)" FT gene complement(6012873..6048674) FT /gene="PMS2" FT mRNA complement(join(6012873..6013173,6017219..6017388, FT 6018227..6018327,6022455..6022622,6026390..6027251, FT 6029431..6029586,6031604..6031688,6035165..6035264, FT 6036957..6037054,6038739..6038906,6042084..6042267, FT 6043321..6043423,6043603..6043689,6045523..6045662, FT 6048628..6048674)) FT /gene="PMS2" FT CDS complement(join(6013030..6013173,6017219..6017388, FT 6018227..6018327,6022455..6022622,6026390..6027251, FT 6029431..6029586,6031604..6031688,6035165..6035264, FT 6036957..6037054,6038739..6038906,6042084..6042267, FT 6043321..6043423,6043603..6043689,6045523..6045662, FT 6048628..6048650)) FT /codon_start=1 FT /gene="PMS2" FT /product="unknown" FT /note="Homo sapiens PMS2 postmeiotic segregation increased FT 2 (S. cerevisiae) (PMS2), mRNA.; H_DJ0042M02.3 This gene FT was based on gi(11125773)" FT /protein_id="AAS00390.1" FT /translation="MERAESSSTEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVEN FT SLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQVETF FT GFRGEALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLF FT STLPVRHKEFQRNIKKEYAKMVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPS FT IKENIGSVFGQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVG FT RSSTDRQFFFINRRPCDPAKVCRLVNEVYHMYNRHQYPFVVLNISVDSECVDINVTPDK FT RQILLQEEKLLLAVLKTSLIGMFDSDVNKLNVSQQPLLDVEGNLIKMHAADLEKPMVEK FT QDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRSPLGQKRGMLSSST FT SGAISDKGVLRPQKEAVSSSHGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSS FT EYAASSPGDRGSQEHVDSQEKAPKTDDSFSDVDCHSNQEDTGCKFRVLPQPTNLATPNT FT KRFKKEEILSSSDICQKLVNTQDMSASQVDVAVKINKKVVPLDFSMSSLAKRIKQLHHE FT AQQSEGEQNYRKFRAKICPGENQAAEDELRKEISKTMFAEMEIIGQFNLGFIITKLNED FT IFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAVNEAVLIENLEIFRKNGFDF FT VIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLSDSPGVMCRPSRVKQMFASRAC FT RKSVMIGTALNTSEMKKLITHMGEMDHPWNCPHGRPTMRHIANLGVISQN" FT repeat_region complement(6048099..6048239) FT /rpt_family="Alu" FT repeat_region complement(6047488..6047787) FT /rpt_family="Alu" FT repeat_region complement(6046719..6047025) FT /rpt_family="Alu" FT repeat_region complement(6046469..6046644) FT /rpt_family="L2" FT repeat_region complement(6046001..6046273) FT /rpt_family="Alu" FT repeat_region complement(6045268..6045353) FT /rpt_family="MIR" FT repeat_region complement(6045140..6045267) FT /rpt_family="Alu" FT repeat_region complement(6044838..6045134) FT /rpt_family="Alu" FT repeat_region complement(6044521..6044824) FT /rpt_family="Alu" FT repeat_region complement(6044370..6044509) FT /rpt_family="MIR" FT repeat_region complement(6044065..6044368) FT /rpt_family="Alu" FT ncRNA complement(6043917..6044016) FT /gene="PMS2" FT /product="scRNA-hY3_RNA-related" FT /ncRNA_class="scRNA" FT repeat_region complement(6043917..6044016) FT /rpt_family="HY3" FT repeat_region complement(6043698..6043725) FT /rpt_family="AT_rich" FT repeat_region complement(6042938..6042973) FT /rpt_family="AT_rich" FT repeat_region complement(6042643..6042936) FT /rpt_family="Alu" FT repeat_region complement(6041673..6041876) FT /rpt_family="Alu" FT repeat_region complement(6041333..6041652) FT /rpt_family="Alu" FT repeat_region complement(6041002..6041299) FT /rpt_family="Alu" FT repeat_region complement(6040712..6040931) FT /rpt_family="L1" FT repeat_region complement(6040340..6040636) FT /rpt_family="Alu" FT repeat_region complement(6039724..6040030) FT /rpt_family="Alu" FT repeat_region complement(6039450..6039651) FT /rpt_family="L1" FT repeat_region complement(6039159..6039446) FT /rpt_family="Alu" FT repeat_region complement(6038341..6038636) FT /rpt_family="Alu" FT repeat_region complement(6038044..6038338) FT /rpt_family="Alu" FT repeat_region complement(6037705..6038010) FT /rpt_family="Alu" FT repeat_region complement(6037438..6037511) FT /rpt_family="Alu" FT repeat_region complement(6037173..6037432) FT /rpt_family="Alu" FT repeat_region complement(6036564..6036860) FT /rpt_family="Alu" FT repeat_region complement(6036223..6036263) FT /rpt_family="(TA)n" FT repeat_region complement(6035903..6036222) FT /rpt_family="Alu" FT repeat_region complement(6034680..6034965) FT /rpt_family="Alu" FT repeat_region complement(6034433..6034657) FT /rpt_family="MER2_type" FT repeat_region complement(6034124..6034432) FT /rpt_family="Alu" FT repeat_region complement(6034057..6034123) FT /rpt_family="MER2_type" FT repeat_region complement(6033732..6034044) FT /rpt_family="Alu" FT repeat_region complement(6033615..6033708) FT /rpt_family="(TATATG)n" FT repeat_region complement(6033212..6033523) FT /rpt_family="Alu" FT repeat_region complement(6033030..6033203) FT /rpt_family="L1" FT repeat_region complement(6032720..6033029) FT /rpt_family="Alu" FT repeat_region complement(6032690..6032719) FT /rpt_family="L1" FT repeat_region complement(6032602..6032629) FT /rpt_family="AT_rich" FT repeat_region complement(6032261..6032413) FT /rpt_family="L1" FT repeat_region complement(6031948..6032250) FT /rpt_family="Alu" FT repeat_region complement(6031798..6031943) FT /rpt_family="Alu" FT repeat_region complement(6031189..6031491) FT /rpt_family="Alu" FT repeat_region complement(6031166..6031187) FT /rpt_family="AT_rich" FT repeat_region complement(6030909..6030931) FT /rpt_family="(TC)n" FT repeat_region complement(6030652..6030878) FT /rpt_family="L1" FT repeat_region complement(6030362..6030651) FT /rpt_family="Alu" FT repeat_region complement(6030234..6030361) FT /rpt_family="L1" FT repeat_region complement(6029629..6029938) FT /rpt_family="Alu" FT repeat_region complement(6029182..6029313) FT /rpt_family="Alu" FT repeat_region complement(6028806..6029071) FT /rpt_family="Alu" FT repeat_region complement(6028781..6028805) FT /rpt_family="L1" FT repeat_region complement(6028477..6028780) FT /rpt_family="Alu" FT repeat_region complement(6028209..6028476) FT /rpt_family="L1" FT repeat_region complement(6027929..6028208) FT /rpt_family="Alu" FT repeat_region complement(6027710..6027928) FT /rpt_family="L1" FT repeat_region complement(6027404..6027709) FT /rpt_family="Alu" FT repeat_region complement(6027318..6027403) FT /rpt_family="L1" FT repeat_region complement(6026041..6026348) FT /rpt_family="Alu" FT repeat_region complement(6025843..6026010) FT /rpt_family="Alu" FT repeat_region complement(6025173..6025482) FT /rpt_family="Alu" FT repeat_region complement(6025038..6025166) FT /rpt_family="ERVL" FT repeat_region complement(6024737..6025037) FT /rpt_family="Alu" FT repeat_region complement(6024678..6024736) FT /rpt_family="ERVL" FT repeat_region complement(6024157..6024430) FT /rpt_family="Alu" FT repeat_region complement(6023588..6023888) FT /rpt_family="L1" FT repeat_region complement(6023276..6023582) FT /rpt_family="Alu" FT repeat_region complement(6023159..6023186) FT /rpt_family="AT_rich" FT repeat_region complement(6022749..6023039) FT /rpt_family="Alu" FT repeat_region complement(6022315..6022400) FT /rpt_family="Alu" FT repeat_region complement(6022135..6022267) FT /rpt_family="Alu" FT repeat_region complement(6021824..6022134) FT /rpt_family="Alu" FT repeat_region complement(6021654..6021823) FT /rpt_family="Alu" FT repeat_region complement(6021373..6021563) FT /rpt_family="MIR" FT repeat_region complement(6020856..6021176) FT /rpt_family="Alu" FT repeat_region complement(6020109..6020410) FT /rpt_family="Alu" FT repeat_region complement(6019452..6019771) FT /rpt_family="L2" FT repeat_region complement(6019313..6019451) FT /rpt_family="Alu" FT repeat_region complement(6018862..6019036) FT /rpt_family="Alu" FT repeat_region complement(6018544..6018854) FT /rpt_family="Alu" FT repeat_region complement(6017904..6018201) FT /rpt_family="Alu" FT repeat_region complement(6017813..6017841) FT /rpt_family="AT_rich" FT repeat_region complement(6017469..6017764) FT /rpt_family="Alu" FT repeat_region complement(6016688..6016985) FT /rpt_family="Alu" FT repeat_region complement(6016418..6016680) FT /rpt_family="Alu" FT repeat_region complement(6015885..6016078) FT /rpt_family="L2" FT repeat_region complement(6015590..6015884) FT /rpt_family="Alu" FT repeat_region complement(6015469..6015589) FT /rpt_family="L2" FT repeat_region complement(6015168..6015468) FT /rpt_family="Alu" FT repeat_region complement(6015085..6015167) FT /rpt_family="L2" FT repeat_region complement(6014747..6014830) FT /rpt_family="L2" FT repeat_region complement(6014448..6014714) FT /rpt_family="Alu" FT repeat_region complement(6013388..6013765) FT /rpt_family="L2" FT repeat_region complement(6012450..6012773) FT /rpt_family="Alu" FT repeat_region complement(6011680..6011786) FT /rpt_family="MaLR" FT repeat_region complement(6011380..6011679) FT /rpt_family="Alu" FT repeat_region complement(6011205..6011379) FT /rpt_family="MaLR" FT repeat_region complement(6010679..6011204) FT /rpt_family="MER1_type" FT repeat_region complement(6010515..6010678) FT /rpt_family="MaLR" FT misc_feature complement(6010076..6010408) FT /note="CpG_island (%GC=73.3, o/e=0.86, #CpGs=37)" FT repeat_region complement(6009528..6009814) FT /rpt_family="Alu" FT repeat_region complement(6008930..6009074) FT /rpt_family="MIR" FT repeat_region complement(6008792..6008925) FT /rpt_family="Alu" FT repeat_region complement(6008456..6008771) FT /rpt_family="Alu" FT repeat_region complement(6008127..6008428) FT /rpt_family="Alu" FT repeat_region complement(6007740..6008043) FT /rpt_family="Alu" FT repeat_region complement(6007318..6007611) FT /rpt_family="Alu" FT repeat_region complement(6006952..6007241) FT /rpt_family="Alu" FT repeat_region complement(6006146..6006445) FT /rpt_family="Alu" FT repeat_region complement(6006006..6006114) FT /rpt_family="L1" FT repeat_region complement(6005880..6005977) FT /rpt_family="L1" FT repeat_region complement(6005545..6005861) FT /rpt_family="Alu" FT repeat_region complement(6005446..6005474) FT /rpt_family="AT_rich" FT repeat_region complement(6004752..6005071) FT /rpt_family="Alu" FT repeat_region complement(6004260..6004544) FT /rpt_family="Alu" FT repeat_region complement(6003792..6003875) FT /rpt_family="Alu" FT repeat_region complement(6003415..6003711) FT /rpt_family="Alu" FT repeat_region complement(6003318..6003399) FT /rpt_family="L1" FT repeat_region 6236080..6236391 FT /rpt_family="Alu" FT repeat_region 6236922..6237024 FT /rpt_family="L1" FT repeat_region 6237032..6237333 FT /rpt_family="Alu" FT repeat_region 6237441..6237752 FT /rpt_family="Alu" FT repeat_region 6238924..6238999 FT /rpt_family="L1" FT repeat_region 6239000..6239134 FT /rpt_family="Alu" FT repeat_region 6239135..6239149 FT /rpt_family="L1" FT repeat_region 6239152..6239598 FT /rpt_family="L1" FT repeat_region 6239646..6239747 FT /rpt_family="Tc2" FT repeat_region 6240401..6240690 FT /rpt_family="Alu" FT repeat_region 6241654..6242088 FT /rpt_family="MaLR" FT repeat_region 6242089..6242389 FT /rpt_family="Alu" FT repeat_region 6242390..6242456 FT /rpt_family="MaLR" FT repeat_region 6242518..6242793 FT /rpt_family="L1" FT repeat_region 6242890..6243354 FT /rpt_family="Tc2" FT repeat_region 6243355..6243647 FT /rpt_family="Alu" FT repeat_region 6243648..6243830 FT /rpt_family="Tc2" FT repeat_region 6244460..6244517 FT /rpt_family="L1" FT repeat_region 6244518..6244813 FT /rpt_family="Alu" FT repeat_region 6244814..6244922 FT /rpt_family="L1" FT repeat_region 6244923..6245233 FT /rpt_family="Alu" FT repeat_region 6245234..6245305 FT /rpt_family="L1" FT repeat_region 6245311..6245535 FT /rpt_family="Alu" FT repeat_region 6245654..6246187 FT /rpt_family="L1" FT repeat_region 6246573..6246717 FT /rpt_family="Tc2" FT repeat_region 6246718..6247024 FT /rpt_family="Alu" FT repeat_region 6247025..6247057 FT /rpt_family="Tc2" FT repeat_region 6247115..6247298 FT /rpt_family="Alu" FT repeat_region 6247299..6247579 FT /rpt_family="Alu" FT repeat_region 6247714..6247749 FT /rpt_family="U2" FT repeat_region 6248170..6248457 FT /rpt_family="Alu" FT repeat_region 6248477..6248664 FT /rpt_family="MER1_type" FT repeat_region 6248743..6248870 FT /rpt_family="MIR" FT repeat_region 6249168..6249927 FT /rpt_family="L1" FT repeat_region 6250648..6250958 FT /rpt_family="L2" FT repeat_region 6250975..6251099 FT /rpt_family="MIR" FT repeat_region 6251136..6251217 FT /rpt_family="Alu" FT repeat_region 6251219..6251262 FT /rpt_family="Alu" FT repeat_region 6251264..6251346 FT /rpt_family="L1" FT repeat_region 6251347..6251646 FT /rpt_family="Alu" FT repeat_region 6251647..6251767 FT /rpt_family="L1" FT repeat_region 6251775..6251922 FT /rpt_family="Alu" FT repeat_region 6251925..6252269 FT /rpt_family="L1" FT repeat_region 6252270..6252371 FT /rpt_family="HY1" FT ncRNA complement(6252270..6252337) FT /product="scRNA-hY1_RNA-related" FT /ncRNA_class="scRNA" FT repeat_region 6252372..6252492 FT /rpt_family="L1" FT repeat_region 6252494..6252599 FT /rpt_family="L1" FT repeat_region 6252689..6252825 FT /rpt_family="L2" FT repeat_region 6253166..6253185 FT /rpt_family="(TTTG)n" FT repeat_region 6253820..6253933 FT /rpt_family="L1" FT repeat_region 6254940..6255244 FT /rpt_family="Alu" FT repeat_region 6255280..6256087 FT /rpt_family="L1" FT repeat_region 6256088..6256378 FT /rpt_family="Alu" FT repeat_region 6256379..6256395 FT /rpt_family="L1" FT repeat_region 6256396..6256422 FT /rpt_family="(CA)n" FT repeat_region 6256423..6256547 FT /rpt_family="L1" FT repeat_region 6256548..6256844 FT /rpt_family="Alu" FT repeat_region 6256845..6257396 FT /rpt_family="L1" FT repeat_region 6257397..6257531 FT /rpt_family="MaLR" FT repeat_region 6257532..6257823 FT /rpt_family="Alu" FT repeat_region 6257824..6258199 FT /rpt_family="MaLR" FT repeat_region 6258200..6258356 FT /rpt_family="MaLR" FT repeat_region 6258357..6258658 FT /rpt_family="Alu" FT repeat_region 6258659..6259391 FT /rpt_family="MaLR" FT repeat_region 6259394..6259634 FT /rpt_family="L1" FT repeat_region 6259641..6259827 FT /rpt_family="Alu" FT repeat_region 6259828..6260187 FT /rpt_family="L1" FT repeat_region 6260200..6260344 FT /rpt_family="L1" FT repeat_region 6260345..6260637 FT /rpt_family="Alu" FT repeat_region 6260638..6261181 FT /rpt_family="L1" FT repeat_region 6261186..6261332 FT /rpt_family="L1" FT repeat_region 6261340..6261610 FT /rpt_family="Alu" FT repeat_region 6262116..6262412 FT /rpt_family="Alu" FT repeat_region 6262713..6263484 FT /rpt_family="SVA" FT repeat_region 6263731..6263817 FT /rpt_family="Alu" FT repeat_region 6263965..6264163 FT /rpt_family="L1" FT repeat_region 6264160..6264752 FT /rpt_family="L1" FT repeat_region 6264986..6265286 FT /rpt_family="Alu" FT repeat_region 6265312..6265616 FT /rpt_family="Alu" FT repeat_region 6265752..6265777 FT /rpt_family="AT_rich" FT repeat_region 6266430..6266727 FT /rpt_family="Alu" FT repeat_region 6266963..6267026 FT /rpt_family="L1" FT repeat_region 6267019..6267221 FT /rpt_family="L1" FT repeat_region 6269084..6269157 FT /rpt_family="MIR" FT repeat_region 6269159..6269467 FT /rpt_family="Alu" FT repeat_region 6269485..6269798 FT /rpt_family="Alu" FT repeat_region 6270175..6270554 FT /rpt_family="L1" FT repeat_region 6272385..6272507 FT /rpt_family="ERVL" FT repeat_region 6273041..6273306 FT /rpt_family="Alu" FT repeat_region 6273386..6273738 FT /rpt_family="MaLR" FT repeat_region 6274825..6275122 FT /rpt_family="Alu" FT repeat_region 6275490..6275509 FT /rpt_family="(CAAAA)n" FT repeat_region 6275840..6276140 FT /rpt_family="Alu" FT repeat_region 6276181..6276493 FT /rpt_family="Alu" FT repeat_region 6277059..6277360 FT /rpt_family="Alu" FT repeat_region 6278207..6278505 FT /rpt_family="L1" FT repeat_region 6278536..6278562 FT /rpt_family="AT_rich" FT repeat_region 6278563..6278833 FT /rpt_family="Alu" FT repeat_region 6278872..6278926 FT /rpt_family="GA-rich" FT repeat_region 6279013..6279105 FT /rpt_family="L2" FT repeat_region 6279146..6279654 FT /rpt_family="L1" FT repeat_region 6279655..6279947 FT /rpt_family="Alu" FT repeat_region 6279948..6280374 FT /rpt_family="L1" FT repeat_region 6280375..6280410 FT /rpt_family="CR1" FT repeat_region 6280465..6280766 FT /rpt_family="Alu" FT repeat_region 6280964..6281353 FT /rpt_family="L1" FT repeat_region 6281705..6282005 FT /rpt_family="Alu" FT repeat_region 6282007..6282289 FT /rpt_family="Alu" FT repeat_region 6282541..6282650 FT /rpt_family="MIR" FT repeat_region 6283133..6283910 FT /rpt_family="AcHobo" FT repeat_region 6284101..6284305 FT /rpt_family="Alu" FT repeat_region 6284378..6284420 FT /rpt_family="AcHobo" FT repeat_region 6284421..6284749 FT /rpt_family="Alu" FT repeat_region 6284750..6285033 FT /rpt_family="AcHobo" FT repeat_region 6285254..6285529 FT /rpt_family="Alu" FT repeat_region 6285705..6285998 FT /rpt_family="Alu" FT repeat_region 6286418..6286621 FT /rpt_family="L1" FT repeat_region 6286775..6286989 FT /rpt_family="L1" FT repeat_region 6287280..6287596 FT /rpt_family="Alu" FT repeat_region 6288562..6288730 FT /rpt_family="L1" FT repeat_region 6289343..6289664 FT /rpt_family="L1" FT repeat_region 6290178..6290468 FT /rpt_family="L1" FT repeat_region 6290628..6290932 FT /rpt_family="Alu" FT repeat_region 6292848..6293139 FT /rpt_family="Alu" FT repeat_region 6293167..6293474 FT /rpt_family="Alu" FT repeat_region 6293478..6293653 FT /rpt_family="Alu" FT repeat_region 6293667..6293842 FT /rpt_family="Alu" FT repeat_region 6293916..6294092 FT /rpt_family="L1" FT repeat_region 6294093..6294380 FT /rpt_family="Alu" FT repeat_region 6294381..6294557 FT /rpt_family="L1" FT repeat_region 6294775..6294830 FT /rpt_family="MIR" FT repeat_region 6295390..6295693 FT /rpt_family="Alu" FT repeat_region 6297393..6297651 FT /rpt_family="MaLR" FT repeat_region 6297652..6297963 FT /rpt_family="Alu" FT repeat_region 6297964..6298254 FT /rpt_family="MaLR" FT repeat_region 6299359..6299464 FT /rpt_family="(TA)n" FT repeat_region 6299465..6299759 FT /rpt_family="Alu" FT repeat_region 6300047..6300184 FT /rpt_family="L2" FT repeat_region 6300156..6300598 FT /rpt_family="L2" FT repeat_region 6300602..6300781 FT /rpt_family="L1" FT repeat_region 6301064..6301346 FT /rpt_family="Alu" FT repeat_region 6301425..6302217 FT /rpt_family="L1" FT repeat_region 6302219..6302336 FT /rpt_family="Alu" FT repeat_region 6302414..6302554 FT /rpt_family="Alu" FT repeat_region 6302757..6302826 FT /rpt_family="L1" FT repeat_region 6302838..6303060 FT /rpt_family="L1" FT repeat_region 6303146..6303448 FT /rpt_family="Alu" FT repeat_region 6303596..6303898 FT /rpt_family="Alu" FT repeat_region 6303961..6304258 FT /rpt_family="Alu" FT repeat_region 6304377..6304821 FT /rpt_family="L2" FT repeat_region 6304874..6304955 FT /rpt_family="MER1_type" FT repeat_region 6304962..6305278 FT /rpt_family="Alu" FT repeat_region 6305369..6305461 FT /rpt_family="L2" FT repeat_region 6305469..6305545 FT /rpt_family="L2" FT repeat_region 6305567..6305679 FT /rpt_family="L1" FT repeat_region 6305703..6305849 FT /rpt_family="L2" FT repeat_region 6305859..6305992 FT /rpt_family="MIR" FT repeat_region 6306068..6306523 FT /rpt_family="L2" FT repeat_region 6306531..6306934 FT /rpt_family="MaLR" FT repeat_region 6307165..6307452 FT /rpt_family="Alu" FT repeat_region 6307620..6307800 FT /rpt_family="L1" FT repeat_region 6307801..6308100 FT /rpt_family="Alu" FT repeat_region 6308101..6308374 FT /rpt_family="L1" FT repeat_region 6308381..6308834 FT /rpt_family="ERVL" FT repeat_region 6308963..6309041 FT /rpt_family="L1" FT repeat_region 6309981..6310049 FT /rpt_family="L2" FT repeat_region 6310224..6310432 FT /rpt_family="L1" FT misc_feature 6311323..6312526 FT /note="CpG_island (%GC=73.1, o/e=0.96, #CpGs=139)" FT repeat_region 6311978..6312126 FT /rpt_family="C-rich" FT gene complement(6312105..6312160) FT /gene="PSCD3" FT mRNA complement(6312105..6312160) FT /gene="PSCD3" FT CDS complement(<6312105..6312138) FT /codon_start=1 FT /gene="PSCD3" FT /product="unknown" FT /note="Homo sapiens pleckstrin homology, Sec7 and FT coiled-coil domains 3 (PSCD3), mRNA.; H_NH0425P05.2 This FT gene was based on gi(8670548) Continues as H_DJ0810E06.2.1" FT /protein_id="AAS07510.1" FT /translation="MDEDGGGEGGG" FT repeat_region 6312243..6312289 FT /rpt_family="GC_rich" FT repeat_region 6312620..6312890 FT /rpt_family="Alu" FT repeat_region 6313620..6313877 FT /rpt_family="Alu" FT repeat_region 6313918..6314003 FT /rpt_family="MIR" FT repeat_region 6314714..6314807 FT /rpt_family="L2" FT repeat_region 6314823..6315133 FT /rpt_family="Alu" FT repeat_region 6315289..6315432 FT /rpt_family="Alu" FT repeat_region 6315433..6315732 FT /rpt_family="Alu" FT repeat_region 6315821..6315960 FT /rpt_family="Alu" FT repeat_region 6315961..6316234 FT /rpt_family="Alu" FT repeat_region 6316235..6316401 FT /rpt_family="Alu" FT repeat_region 6317465..6317777 FT /rpt_family="Alu" FT repeat_region 6317823..6317847 FT /rpt_family="AT_rich" FT repeat_region 6318021..6318310 FT /rpt_family="Alu" FT repeat_region 6318508..6318725 FT /rpt_family="MIR" FT repeat_region 6319062..6319183 FT /rpt_family="Alu" FT repeat_region 6319248..6319548 FT /rpt_family="Alu" FT repeat_region 6319674..6319889 FT /rpt_family="Alu" FT repeat_region 6319928..6320232 FT /rpt_family="Alu" FT repeat_region 6320233..6320426 FT /rpt_family="L1" FT repeat_region 6320427..6320731 FT /rpt_family="Alu" FT repeat_region 6320732..6321009 FT /rpt_family="L1" FT repeat_region 6321010..6321318 FT /rpt_family="Alu" FT repeat_region 6321319..6321489 FT /rpt_family="L1" FT repeat_region 6321490..6321768 FT /rpt_family="Alu" FT repeat_region 6321769..6321974 FT /rpt_family="L1" FT repeat_region 6321975..6322276 FT /rpt_family="Alu" FT repeat_region 6322277..6322377 FT /rpt_family="L1" FT repeat_region 6322378..6322692 FT /rpt_family="Alu" FT repeat_region 6322693..6322720 FT /rpt_family="L1" FT repeat_region 6322721..6323021 FT /rpt_family="Alu" FT repeat_region 6323022..6323160 FT /rpt_family="L1" FT repeat_region 6323255..6323553 FT /rpt_family="Alu" FT repeat_region 6323563..6323864 FT /rpt_family="Alu" FT repeat_region 6323866..6324281 FT /rpt_family="L1" FT repeat_region 6324282..6324442 FT /rpt_family="Alu" FT repeat_region 6324443..6324463 FT /rpt_family="(TTG)n" FT repeat_region 6324464..6324568 FT /rpt_family="Alu" FT repeat_region 6324569..6324729 FT /rpt_family="L1" FT repeat_region 6325067..6325366 FT /rpt_family="Alu" FT repeat_region 6325368..6325491 FT /rpt_family="MaLR" FT repeat_region 6325503..6325681 FT /rpt_family="Alu" FT repeat_region 6325683..6325993 FT /rpt_family="Alu" FT repeat_region 6325996..6326059 FT /rpt_family="MaLR" FT repeat_region 6326540..6326575 FT /rpt_family="(T)n" FT repeat_region 6326579..6327592 FT /rpt_family="L1" FT repeat_region 6327622..6327897 FT /rpt_family="Alu" FT repeat_region 6327910..6328134 FT /rpt_family="(TTCC)n" FT repeat_region 6328135..6328232 FT /rpt_family="L1" FT repeat_region 6328246..6328418 FT /rpt_family="Alu" FT repeat_region 6328419..6328711 FT /rpt_family="Alu" FT repeat_region 6328712..6328820 FT /rpt_family="Alu" FT repeat_region 6328823..6328954 FT /rpt_family="Alu" FT repeat_region 6329099..6329395 FT /rpt_family="Alu" FT repeat_region 6329443..6329472 FT /rpt_family="(CACCAT)n" FT repeat_region 6329503..6329803 FT /rpt_family="Alu" FT repeat_region 6329805..6329863 FT /rpt_family="L1" FT repeat_region 6330467..6330643 FT /rpt_family="L1" FT repeat_region 6330644..6330936 FT /rpt_family="Alu" FT repeat_region 6330937..6330987 FT /rpt_family="L1" FT repeat_region 6330962..6330987 FT /rpt_family="L1" FT repeat_region 6330988..6331292 FT /rpt_family="Alu" FT repeat_region 6331293..6331309 FT /rpt_family="L1" FT repeat_region 6331310..6331427 FT /rpt_family="Alu" FT repeat_region 6331428..6331632 FT /rpt_family="L1" FT repeat_region 6331633..6331757 FT /rpt_family="Alu" FT repeat_region 6331770..6332051 FT /rpt_family="Alu" FT repeat_region 6332076..6332174 FT /rpt_family="L1" FT repeat_region 6332185..6332211 FT /rpt_family="(CA)n" FT repeat_region 6332227..6332538 FT /rpt_family="Alu" FT repeat_region 6332542..6332843 FT /rpt_family="Alu" FT repeat_region 6332895..6333173 FT /rpt_family="L1" FT repeat_region 6333182..6333218 FT /rpt_family="MaLR" FT repeat_region 6333219..6333510 FT /rpt_family="Alu" FT repeat_region 6333511..6333787 FT /rpt_family="MaLR" FT repeat_region 6333788..6334090 FT /rpt_family="Alu" FT repeat_region 6334091..6334164 FT /rpt_family="MaLR" FT repeat_region 6334165..6334208 FT /rpt_family="L1" FT repeat_region 6334216..6334495 FT /rpt_family="Alu" FT repeat_region 6335136..6335433 FT /rpt_family="Alu" FT repeat_region 6335523..6335854 FT /rpt_family="Alu" FT repeat_region 6336054..6336199 FT /rpt_family="Alu" FT repeat_region 6336200..6336503 FT /rpt_family="Alu" FT repeat_region 6336504..6336681 FT /rpt_family="Alu" FT repeat_region 6336682..6336975 FT /rpt_family="Alu" FT repeat_region 6337399..6337694 FT /rpt_family="Alu" FT repeat_region 6337695..6337948 FT /rpt_family="Alu" FT repeat_region 6337950..6338287 FT /rpt_family="Alu" FT repeat_region 6338294..6338323 FT /rpt_family="(TTTTA)n" FT repeat_region 6338326..6338590 FT /rpt_family="Alu" FT repeat_region 6338620..6338649 FT /rpt_family="(TTTTA)n" FT repeat_region 6338650..6338708 FT /rpt_family="L1" FT repeat_region 6338712..6338732 FT /rpt_family="AT_rich" FT repeat_region 6338733..6339029 FT /rpt_family="Alu" FT repeat_region 6339040..6339184 FT /rpt_family="Alu" FT repeat_region 6339209..6339326 FT /rpt_family="Alu" FT repeat_region 6339337..6339484 FT /rpt_family="Alu" FT repeat_region 6339515..6339942 FT /rpt_family="L1" FT repeat_region 6339943..6340226 FT /rpt_family="Alu" FT repeat_region 6340250..6340569 FT /rpt_family="Alu" FT repeat_region 6340571..6340739 FT /rpt_family="Alu" FT repeat_region 6340740..6341023 FT /rpt_family="Alu" FT repeat_region 6341026..6341218 FT /rpt_family="Alu" FT repeat_region 6341219..6341305 FT /rpt_family="Alu" FT repeat_region 6341347..6341651 FT /rpt_family="Alu" FT repeat_region 6342017..6342237 FT /rpt_family="Alu" FT repeat_region 6342817..6342839 FT /rpt_family="AT_rich" FT repeat_region 6342910..6343044 FT /rpt_family="Alu" FT repeat_region 6343045..6343352 FT /rpt_family="Alu" FT repeat_region 6343353..6343527 FT /rpt_family="Alu" FT repeat_region 6343785..6343795 FT /rpt_family="Alu" FT repeat_region 6343796..6344107 FT /rpt_family="Alu" FT repeat_region 6344108..6344280 FT /rpt_family="Alu" FT repeat_region 6344281..6344579 FT /rpt_family="Alu" FT repeat_region 6344580..6344874 FT /rpt_family="Alu" FT repeat_region 6344875..6345009 FT /rpt_family="Alu" FT repeat_region 6345303..6345478 FT /rpt_family="Alu" FT repeat_region 6345479..6345786 FT /rpt_family="Alu" FT repeat_region 6345787..6345869 FT /rpt_family="Alu" FT repeat_region 6345870..6346084 FT /rpt_family="MaLR" FT repeat_region 6346091..6346541 FT /rpt_family="L1" FT repeat_region 6346597..6346619 FT /rpt_family="AT_rich" FT repeat_region 6346718..6347013 FT /rpt_family="Alu" FT repeat_region 6347301..6347436 FT /rpt_family="Alu" FT repeat_region 6347443..6347686 FT /rpt_family="L2" FT repeat_region 6347886..6348019 FT /rpt_family="Alu" FT repeat_region 6348118..6348245 FT /rpt_family="Alu" FT repeat_region 6348296..6348360 FT /rpt_family="ERV1" FT repeat_region 6348361..6348488 FT /rpt_family="L1" FT repeat_region 6348489..6348793 FT /rpt_family="Alu" FT repeat_region 6348794..6348994 FT /rpt_family="L1" FT repeat_region 6349127..6349414 FT /rpt_family="Alu" FT repeat_region 6349415..6349440 FT /rpt_family="(TTAA)n" FT repeat_region 6349465..6349765 FT /rpt_family="Alu" FT repeat_region 6349894..6349972 FT /rpt_family="MER1_type" FT repeat_region 6350349..6350549 FT /rpt_family="L1" FT repeat_region 6350551..6350863 FT /rpt_family="Alu" FT repeat_region 6350872..6351028 FT /rpt_family="Alu" FT repeat_region 6351032..6351357 FT /rpt_family="Alu" FT repeat_region 6351415..6351592 FT /rpt_family="L1" FT repeat_region 6351595..6351911 FT /rpt_family="Alu" FT repeat_region 6351917..6352074 FT /rpt_family="Alu" FT repeat_region 6352140..6352428 FT /rpt_family="Alu" FT repeat_region 6352544..6352841 FT /rpt_family="Alu" FT repeat_region 6352842..6353039 FT /rpt_family="Alu" FT repeat_region 6353116..6353148 FT /rpt_family="AT_rich" FT repeat_region 6353149..6353327 FT /rpt_family="Alu" FT repeat_region 6353330..6353435 FT /rpt_family="MIR" FT repeat_region 6353498..6353545 FT /rpt_family="L1" FT repeat_region 6353582..6353896 FT /rpt_family="Alu" FT repeat_region 6353897..6354172 FT /rpt_family="L1" FT repeat_region 6354265..6354435 FT /rpt_family="Alu" FT repeat_region 6354603..6354896 FT /rpt_family="Alu" FT repeat_region 6354902..6355205 FT /rpt_family="Alu" FT repeat_region 6355694..6355931 FT /rpt_family="Alu" FT repeat_region 6355942..6355970 FT /rpt_family="AT_rich" FT repeat_region 6356173..6356481 FT /rpt_family="Alu" FT repeat_region 6356573..6356736 FT /rpt_family="Alu" FT repeat_region 6356739..6356916 FT /rpt_family="AT_rich" FT repeat_region 6356917..6357212 FT /rpt_family="Alu" FT repeat_region 6357213..6357253 FT /rpt_family="Alu" FT repeat_region 6357914..6358084 FT /rpt_family="Alu" FT repeat_region 6358094..6358404 FT /rpt_family="Alu" FT repeat_region 6358497..6358532 FT /rpt_family="(TTTA)n" FT repeat_region 6358535..6358689 FT /rpt_family="Alu" FT repeat_region 6359050..6359186 FT /rpt_family="MER1_type" FT repeat_region 6359207..6359529 FT /rpt_family="Alu" FT repeat_region 6359534..6359849 FT /rpt_family="Alu" FT repeat_region 6359882..6360189 FT /rpt_family="Alu" FT repeat_region 6360197..6360499 FT /rpt_family="Alu" FT repeat_region 6360851..6360987 FT /rpt_family="Alu" FT repeat_region 6360988..6361295 FT /rpt_family="Alu" FT repeat_region 6361435..6361594 FT /rpt_family="Alu" FT repeat_region 6361859..6361994 FT /rpt_family="Alu" FT repeat_region 6362159..6362443 FT /rpt_family="Alu" FT repeat_region 6362478..6362601 FT /rpt_family="Alu" FT repeat_region 6363133..6363430 FT /rpt_family="Alu" FT repeat_region 6363453..6363573 FT /rpt_family="Alu" FT repeat_region 6363941..6364233 FT /rpt_family="Alu" FT repeat_region 6364237..6364540 FT /rpt_family="Alu" FT repeat_region 6364625..6364895 FT /rpt_family="Alu" FT repeat_region 6364987..6365090 FT /rpt_family="Alu" FT repeat_region 6365107..6365417 FT /rpt_family="Alu" FT repeat_region 6365680..6365966 FT /rpt_family="Alu" FT repeat_region 6366004..6366313 FT /rpt_family="Alu" FT repeat_region 6366564..6366879 FT /rpt_family="Alu" FT repeat_region 6366900..6367201 FT /rpt_family="Alu" FT repeat_region 6367245..6367373 FT /rpt_family="Alu" FT repeat_region 6367374..6367414 FT /rpt_family="AT_rich" FT repeat_region 6367565..6367862 FT /rpt_family="Alu" FT repeat_region 6367863..6368177 FT /rpt_family="Alu" FT repeat_region 6368505..6368516 FT /rpt_family="Alu" FT repeat_region 6368517..6368824 FT /rpt_family="Alu" FT repeat_region 6368825..6368985 FT /rpt_family="Alu" FT gene complement(6369060..6388590) FT /gene="MGC12966" FT mRNA complement(join(6369060..6370866,6388204..6388590)) FT /gene="MGC12966" FT CDS complement(join(6370846..6370866,6388204..6388389)) FT /codon_start=1 FT /gene="MGC12966" FT /product="unknown" FT /note="Homo sapiens, clone MGC:12966 IMAGE:3139887, mRNA, FT complete cds.; H_NH0425P05.1 This gene was based on FT gi(13543934 14249303)" FT /protein_id="AAS07509.1" FT /translation="MAAALSGLAVRLSRSAAARSYGVFCKGLTRTLLIFFDLAWRLRIN FT FPYLYIVASMMLNVRLQVHIEIH" FT repeat_region 6370981..6371093 FT /rpt_family="Alu" FT repeat_region 6371103..6371147 FT /rpt_family="Alu" FT repeat_region 6371153..6371310 FT /rpt_family="Alu" FT repeat_region 6371370..6371588 FT /rpt_family="Alu" FT repeat_region 6371591..6371761 FT /rpt_family="Alu" FT repeat_region 6371815..6372147 FT /rpt_family="ERV1" FT repeat_region 6372165..6372348 FT /rpt_family="Alu" FT repeat_region 6372510..6372818 FT /rpt_family="Alu" FT repeat_region 6372930..6373064 FT /rpt_family="L2" FT repeat_region 6373143..6373313 FT /rpt_family="Alu" FT repeat_region 6373314..6373401 FT /rpt_family="ERV1" FT repeat_region 6373404..6373471 FT /rpt_family="Alu" FT repeat_region 6373472..6373776 FT /rpt_family="Alu" FT repeat_region 6373777..6373857 FT /rpt_family="Alu" FT repeat_region 6373885..6374098 FT /rpt_family="Alu" FT repeat_region 6374118..6374396 FT /rpt_family="Alu" FT repeat_region 6374412..6374697 FT /rpt_family="Alu" FT repeat_region 6374703..6374859 FT /rpt_family="Alu" FT repeat_region 6374860..6375158 FT /rpt_family="Alu" FT repeat_region 6375175..6375343 FT /rpt_family="MER1_type" FT repeat_region 6375384..6375521 FT /rpt_family="Alu" FT repeat_region 6375522..6375825 FT /rpt_family="Alu" FT repeat_region 6375826..6375997 FT /rpt_family="Alu" FT repeat_region 6376030..6376329 FT /rpt_family="Alu" FT repeat_region 6376330..6376584 FT /rpt_family="Alu" FT repeat_region 6376696..6377052 FT /rpt_family="Alu" FT repeat_region 6377426..6377734 FT /rpt_family="Alu" FT repeat_region 6378817..6379036 FT /rpt_family="Alu" FT repeat_region 6379037..6379078 FT /rpt_family="Alu" FT repeat_region 6379114..6379401 FT /rpt_family="Alu" FT repeat_region 6379540..6379815 FT /rpt_family="Alu" FT repeat_region 6380256..6380548 FT /rpt_family="Alu" FT repeat_region 6380562..6380785 FT /rpt_family="Alu" FT repeat_region 6380794..6381091 FT /rpt_family="Alu" FT repeat_region 6381117..6381335 FT /rpt_family="Alu" FT repeat_region 6381348..6381639 FT /rpt_family="Alu" FT repeat_region 6381691..6381808 FT /rpt_family="L2" FT repeat_region 6381811..6381877 FT /rpt_family="CT-rich" FT repeat_region 6381894..6382179 FT /rpt_family="Alu" FT repeat_region 6382204..6382347 FT /rpt_family="L1" FT repeat_region 6382386..6382697 FT /rpt_family="Alu" FT repeat_region 6382726..6383024 FT /rpt_family="Alu" FT repeat_region 6383029..6383076 FT /rpt_family="(TA)n" FT repeat_region 6383531..6383753 FT /rpt_family="Alu" FT repeat_region 6384064..6384349 FT /rpt_family="Alu" FT repeat_region 6384357..6384674 FT /rpt_family="Alu" FT repeat_region 6384742..6385045 FT /rpt_family="Alu" FT repeat_region 6385399..6385699 FT /rpt_family="Alu" FT repeat_region 6386016..6386315 FT /rpt_family="Alu" FT repeat_region 6386677..6386823 FT /rpt_family="Alu" FT repeat_region 6386864..6387160 FT /rpt_family="Alu" FT repeat_region 6387405..6387514 FT /rpt_family="Alu" FT repeat_region 6387515..6387836 FT /rpt_family="Alu" FT misc_feature 6387594..6389099 FT /note="CpG_island (%GC=62.9, o/e=0.79, #CpGs=132)" FT repeat_region 6387837..6387862 FT /rpt_family="Alu" FT repeat_region 6387947..6388049 FT /rpt_family="MIR" FT repeat_region 6388144..6388186 FT /rpt_family="GC_rich" FT repeat_region 6388781..6388856 FT /rpt_family="L1" FT repeat_region 6388863..6389166 FT /rpt_family="Alu" FT repeat_region 6389184..6389459 FT /rpt_family="Alu" FT repeat_region 6389488..6389790 FT /rpt_family="Alu" FT repeat_region 6390245..6390293 FT /rpt_family="(CA)n" FT repeat_region 6390359..6390518 FT /rpt_family="Alu" FT repeat_region 6390519..6390816 FT /rpt_family="Alu" FT repeat_region 6390817..6390833 FT /rpt_family="Alu" FT repeat_region 6390834..6390908 FT /rpt_family="(TTA)n" FT repeat_region 6390909..6390983 FT /rpt_family="Alu" FT repeat_region 6391300..6391352 FT /rpt_family="Alu" FT repeat_region 6391383..6391514 FT /rpt_family="Alu" FT repeat_region 6391514..6391667 FT /rpt_family="Alu" FT repeat_region 6391756..6392062 FT /rpt_family="Alu" FT repeat_region 6392132..6392285 FT /rpt_family="MIR" FT repeat_region 6392286..6392635 FT /rpt_family="Alu" FT repeat_region 6392648..6392957 FT /rpt_family="Alu" FT repeat_region 6393020..6393110 FT /rpt_family="Alu" FT repeat_region 6393111..6393184 FT /rpt_family="GA-rich" FT repeat_region 6393185..6393497 FT /rpt_family="Alu" FT repeat_region 6393506..6393658 FT /rpt_family="L1" FT repeat_region 6393668..6393964 FT /rpt_family="Alu" FT repeat_region 6393973..6394166 FT /rpt_family="L1" FT repeat_region 6394168..6394460 FT /rpt_family="Alu" FT repeat_region 6394463..6394769 FT /rpt_family="Alu" FT repeat_region 6394782..6394970 FT /rpt_family="Alu" FT repeat_region 6394971..6395277 FT /rpt_family="Alu" FT repeat_region 6395278..6395410 FT /rpt_family="Alu" FT repeat_region 6395411..6395572 FT /rpt_family="MaLR" FT repeat_region 6395598..6395756 FT /rpt_family="L1" FT repeat_region 6395757..6396072 FT /rpt_family="Alu" FT repeat_region 6396217..6396349 FT /rpt_family="Alu" FT repeat_region 6396357..6396656 FT /rpt_family="Alu" FT repeat_region 6396702..6396721 FT /rpt_family="L1" FT repeat_region 6396722..6397042 FT /rpt_family="Alu" FT repeat_region 6397043..6397142 FT /rpt_family="L1" FT repeat_region 6397143..6397411 FT /rpt_family="Alu" FT repeat_region 6397412..6397593 FT /rpt_family="L1" FT repeat_region 6397601..6397920 FT /rpt_family="Alu" FT repeat_region 6397954..6398088 FT /rpt_family="Alu" FT repeat_region 6398170..6398482 FT /rpt_family="Alu" FT repeat_region 6398745..6398950 FT /rpt_family="MaLR" FT repeat_region 6398951..6399256 FT /rpt_family="Alu" FT repeat_region 6399257..6399502 FT /rpt_family="MaLR" FT repeat_region 6399724..6400054 FT /rpt_family="Alu" FT repeat_region 6400321..6400623 FT /rpt_family="Alu" FT repeat_region 6400996..6401309 FT /rpt_family="Alu" FT repeat_region 6401354..6401476 FT /rpt_family="Alu" FT repeat_region 6401477..6401770 FT /rpt_family="Alu" FT repeat_region 6401773..6402096 FT /rpt_family="Alu" FT repeat_region 6402097..6402283 FT /rpt_family="Alu" FT repeat_region 6402442..6402728 FT /rpt_family="Alu" FT repeat_region 6402729..6402803 FT /rpt_family="Alu" FT repeat_region 6402805..6402958 FT /rpt_family="Alu" FT repeat_region 6403042..6403103 FT /rpt_family="AT_rich" FT repeat_region 6403106..6403394 FT /rpt_family="Alu" FT repeat_region 6403453..6403560 FT /rpt_family="MIR" FT repeat_region 6403765..6404060 FT /rpt_family="Alu" FT repeat_region 6404085..6404253 FT /rpt_family="Alu" FT repeat_region 6404276..6404316 FT /rpt_family="Alu" FT repeat_region 6404317..6404468 FT /rpt_family="Alu" FT repeat_region 6404496..6404791 FT /rpt_family="Alu" FT repeat_region 6404793..6405078 FT /rpt_family="Alu" FT repeat_region 6405405..6405611 FT /rpt_family="L1" FT repeat_region 6405615..6405914 FT /rpt_family="Alu" FT repeat_region 6405915..6406212 FT /rpt_family="Alu" FT repeat_region 6406213..6406382 FT /rpt_family="Alu" FT repeat_region 6406392..6406553 FT /rpt_family="Alu" FT repeat_region 6406574..6406880 FT /rpt_family="Alu" FT repeat_region 6406913..6407226 FT /rpt_family="Alu" FT repeat_region 6407420..6407944 FT /rpt_family="L1" FT repeat_region 6407960..6408127 FT /rpt_family="Alu" FT repeat_region 6408128..6408420 FT /rpt_family="Alu" FT repeat_region 6408431..6408575 FT /rpt_family="L1" FT repeat_region 6408606..6408882 FT /rpt_family="Alu" FT repeat_region 6408937..6408976 FT /rpt_family="(TA)n" FT repeat_region 6408977..6409268 FT /rpt_family="Alu" FT repeat_region 6409269..6409307 FT /rpt_family="(TA)n" FT repeat_region 6409341..6409466 FT /rpt_family="Alu" FT repeat_region 6409632..6409873 FT /rpt_family="L1" FT repeat_region 6409874..6410170 FT /rpt_family="Alu" FT repeat_region 6410171..6410241 FT /rpt_family="L1" FT repeat_region 6410249..6410380 FT /rpt_family="L1" FT repeat_region 6410383..6410488 FT /rpt_family="L2" FT repeat_region 6410590..6410852 FT /rpt_family="Alu" FT repeat_region 6410907..6411193 FT /rpt_family="Alu" FT repeat_region 6411215..6411486 FT /rpt_family="Alu" FT repeat_region 6411643..6411921 FT /rpt_family="Alu" FT repeat_region 6411925..6411994 FT /rpt_family="Alu" FT repeat_region 6412019..6412153 FT /rpt_family="Alu" FT repeat_region 6412424..6412718 FT /rpt_family="Alu" FT repeat_region 6412946..6413248 FT /rpt_family="Alu" FT repeat_region 6413263..6413560 FT /rpt_family="Alu" FT repeat_region 6413579..6413880 FT /rpt_family="Alu" FT misc_feature 6413811..6414720 FT /note="CpG_island (%GC=75.4, o/e=0.90, #CpGs=123)" FT repeat_region 6414050..6414123 FT /rpt_family="GC_rich" FT gene 6414229..6442152 FT /gene="RAC1" FT mRNA join(6414229..6414401,6426843..6426914,6431555..6431672, FT 6439757..6439819,6441499..6441658,6441947..6442152) FT /gene="RAC1" FT repeat_region 6414246..6414315 FT /rpt_family="GC_rich" FT mRNA join(6414367..6414401,6426843..6426914,6431555..6431672, FT 6438293..6438349,6439757..6439819,6441499..6441658, FT 6441947..6442077) FT /gene="RAC1" FT mRNA join(6414367..6414401,6426843..6426914,6431555..6431672, FT 6439757..6439819,6441499..6441658,6441947..6442077) FT /gene="RAC1" FT CDS join(6414367..6414401,6426843..6426914,6431555..6431672, FT 6438293..6438349,6439757..6439819,6441499..6441658, FT 6441947..6442077) FT /codon_start=1 FT /gene="RAC1" FT /product="unknown" FT /note="Homo sapiens ras-related C3 botulinum toxin FT substrate 1 (rho family, small GTP binding protein Rac1) FT (RAC1), transcript variant Rac1b, mRNA.; H_NH0425P05.3.1 FT This gene was based on gi(9845508)" FT /protein_id="AAS07511.1" FT /translation="MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVM FT VDGKPVNLGLWDTAGQEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLV FT SPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLA FT MAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL" FT CDS join(6414367..6414401,6426843..6426914,6431555..6431672, FT 6439757..6439819,6441499..6441658,6441947..6442077) FT /codon_start=1 FT /gene="RAC1" FT /product="unknown" FT /note="Homo sapiens ras-related C3 botulinum toxin FT substrate 1 (rho family, small GTP binding protein Rac1) FT (RAC1), transcript variant Rac1, mRNA.; H_NH0425P05.3.2 FT This gene was based on gi(9845510 13279010)" FT /protein_id="AAS07512.1" FT /translation="MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVM FT VDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHH FT CPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQR FT GLKTVFDEAIRAVLCPPPVKKRKRKCLLL" FT repeat_region 6414531..6414561 FT /rpt_family="GC_rich" FT repeat_region 6414894..6414935 FT /rpt_family="Alu" FT repeat_region 6414936..6415147 FT /rpt_family="Alu" FT repeat_region 6415282..6415313 FT /rpt_family="(T)n" FT repeat_region 6415808..6416114 FT /rpt_family="Alu" FT repeat_region 6416122..6416409 FT /rpt_family="Alu" FT repeat_region 6416411..6416431 FT /rpt_family="(T)n" FT repeat_region 6416944..6417244 FT /rpt_family="Alu" FT repeat_region 6417264..6417528 FT /rpt_family="Alu" FT repeat_region 6417680..6417861 FT /rpt_family="ERVL" FT repeat_region 6417896..6418195 FT /rpt_family="Alu" FT repeat_region 6418439..6418736 FT /rpt_family="Alu" FT repeat_region 6418797..6418899 FT /rpt_family="Alu" FT repeat_region 6418900..6419204 FT /rpt_family="Alu" FT repeat_region 6419205..6419340 FT /rpt_family="Alu" FT repeat_region 6419364..6419543 FT /rpt_family="Alu" FT repeat_region 6420304..6420380 FT /rpt_family="L1" FT repeat_region 6420483..6420798 FT /rpt_family="Alu" FT repeat_region 6421022..6421325 FT /rpt_family="Alu" FT repeat_region 6421626..6421920 FT /rpt_family="Alu" FT repeat_region 6422213..6422507 FT /rpt_family="Alu" FT repeat_region 6423421..6423725 FT /rpt_family="Alu" FT repeat_region 6423751..6424006 FT /rpt_family="L2" FT repeat_region 6424112..6424418 FT /rpt_family="Alu" FT repeat_region 6424419..6424736 FT /rpt_family="Alu" FT repeat_region 6424906..6425129 FT /rpt_family="MIR" FT repeat_region 6426131..6426449 FT /rpt_family="Alu" FT repeat_region 6427096..6427377 FT /rpt_family="Alu" FT repeat_region 6427949..6427973 FT /rpt_family="(TTG)n" FT repeat_region 6427978..6428270 FT /rpt_family="Alu" FT repeat_region 6428550..6428857 FT /rpt_family="Alu" FT repeat_region 6429014..6429039 FT /rpt_family="AT_rich" FT repeat_region 6429044..6429328 FT /rpt_family="Alu" FT repeat_region 6429335..6429456 FT /rpt_family="Alu" FT repeat_region 6429457..6429543 FT /rpt_family="L1" FT repeat_region 6429555..6429727 FT /rpt_family="(TCCC)n" FT repeat_region 6429728..6429821 FT /rpt_family="Alu" FT repeat_region 6429849..6429952 FT /rpt_family="L1" FT repeat_region 6429953..6430250 FT /rpt_family="Alu" FT repeat_region 6430251..6430487 FT /rpt_family="L1" FT repeat_region 6430519..6430828 FT /rpt_family="Alu" FT repeat_region 6430845..6430871 FT /rpt_family="(T)n" FT repeat_region 6432429..6432578 FT /rpt_family="MIR" FT repeat_region 6433878..6433945 FT /rpt_family="CR1" FT repeat_region 6434304..6434478 FT /rpt_family="Alu" FT repeat_region 6434479..6434761 FT /rpt_family="Alu" FT repeat_region 6434762..6434896 FT /rpt_family="Alu" FT repeat_region 6435130..6435394 FT /rpt_family="ERV1" FT repeat_region 6435399..6435429 FT /rpt_family="Alu" FT repeat_region 6436380..6436690 FT /rpt_family="Alu" FT repeat_region 6436691..6436900 FT /rpt_family="Alu" FT repeat_region 6436932..6437209 FT /rpt_family="Alu" FT repeat_region 6437337..6437624 FT /rpt_family="Alu" FT repeat_region 6439959..6440256 FT /rpt_family="Alu" FT repeat_region 6440266..6440287 FT /rpt_family="AT_rich" FT repeat_region 6440297..6440605 FT /rpt_family="Alu" FT repeat_region 6440606..6440886 FT /rpt_family="Alu" FT repeat_region 6441204..6441242 FT /rpt_family="CT-rich" FT misc_feature 6441810..6442042 FT /gene="RAC1" FT /note="CpG_island (%GC=62.7, o/e=0.77, #CpGs=17)" FT repeat_region 6442134..6442168 FT /rpt_family="(A)n" FT repeat_region 6443963..6444083 FT /rpt_family="Alu" FT repeat_region 6444164..6444463 FT /rpt_family="Alu" FT repeat_region 6444501..6444780 FT /rpt_family="Alu" FT repeat_region 6444782..6444831 FT /rpt_family="Alu" FT repeat_region 6445077..6445259 FT /rpt_family="L1" FT repeat_region 6445260..6445552 FT /rpt_family="Alu" FT repeat_region 6445553..6445642 FT /rpt_family="L1" FT repeat_region 6445646..6445758 FT /rpt_family="L1" FT repeat_region 6445759..6446040 FT /rpt_family="MER2_type" FT repeat_region 6446041..6446116 FT /rpt_family="L1" FT repeat_region 6446141..6446465 FT /rpt_family="Alu" FT repeat_region 6446493..6446778 FT /rpt_family="Alu" FT repeat_region 6446782..6446906 FT /rpt_family="Alu" FT repeat_region 6447012..6447076 FT /rpt_family="L1" FT repeat_region 6447485..6447657 FT /rpt_family="Alu" FT repeat_region 6447658..6447690 FT /rpt_family="(TTTA)n" FT repeat_region 6447691..6447972 FT /rpt_family="Alu" FT repeat_region 6447973..6448156 FT /rpt_family="Alu" FT repeat_region 6448515..6448649 FT /rpt_family="L1" FT repeat_region 6450384..6450503 FT /rpt_family="Alu" FT repeat_region 6450504..6450802 FT /rpt_family="Alu" FT repeat_region 6450803..6450939 FT /rpt_family="Alu" FT repeat_region 6450968..6451264 FT /rpt_family="Alu" FT repeat_region 6451560..6451844 FT /rpt_family="Alu" FT repeat_region 6452094..6452216 FT /rpt_family="Alu" FT repeat_region 6452917..6452979 FT /rpt_family="L1" FT repeat_region 6452980..6453281 FT /rpt_family="Alu" FT repeat_region 6453282..6453496 FT /rpt_family="L1" FT repeat_region 6453648..6453940 FT /rpt_family="Alu" FT repeat_region 6453943..6454231 FT /rpt_family="Alu" FT repeat_region 6454294..6454454 FT /rpt_family="L1" FT repeat_region 6454518..6454822 FT /rpt_family="Alu" FT repeat_region 6454846..6455006 FT /rpt_family="L1" FT repeat_region 6455032..6455075 FT /rpt_family="Alu" FT repeat_region 6455188..6455491 FT /rpt_family="Alu" FT repeat_region 6455523..6455783 FT /rpt_family="L1" FT repeat_region 6455893..6456194 FT /rpt_family="Alu" FT repeat_region 6456631..6456744 FT /rpt_family="L2" FT repeat_region 6456746..6457067 FT /rpt_family="Alu" FT repeat_region 6457239..6457361 FT /rpt_family="Alu" FT repeat_region 6457477..6457501 FT /rpt_family="AT_rich" FT repeat_region 6457502..6457525 FT /rpt_family="(TGAA)n" FT repeat_region 6457527..6457798 FT /rpt_family="Alu" FT repeat_region 6457863..6458039 FT /rpt_family="Alu" FT repeat_region 6458290..6458594 FT /rpt_family="Alu" FT repeat_region 6458713..6458732 FT /rpt_family="(T)n" FT repeat_region 6458742..6458926 FT /rpt_family="Alu" FT repeat_region 6459491..6459788 FT /rpt_family="Alu" FT repeat_region 6459793..6460091 FT /rpt_family="Alu" FT repeat_region 6460093..6460310 FT /rpt_family="L1" FT repeat_region 6460653..6460777 FT /rpt_family="Alu" FT repeat_region 6460780..6460940 FT /rpt_family="MIR" FT misc_feature 6460946..6461464 FT /note="CpG_island (%GC=75.0, o/e=0.63, #CpGs=67)" FT repeat_region 6460953..6461274 FT /rpt_family="(CGCGG)n" FT repeat_region 6462033..6462185 FT /rpt_family="L2" FT repeat_region 6462186..6462526 FT /rpt_family="L1" FT repeat_region 6462527..6462612 FT /rpt_family="L2" FT repeat_region 6462643..6462896 FT /rpt_family="Alu" FT repeat_region 6463067..6463221 FT /rpt_family="Alu" FT repeat_region 6463222..6463505 FT /rpt_family="Alu" FT repeat_region 6464707..6464810 FT /rpt_family="MER1_type" FT repeat_region 6464911..6465200 FT /rpt_family="Alu" FT repeat_region 6465917..6466200 FT /rpt_family="Alu" FT repeat_region 6466226..6466457 FT /rpt_family="L1" FT repeat_region 6466458..6466747 FT /rpt_family="Alu" FT repeat_region 6466748..6466779 FT /rpt_family="(TTAAA)n" FT repeat_region 6466780..6466790 FT /rpt_family="Alu" FT repeat_region 6466791..6466998 FT /rpt_family="L1" FT repeat_region 6466999..6467112 FT /rpt_family="Alu" FT repeat_region 6467113..6467143 FT /rpt_family="AT_rich" FT repeat_region 6467144..6467428 FT /rpt_family="Alu" FT repeat_region 6467430..6467695 FT /rpt_family="L1" FT repeat_region 6467696..6467974 FT /rpt_family="Alu" FT repeat_region 6467975..6468103 FT /rpt_family="L1" FT repeat_region 6468104..6468415 FT /rpt_family="Alu" FT repeat_region 6468416..6468434 FT /rpt_family="L1" FT repeat_region 6468435..6468734 FT /rpt_family="Alu" FT repeat_region 6468735..6469109 FT /rpt_family="L1" FT repeat_region 6469110..6469381 FT /rpt_family="Alu" FT repeat_region 6469394..6469686 FT /rpt_family="Alu" FT repeat_region 6469687..6469854 FT /rpt_family="Alu" FT repeat_region 6469872..6469913 FT /rpt_family="(TA)n" FT repeat_region 6469941..6470056 FT /rpt_family="L1" FT repeat_region 6470416..6470706 FT /rpt_family="Alu" FT repeat_region 6471121..6471420 FT /rpt_family="Alu" FT repeat_region 6471559..6471696 FT /rpt_family="L1" FT repeat_region 6471700..6471996 FT /rpt_family="Alu" FT repeat_region 6472007..6472308 FT /rpt_family="Alu" FT repeat_region 6472309..6472360 FT /rpt_family="G-rich" FT repeat_region 6473190..6473504 FT /rpt_family="Alu" FT repeat_region 6474837..6475133 FT /rpt_family="Alu" FT repeat_region 6475431..6475548 FT /rpt_family="MIR" FT repeat_region 6475710..6475784 FT /rpt_family="GA-rich" FT repeat_region 6476419..6476495 FT /rpt_family="AcHobo" FT repeat_region 6476496..6476831 FT /rpt_family="Alu" FT repeat_region 6476832..6476893 FT /rpt_family="AcHobo" FT repeat_region 6476931..6477067 FT /rpt_family="MIR" FT repeat_region 6477072..6477221 FT /rpt_family="Alu" FT repeat_region 6477268..6477568 FT /rpt_family="Alu" FT repeat_region 6477628..6477986 FT /rpt_family="L1" FT repeat_region 6477999..6478025 FT /rpt_family="AT_rich" FT repeat_region 6478382..6478473 FT /rpt_family="Alu" FT repeat_region 6478491..6478518 FT /rpt_family="(ATG)n" FT repeat_region 6478571..6478643 FT /rpt_family="Alu" FT repeat_region 6478644..6478914 FT /rpt_family="Alu" FT repeat_region 6479401..6479712 FT /rpt_family="Alu" FT repeat_region 6479742..6480032 FT /rpt_family="Alu" FT repeat_region 6480246..6480503 FT /rpt_family="Alu" FT repeat_region 6480631..6480690 FT /rpt_family="Alu" FT repeat_region 6480724..6481021 FT /rpt_family="Alu" FT repeat_region 6481045..6481347 FT /rpt_family="Alu" FT repeat_region 6481702..6481791 FT /rpt_family="MaLR" FT repeat_region 6482403..6482522 FT /rpt_family="Alu" FT repeat_region 6482523..6482849 FT /rpt_family="Alu" FT repeat_region 6482850..6483108 FT /rpt_family="Alu" FT repeat_region 6483160..6483487 FT /rpt_family="CR1" FT repeat_region 6483619..6483917 FT /rpt_family="Alu" FT repeat_region 6483925..6483950 FT /rpt_family="L1" FT repeat_region 6483951..6484256 FT /rpt_family="Alu" FT repeat_region 6484257..6484398 FT /rpt_family="L1" FT repeat_region 6484410..6484568 FT /rpt_family="Alu" FT repeat_region 6484571..6485139 FT /rpt_family="L1" FT repeat_region 6485141..6485207 FT /rpt_family="Alu" FT repeat_region 6485208..6485393 FT /rpt_family="Alu" FT repeat_region 6485395..6485552 FT /rpt_family="L1" FT repeat_region 6485822..6486138 FT /rpt_family="Alu" FT repeat_region 6486198..6486357 FT /rpt_family="Alu" FT repeat_region 6486358..6486658 FT /rpt_family="Alu" FT repeat_region 6486659..6486769 FT /rpt_family="Alu" FT misc_feature 6487047..6487750 FT /note="CpG_island (%GC=66.1, o/e=0.91, #CpGs=72)" FT repeat_region 6487168..6487289 FT /rpt_family="MIR" FT misc_feature 6487723..6487820 FT /note="sequence derived from PCR product from clone DNA" FT repeat_region 6487831..6488138 FT /rpt_family="Alu" FT repeat_region 6488139..6488321 FT /rpt_family="Alu" FT repeat_region 6488324..6488551 FT /rpt_family="Alu" FT repeat_region 6488553..6488688 FT /rpt_family="Alu" FT repeat_region 6488696..6488790 FT /rpt_family="MIR" FT repeat_region 6488907..6489111 FT /rpt_family="L2" FT repeat_region 6489112..6489412 FT /rpt_family="Alu" FT repeat_region 6489413..6489630 FT /rpt_family="L2" FT repeat_region 6489703..6489839 FT /rpt_family="Alu" FT repeat_region 6489840..6490127 FT /rpt_family="Alu" FT repeat_region 6490212..6490345 FT /rpt_family="L2" FT repeat_region 6490418..6490554 FT /rpt_family="Alu" FT repeat_region 6490555..6490863 FT /rpt_family="Alu" FT repeat_region 6490867..6491185 FT /rpt_family="ERV1" FT repeat_region 6491186..6491486 FT /rpt_family="Alu" FT repeat_region 6491499..6491805 FT /rpt_family="Alu" FT repeat_region 6491808..6491941 FT /rpt_family="Alu" FT repeat_region 6491957..6492241 FT /rpt_family="L2" FT repeat_region 6492265..6492567 FT /rpt_family="Alu" FT repeat_region 6492688..6492765 FT /rpt_family="Alu" FT repeat_region 6492807..6492828 FT /rpt_family="AT_rich" FT repeat_region 6492905..6493199 FT /rpt_family="Alu" FT repeat_region 6493203..6493294 FT /rpt_family="MER1_type" FT repeat_region 6493295..6493851 FT /rpt_family="ERV1" FT repeat_region 6493852..6494142 FT /rpt_family="Alu" FT repeat_region 6494143..6494181 FT /rpt_family="ERV1" FT repeat_region 6494182..6494225 FT /rpt_family="MER1_type" FT repeat_region 6494226..6494517 FT /rpt_family="Alu" FT repeat_region 6494518..6494581 FT /rpt_family="MER1_type" FT repeat_region 6494653..6494972 FT /rpt_family="Alu" FT repeat_region 6495104..6495169 FT /rpt_family="L1" FT repeat_region 6495170..6495465 FT /rpt_family="Alu" FT repeat_region 6495466..6495570 FT /rpt_family="L1" FT repeat_region 6495574..6495881 FT /rpt_family="Alu" FT repeat_region 6496081..6496189 FT /rpt_family="L1" FT repeat_region 6496205..6496482 FT /rpt_family="Alu" FT repeat_region 6496488..6496792 FT /rpt_family="Alu" FT repeat_region 6496801..6497108 FT /rpt_family="Alu" FT repeat_region 6497309..6497590 FT /rpt_family="Alu" FT repeat_region 6497601..6497911 FT /rpt_family="Alu" FT repeat_region 6497940..6498251 FT /rpt_family="Alu" FT misc_feature 6498222..6498264 FT /note="unresolved homopolymeric repeat" FT unsure 6498222..6498264 FT /note="unresolved simple sequence repeat" FT repeat_region 6498252..6498430 FT /rpt_family="Alu" FT repeat_region 6498724..6499027 FT /rpt_family="Alu" FT repeat_region 6499360..6499669 FT /rpt_family="Alu" FT repeat_region 6499670..6499959 FT /rpt_family="Alu" FT repeat_region 6500480..6500614 FT /rpt_family="Alu" FT gene complement(6502270..6523784) FT /gene="KDELR2" FT mRNA complement(join(6502270..6502806,6505702..6505954, FT 6509227..6509385,6513815..6513915,6523598..6523700)) FT /gene="KDELR2" FT mRNA complement(join(6502347..6502806,6505702..6505954, FT 6509227..6509385,6513815..6513915,6523598..6523754)) FT /gene="KDELR2" FT mRNA complement(join(6502417..6502806,6505702..6505954, FT 6509227..6509385,6513815..6513915,6523598..6523784)) FT /gene="KDELR2" FT repeat_region 6502432..6502457 FT /rpt_family="AT_rich" FT CDS complement(join(6502772..6502806,6505702..6505954, FT 6509227..6509385,6513815..6513915,6523598..6523688)) FT /codon_start=1 FT /gene="KDELR2" FT /product="unknown" FT /note="Homo sapiens KDEL (Lys-Asp-Glu-Leu) endoplasmic FT reticulum protein retention receptor 2 (KDELR2), mRNA.; FT H_MS2195F21.2 This gene was based on gi(8051609 14165554 FT 15278090)" FT /protein_id="AAS02002.1" FT /translation="MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFT FT TRYLDLFTSFISLYNTSMKVIYLACSYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGG FT LSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYL FT VNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA" FT repeat_region 6503080..6503405 FT /rpt_family="Alu" FT repeat_region 6503410..6503545 FT /rpt_family="Alu" FT repeat_region 6503546..6503858 FT /rpt_family="Alu" FT repeat_region 6503859..6503869 FT /rpt_family="Alu" FT repeat_region 6503870..6504173 FT /rpt_family="Alu" FT repeat_region 6504174..6504345 FT /rpt_family="Alu" FT repeat_region 6504355..6504666 FT /rpt_family="Alu" FT repeat_region 6504811..6505111 FT /rpt_family="Alu" FT repeat_region 6505185..6505412 FT /rpt_family="L1" FT repeat_region 6506110..6506632 FT /rpt_family="MER1_type" FT repeat_region 6507110..6507403 FT /rpt_family="Alu" FT repeat_region 6507969..6508126 FT /rpt_family="Alu" FT repeat_region 6508127..6508434 FT /rpt_family="Alu" FT repeat_region 6508435..6508572 FT /rpt_family="Alu" FT repeat_region 6508585..6508882 FT /rpt_family="Alu" FT repeat_region 6508889..6509204 FT /rpt_family="Alu" FT repeat_region 6509512..6509821 FT /rpt_family="L1" FT repeat_region 6509829..6510463 FT /rpt_family="MER2_type" FT repeat_region 6510464..6510785 FT /rpt_family="Alu" FT repeat_region 6510786..6510807 FT /rpt_family="MER2_type" FT repeat_region 6510808..6511110 FT /rpt_family="Alu" FT repeat_region 6511111..6511300 FT /rpt_family="MER2_type" FT repeat_region 6511301..6511535 FT /rpt_family="L1" FT repeat_region 6511536..6511755 FT /rpt_family="Alu" FT repeat_region 6512428..6512467 FT /rpt_family="L2" FT repeat_region 6512468..6512492 FT /rpt_family="(GAAA)n" FT repeat_region 6512526..6512850 FT /rpt_family="Alu" FT repeat_region 6514292..6514568 FT /rpt_family="Alu" FT repeat_region 6514702..6514768 FT /rpt_family="Mariner" FT repeat_region 6514798..6515066 FT /rpt_family="Alu" FT repeat_region 6515540..6515722 FT /rpt_family="Alu" FT repeat_region 6516517..6516626 FT /rpt_family="L2" FT repeat_region 6517286..6517400 FT /rpt_family="Alu" FT repeat_region 6517401..6517569 FT /rpt_family="L1" FT repeat_region 6517622..6517738 FT /rpt_family="L1" FT repeat_region 6517795..6518047 FT /rpt_family="Alu" FT repeat_region 6518064..6518205 FT /rpt_family="L1" FT repeat_region 6518412..6518719 FT /rpt_family="Alu" FT repeat_region 6518779..6519085 FT /rpt_family="Alu" FT repeat_region 6519098..6519407 FT /rpt_family="Alu" FT repeat_region 6519457..6519489 FT /rpt_family="L2" FT repeat_region 6519490..6519502 FT /rpt_family="MIR" FT repeat_region 6520720..6521025 FT /rpt_family="Alu" FT repeat_region 6521207..6521342 FT /rpt_family="Alu" FT repeat_region 6521360..6521396 FT /rpt_family="(CAAA)n" FT repeat_region 6521495..6521600 FT /rpt_family="MIR" FT repeat_region 6521601..6521929 FT /rpt_family="Alu" FT repeat_region 6521930..6522011 FT /rpt_family="MIR" FT repeat_region 6522421..6522660 FT /rpt_family="Alu" FT gene 6522922..6524906 FT /gene="FLJ20306" FT mRNA 6522922..6524906 FT /gene="FLJ20306" FT misc_feature 6523065..6523897 FT /gene="FLJ20306" FT /note="CpG_island (%GC=75.9, o/e=0.93, #CpGs=106)" FT CDS 6523636..6524022 FT /codon_start=1 FT /gene="FLJ20306" FT /product="unknown" FT /note="Homo sapiens hypothetical protein FLJ20306 FT (FLJ20306), mRNA.; H_MS2195F21.1 This gene was based on FT gi(8923286)" FT /protein_id="AAS02001.1" FT /translation="MTMAARWDRSPVSRKMFMAAAAVAVGAARRPRGWAAQEAAAPERK FT RRRWRDRPRRGQGRGRTAGARARGAPWESGARPRPLKGARPSAGSAGQLAGTPLQEDPG FT LCQIFPAGFPASPRVPAVSFTFLK" FT repeat_region 6523689..6523757 FT /rpt_family="(CGG)n" FT repeat_region 6523822..6523844 FT /rpt_family="GC_rich" FT repeat_region 6524102..6524446 FT /rpt_family="Alu" FT repeat_region 6524498..6524593 FT /rpt_family="AcHobo" FT repeat_region 6524594..6524903 FT /rpt_family="Alu" FT repeat_region 6524904..6524971 FT /rpt_family="AcHobo" FT repeat_region 6524972..6525042 FT /rpt_family="AcHobo" FT repeat_region 6525054..6525394 FT /rpt_family="Alu" FT repeat_region 6525400..6525481 FT /rpt_family="Alu" FT repeat_region 6525484..6525791 FT /rpt_family="Alu" FT repeat_region 6525798..6526026 FT /rpt_family="Alu" FT repeat_region 6526042..6526184 FT /rpt_family="AcHobo" FT repeat_region 6526185..6526348 FT /rpt_family="Alu" FT repeat_region 6526353..6526444 FT /rpt_family="AcHobo" FT repeat_region 6526549..6527277 FT /rpt_family="AcHobo" FT repeat_region 6527279..6527368 FT /rpt_family="AcHobo" FT repeat_region 6527373..6527552 FT /rpt_family="(TA)n" FT repeat_region 6527580..6527743 FT /rpt_family="Alu" FT repeat_region 6527748..6528026 FT /rpt_family="AcHobo" FT repeat_region 6528028..6528326 FT /rpt_family="Alu" FT repeat_region 6528396..6528453 FT /rpt_family="MaLR" FT repeat_region 6528454..6528593 FT /rpt_family="Alu" FT repeat_region 6528637..6528941 FT /rpt_family="Alu" FT repeat_region 6528954..6529246 FT /rpt_family="Alu" FT repeat_region 6529247..6529556 FT /rpt_family="MaLR" FT repeat_region 6529557..6529721 FT /rpt_family="ERV1" FT repeat_region 6529722..6530014 FT /rpt_family="Alu" FT repeat_region 6530015..6530062 FT /rpt_family="ERV1" FT repeat_region 6530102..6530146 FT /rpt_family="T-rich" FT repeat_region 6530148..6530320 FT /rpt_family="Alu" FT repeat_region 6530732..6530811 FT /rpt_family="MaLR" FT repeat_region 6530844..6530977 FT /rpt_family="Alu" FT repeat_region 6531266..6531555 FT /rpt_family="Alu" FT repeat_region 6531675..6531846 FT /rpt_family="MaLR" FT repeat_region 6531851..6532089 FT /rpt_family="Alu" FT repeat_region 6532090..6532394 FT /rpt_family="Alu" FT repeat_region 6532412..6532478 FT /rpt_family="GA-rich" FT repeat_region 6532480..6532697 FT /rpt_family="MaLR" FT repeat_region 6532777..6532845 FT /rpt_family="(TG)n" FT repeat_region 6532908..6533025 FT /rpt_family="MIR" FT repeat_region 6533345..6533646 FT /rpt_family="Alu" FT repeat_region 6533667..6533968 FT /rpt_family="Alu" FT repeat_region 6534044..6534111 FT /rpt_family="MaLR" FT repeat_region 6534138..6534436 FT /rpt_family="MaLR" FT repeat_region 6534570..6534879 FT /rpt_family="Alu" FT repeat_region 6535063..6535545 FT /rpt_family="MaLR" FT repeat_region 6535568..6535690 FT /rpt_family="MER1_type" FT repeat_region 6535747..6536045 FT /rpt_family="Alu" FT repeat_region 6536373..6536392 FT /rpt_family="(A)n" FT repeat_region 6538204..6538515 FT /rpt_family="Alu" FT repeat_region 6538675..6538866 FT /rpt_family="MIR" FT repeat_region 6538893..6539044 FT /rpt_family="MIR" FT repeat_region 6539056..6539077 FT /rpt_family="(TTAA)n" FT repeat_region 6539078..6539359 FT /rpt_family="Alu" FT repeat_region 6539370..6539661 FT /rpt_family="Alu" FT repeat_region 6539813..6540109 FT /rpt_family="Alu" FT repeat_region 6540700..6541034 FT /rpt_family="Alu" FT repeat_region 6541051..6541197 FT /rpt_family="Alu" FT repeat_region 6541224..6541247 FT /rpt_family="(CAAT)n" FT repeat_region 6541864..6542145 FT /rpt_family="Alu" FT repeat_region 6542221..6542248 FT /rpt_family="(CACCC)n" FT misc_feature 6543016..6543598 FT /note="CpG_island (%GC=72.7, o/e=0.73, #CpGs=61)" FT repeat_region 6543323..6543364 FT /rpt_family="(CGGGG)n" FT misc_feature 6543796..6544108 FT /note="CpG_island (%GC=67.7, o/e=0.82, #CpGs=23)" FT repeat_region 6544832..6544988 FT /rpt_family="MIR" FT repeat_region 6544989..6545299 FT /rpt_family="Alu" FT repeat_region 6545300..6545315 FT /rpt_family="MIR" FT repeat_region 6546313..6546613 FT /rpt_family="Alu" FT repeat_region 6546846..6547240 FT /rpt_family="CR1" FT misc_feature 6548539..6548781 FT /note="CpG_island (%GC=69.1, o/e=0.88, #CpGs=21)" FT repeat_region 6549458..6549758 FT /rpt_family="Alu" FT repeat_region 6551011..6551303 FT /rpt_family="Alu" FT repeat_region 6551451..6551529 FT /rpt_family="CT-rich" FT repeat_region 6551531..6551844 FT /rpt_family="Alu" FT repeat_region 6551851..6552136 FT /rpt_family="Alu" FT repeat_region 6552139..6552441 FT /rpt_family="Alu" FT repeat_region 6552442..6552585 FT /rpt_family="Alu" FT repeat_region 6552854..6553150 FT /rpt_family="Alu" FT repeat_region 6553433..6553598 FT /rpt_family="Alu" FT repeat_region 6553603..6553910 FT /rpt_family="Alu" FT repeat_region 6554301..6554612 FT /rpt_family="Alu" FT repeat_region 6554623..6554798 FT /rpt_family="MIR" FT repeat_region 6554811..6555115 FT /rpt_family="Alu" FT repeat_region 6555127..6555444 FT /rpt_family="Alu" FT repeat_region 6555448..6555767 FT /rpt_family="Alu" FT repeat_region 6555834..6556681 FT /rpt_family="ERVK" FT repeat_region 6556682..6556987 FT /rpt_family="Alu" FT repeat_region 6556988..6557069 FT /rpt_family="ERVK" FT repeat_region 6557266..6557571 FT /rpt_family="Alu" FT repeat_region 6557581..6557880 FT /rpt_family="Alu" FT repeat_region 6557881..6558086 FT /rpt_family="L1" FT repeat_region 6558087..6558395 FT /rpt_family="Alu" FT repeat_region 6558396..6558522 FT /rpt_family="L1" FT repeat_region 6558541..6558829 FT /rpt_family="Alu" FT repeat_region 6558837..6558967 FT /rpt_family="L1" FT repeat_region 6558978..6559098 FT /rpt_family="Alu" FT repeat_region 6559107..6559413 FT /rpt_family="Alu" FT repeat_region 6559630..6559938 FT /rpt_family="Alu" FT repeat_region 6559969..6560041 FT /rpt_family="MIR" FT repeat_region 6560601..6560901 FT /rpt_family="Alu" FT repeat_region 6561660..6561699 FT /rpt_family="MIR" FT repeat_region 6561700..6561829 FT /rpt_family="Alu" FT repeat_region 6561830..6561924 FT /rpt_family="MIR" FT repeat_region 6562122..6562283 FT /rpt_family="Alu" FT repeat_region 6562284..6562438 FT /rpt_family="Alu" FT repeat_region 6562439..6562475 FT /rpt_family="(TG)n" FT repeat_region 6562476..6562595 FT /rpt_family="Alu" FT repeat_region 6562596..6562727 FT /rpt_family="Alu" FT repeat_region 6563017..6563107 FT /rpt_family="MIR" FT repeat_region 6563201..6563351 FT /rpt_family="Alu" FT repeat_region 6563352..6563453 FT /rpt_family="Alu" FT repeat_region 6563457..6563625 FT /rpt_family="CR1" FT repeat_region 6564209..6564350 FT /rpt_family="Alu" FT repeat_region 6564354..6564617 FT /rpt_family="Alu" FT repeat_region 6564655..6564959 FT /rpt_family="Alu" FT repeat_region 6564971..6565293 FT /rpt_family="Alu" FT misc_feature 6566067..6566650 FT /note="CpG_island (%GC=75.5, o/e=0.89, #CpGs=78)" FT repeat_region 6566154..6566184 FT /rpt_family="GC_rich" FT repeat_region 6566219..6566248 FT /rpt_family="GC_rich" FT repeat_region 6567207..6567391 FT /rpt_family="Alu" FT repeat_region 6567392..6567685 FT /rpt_family="Alu" FT repeat_region 6567686..6567827 FT /rpt_family="Alu" FT repeat_region 6567840..6567915 FT /rpt_family="L2" FT repeat_region 6567981..6568080 FT /rpt_family="MIR" FT repeat_region 6568802..6569094 FT /rpt_family="Alu" FT repeat_region 6569570..6569593 FT /rpt_family="(TC)n" FT repeat_region 6569594..6569888 FT /rpt_family="Alu" FT repeat_region 6569889..6570204 FT /rpt_family="Alu" FT misc_feature 6570454..6571117 FT /note="CpG_island (%GC=71.2, o/e=0.84, #CpGs=68)" FT repeat_region 6571098..6571207 FT /rpt_family="L2" FT repeat_region 6571239..6571322 FT /rpt_family="Alu" FT repeat_region 6571652..6571708 FT /rpt_family="GA-rich" FT repeat_region 6572666..6572885 FT /rpt_family="MER1_type" FT repeat_region 6572989..6573294 FT /rpt_family="Alu" FT repeat_region 6573306..6573356 FT /rpt_family="Alu" FT repeat_region 6573357..6573580 FT /rpt_family="Alu" FT repeat_region 6573767..6573877 FT /rpt_family="MIR" FT repeat_region 6574176..6574344 FT /rpt_family="MER1_type" FT repeat_region 6574345..6574512 FT /rpt_family="Alu" FT repeat_region 6574513..6574532 FT /rpt_family="(TTTA)n" FT repeat_region 6574533..6574815 FT /rpt_family="Alu" FT repeat_region 6574816..6574960 FT /rpt_family="Alu" FT repeat_region 6574961..6575016 FT /rpt_family="MER1_type" FT repeat_region 6575219..6575323 FT /rpt_family="Alu" FT repeat_region 6575591..6575638 FT /rpt_family="L2" FT misc_feature 6575924..6576389 FT /note="CpG_island (%GC=72.5, o/e=0.60, #CpGs=40)" FT repeat_region 6576528..6576562 FT /rpt_family="GC_rich" FT repeat_region 6576893..6577001 FT /rpt_family="Alu" FT repeat_region 6577002..6577308 FT /rpt_family="Alu" FT repeat_region 6577309..6577486 FT /rpt_family="Alu" FT repeat_region 6577500..6577637 FT /rpt_family="MIR" FT repeat_region 6577717..6578043 FT /rpt_family="Alu" FT repeat_region 6578052..6578217 FT /rpt_family="Alu" FT repeat_region 6578227..6578534 FT /rpt_family="Alu" FT repeat_region 6578765..6579057 FT /rpt_family="Alu" FT repeat_region 6579651..6579718 FT /rpt_family="CT-rich" FT repeat_region 6579719..6579749 FT /rpt_family="(TCCCC)n" FT repeat_region 6579750..6580042 FT /rpt_family="Alu" FT repeat_region 6580110..6580141 FT /rpt_family="AT_rich" FT repeat_region 6580142..6580461 FT /rpt_family="Alu" FT repeat_region 6580464..6580648 FT /rpt_family="Alu" FT repeat_region 6580685..6580815 FT /rpt_family="Alu" FT repeat_region 6580819..6580908 FT /rpt_family="MIR" FT repeat_region 6581362..6581650 FT /rpt_family="L1" FT repeat_region 6581651..6581967 FT /rpt_family="Alu" FT repeat_region 6582003..6582313 FT /rpt_family="Alu" FT repeat_region 6582318..6582442 FT /rpt_family="L1" FT repeat_region 6582744..6583039 FT /rpt_family="Alu" FT repeat_region 6583127..6583244 FT /rpt_family="L2" FT repeat_region 6583245..6583410 FT /rpt_family="Alu" FT repeat_region 6583420..6583727 FT /rpt_family="Alu" FT repeat_region 6583753..6583894 FT /rpt_family="L2" FT repeat_region 6583898..6584210 FT /rpt_family="Alu" FT repeat_region 6584300..6584430 FT /rpt_family="Alu" FT repeat_region 6584431..6584745 FT /rpt_family="Alu" FT repeat_region 6584746..6584933 FT /rpt_family="Alu" FT repeat_region 6584936..6585171 FT /rpt_family="L2" FT repeat_region 6585264..6585387 FT /rpt_family="L2" FT repeat_region 6585812..6585926 FT /rpt_family="Alu" FT repeat_region 6585928..6586006 FT /rpt_family="Alu" FT repeat_region 6586024..6586226 FT /rpt_family="Alu" FT repeat_region 6586547..6586687 FT /rpt_family="MaLR" FT repeat_region 6586890..6587199 FT /rpt_family="Alu" FT repeat_region 6587638..6587700 FT /rpt_family="L1" FT repeat_region 6587701..6587999 FT /rpt_family="Alu" FT repeat_region 6588000..6588163 FT /rpt_family="L1" FT repeat_region 6588187..6588490 FT /rpt_family="Alu" FT repeat_region 6589273..6589557 FT /rpt_family="Alu" FT repeat_region 6589570..6589604 FT /rpt_family="U2" FT repeat_region 6589614..6589900 FT /rpt_family="Alu" FT repeat_region 6590017..6590127 FT /rpt_family="L1" FT repeat_region 6590160..6590470 FT /rpt_family="Alu" FT misc_feature 6590564..6590957 FT /note="CpG_island (%GC=76.1, o/e=0.77, #CpGs=48)" FT repeat_region 6591219..6591530 FT /rpt_family="Alu" FT repeat_region 6591534..6591668 FT /rpt_family="Alu" FT repeat_region 6591669..6591705 FT /rpt_family="(TTTG)n" FT repeat_region 6592027..6592332 FT /rpt_family="Alu" FT repeat_region 6592341..6592635 FT /rpt_family="Alu" FT repeat_region 6592664..6592980 FT /rpt_family="Alu" FT repeat_region 6593033..6593084 FT /rpt_family="MIR" FT repeat_region 6593384..6593592 FT /rpt_family="MaLR" FT repeat_region 6593614..6593726 FT /rpt_family="Alu" FT repeat_region 6593727..6594017 FT /rpt_family="Alu" FT repeat_region 6594018..6594205 FT /rpt_family="Alu" FT repeat_region 6594214..6594244 FT /rpt_family="AT_rich" FT repeat_region 6594354..6594673 FT /rpt_family="Alu" FT repeat_region 6594992..6595291 FT /rpt_family="Alu" FT repeat_region 6595292..6595574 FT /rpt_family="Alu" FT repeat_region 6595576..6595661 FT /rpt_family="Alu" FT repeat_region 6596327..6596623 FT /rpt_family="Alu" FT repeat_region 6597560..6597775 FT /rpt_family="Alu" FT repeat_region 6597780..6597823 FT /rpt_family="Alu" FT repeat_region 6597836..6598134 FT /rpt_family="Alu" FT repeat_region 6598153..6598198 FT /rpt_family="(CA)n" FT repeat_region 6598267..6598488 FT /rpt_family="Alu" FT repeat_region 6598527..6598562 FT /rpt_family="(TAAAA)n" FT repeat_region 6598563..6598728 FT /rpt_family="L2" FT repeat_region 6598729..6598782 FT /rpt_family="Alu" FT repeat_region 6598783..6598857 FT /rpt_family="Alu" FT repeat_region 6598938..6599239 FT /rpt_family="Alu" FT repeat_region 6599251..6599299 FT /rpt_family="(TTTG)n" FT repeat_region 6599315..6599421 FT /rpt_family="Alu" FT repeat_region 6599450..6599925 FT /rpt_family="L2" FT repeat_region 6600002..6600120 FT /rpt_family="Alu" FT repeat_region 6600176..6600463 FT /rpt_family="Alu" FT repeat_region 6600465..6600758 FT /rpt_family="Alu" FT repeat_region 6600759..6601039 FT /rpt_family="Alu" FT repeat_region 6601057..6601331 FT /rpt_family="Alu" FT repeat_region 6601355..6601665 FT /rpt_family="Alu" FT repeat_region 6601797..6602161 FT /rpt_family="L1" FT repeat_region 6602174..6602481 FT /rpt_family="Alu" FT repeat_region 6602482..6602589 FT /rpt_family="Alu" FT repeat_region 6602591..6602889 FT /rpt_family="Alu" FT repeat_region 6602911..6603038 FT /rpt_family="L1" FT repeat_region 6603039..6603345 FT /rpt_family="Alu" FT repeat_region 6603346..6603399 FT /rpt_family="L1" FT repeat_region 6603406..6603462 FT /rpt_family="Alu" FT repeat_region 6603471..6603568 FT /rpt_family="MaLR" FT repeat_region 6603572..6603829 FT /rpt_family="Alu" FT repeat_region 6603830..6604048 FT /rpt_family="MaLR" FT repeat_region 6604280..6604573 FT /rpt_family="Alu" FT repeat_region 6604765..6605063 FT /rpt_family="Alu" FT repeat_region 6605064..6605125 FT /rpt_family="Alu" FT repeat_region 6605126..6605337 FT /rpt_family="Alu" FT repeat_region 6605415..6605524 FT /rpt_family="MaLR" FT repeat_region 6605651..6605943 FT /rpt_family="Alu" FT repeat_region 6605980..6606264 FT /rpt_family="Alu" FT repeat_region 6606301..6606568 FT /rpt_family="Alu" FT repeat_region 6606663..6606779 FT /rpt_family="Alu" FT repeat_region 6606819..6607126 FT /rpt_family="Alu" FT repeat_region 6607155..6607466 FT /rpt_family="Alu" FT repeat_region 6607821..6608100 FT /rpt_family="Alu" FT repeat_region 6608177..6608345 FT /rpt_family="ERV1" FT repeat_region 6608346..6608616 FT /rpt_family="Alu" FT repeat_region 6608626..6608946 FT /rpt_family="Alu" FT repeat_region 6608947..6609491 FT /rpt_family="ERV1" FT repeat_region 6609562..6609813 FT /rpt_family="ERV1" FT repeat_region 6609814..6610113 FT /rpt_family="Alu" FT repeat_region 6610114..6610484 FT /rpt_family="ERV1" FT repeat_region 6610485..6610785 FT /rpt_family="Alu" FT repeat_region 6610786..6610796 FT /rpt_family="ERV1" FT repeat_region 6610797..6611090 FT /rpt_family="Alu" FT repeat_region 6611091..6611219 FT /rpt_family="ERV1" FT repeat_region 6611742..6612046 FT /rpt_family="Alu" FT repeat_region 6612049..6612341 FT /rpt_family="Alu" FT repeat_region 6612342..6612580 FT /rpt_family="L2" FT repeat_region 6612707..6613005 FT /rpt_family="Alu" FT repeat_region 6613016..6613312 FT /rpt_family="Alu" FT repeat_region 6613404..6613913 FT /rpt_family="MaLR" FT repeat_region 6613914..6614217 FT /rpt_family="Alu" FT repeat_region 6614404..6614503 FT /rpt_family="L2" FT repeat_region 6614508..6614819 FT /rpt_family="Alu" FT repeat_region 6615322..6615611 FT /rpt_family="Alu" FT misc_feature 6616356..6616377 FT /note="match to EST AI740665 (NID:g5108953) wg07b05.x1" FT repeat_region 6616404..6616700 FT /rpt_family="Alu" FT repeat_region 6616524..6616548 FT /rpt_family="(A)n" FT misc_feature 6616602..6616605 FT /note="match to EST BG469454 (NID:g13401729)" FT misc_feature 6616683 FT /note="match to EST AL555319 (NID:g12896940)" FT repeat_region 6616728..6616916 FT /rpt_family="L1" FT repeat_region 6616744..6616917 FT /rpt_family="(TAAAA)n" FT misc_feature 6616982..6616983 FT /note="match to EST BG700094 (NID:g13969090)" FT misc_feature 6617053..6617054 FT /note="match to EST BG750834 (NID:g14061487)" FT misc_feature 6617083..6617129 FT /note="match to EST AU126873 (NID:g10951589)" FT misc_feature 6617087..6617129 FT /note="match to EST BG700094 (NID:g13969090)" FT misc_feature 6617088..6617129 FT /note="match to EST BE796190 (NID:g10217388)" FT /note="similar to Homo sapiens EST BG024936 FT (NID:g12411050)" FT misc_feature 6617107..6617129 FT /note="match to EST BG750834 (NID:g14061487)" FT /note="match to EST BG546775 (NID:g13545440)" FT misc_feature 6617112..6617129 FT /note="match to EST AA218538 (NID:g1832713) zq98h10.r1" FT misc_feature 6617116..6617129 FT /note="match to EST AL524590 (NID:g12788083)" FT misc_feature 6617116..6617351 FT /note="match to EST AL555319 (NID:g12896940)" FT misc_feature 6617117..6617351 FT /note="match to EST AL529705 (NID:g12793198)" FT misc_feature 6617121..6617129 FT /note="match to EST BG469454 (NID:g13401729)" FT misc_feature 6617148..6617351 FT /note="similar to Homo sapiens EST BE537412 (NID:g9766057)" FT misc_feature 6617163..6617351 FT /note="match to EST BG283447 (NID:g13033406)" FT misc_feature 6617213..6617351 FT /note="match to EST AL554486 (NID:g12895317)" FT misc_feature 6617221..6617351 FT /note="match to EST BG700094 (NID:g13969090)" FT /note="match to EST BG750834 (NID:g14061487)" FT repeat_region 6617460..6617759 FT /rpt_family="Alu" FT repeat_region 6617761..6618047 FT /rpt_family="Alu" FT misc_feature 6618132..6618351 FT /note="match to EST AL554486 (NID:g12895317)" FT /note="match to EST BE796190 (NID:g10217388)" FT /note="match to EST BG283447 (NID:g13033406)" FT misc_feature 6618159..6618351 FT /note="match to EST BE786389 (NID:g10207587)" FT misc_feature 6618188..6618351 FT /note="match to EST BG469454 (NID:g13401729)" FT misc_feature 6618196..6618272 FT /note="match to EST AA969047 (NID:g3144227) op43e01.s1" FT misc_feature 6618197..6618351 FT /note="similar to Homo sapiens EST BG024936 FT (NID:g12411050)" FT /note="match to EST AU126873 (NID:g10951589)" FT /note="match to EST BG750834 (NID:g14061487)" FT /note="match to EST BG546775 (NID:g13545440)" FT /note="similar to Homo sapiens EST BE537412 (NID:g9766057)" FT /note="match to EST BG700094 (NID:g13969090)" FT /note="match to EST AA218538 (NID:g1832713) zq98h10.r1" FT misc_feature 6618197..6618377 FT /note="match to EST AL524590 (NID:g12788083)" FT /note="match to EST AL555319 (NID:g12896940)" FT /note="match to EST AL529705 (NID:g12793198)" FT misc_feature 6618238..6618351 FT /note="match to EST AA296971 (NID:g1949356)" FT misc_feature 6618256..6618351 FT /note="match to EST AW352289 (NID:g6850002)" FT misc_feature 6618322..6618351 FT /note="similar to Homo sapiens EST AL577168 FT (NID:g12940033)" FT repeat_region 6618504..6618753 FT /rpt_family="Alu" FT repeat_region 6618830..6619129 FT /rpt_family="Alu" FT repeat_region 6619485..6619777 FT /rpt_family="Alu" FT repeat_region 6619767..6619815 FT /rpt_family="AT_rich" FT repeat_region 6619792..6619931 FT /rpt_family="Alu" FT misc_feature 6619957..6620502 FT /note="match to EST BG745537 (NID:g14056190)" FT misc_feature 6620186..6620309 FT /note="match to EST BE796190 (NID:g10217388)" FT /note="similar to Mus musculus EST BG863297 FT (NID:g14213848)" FT /note="similar to Homo sapiens EST BE537412 (NID:g9766057)" FT /note="match to EST AW352289 (NID:g6850002)" FT /note="match to EST BG750834 (NID:g14061487)" FT /note="similar to Homo sapiens EST AL577168 FT (NID:g12940033)" FT /note="similar to Homo sapiens EST BG024936 FT (NID:g12411050)" FT /note="match to EST BG283447 (NID:g13033406)" FT /note="match to EST AU126873 (NID:g10951589)" FT /note="match to EST AL524590 (NID:g12788083)" FT /note="match to EST BG469454 (NID:g13401729)" FT /note="match to EST BG700094 (NID:g13969090)" FT /note="match to EST BE786389 (NID:g10207587)" FT /note="match to EST AA296971 (NID:g1949356)" FT /note="match to EST BG546775 (NID:g13545440)" FT /note="match to EST AL555319 (NID:g12896940)" FT /note="match to EST AL529705 (NID:g12793198)" FT /note="match to EST AL554486 (NID:g12895317)" FT misc_feature 6620186..6620290 FT /note="match to EST AA218538 (NID:g1832713) zq98h10.r1" FT misc_feature 6620189..6620309 FT /note="similar to Bos taurus EST BE485458 (NID:g9604991)" FT misc_feature 6620263..6620309 FT /note="match to EST BE544763 (NID:g9773408)" FT repeat_region 6620403..6620563 FT /rpt_family="Alu" FT misc_feature 6621235..6621311 FT /note="match to EST AL563527 (NID:g12913008)" FT misc_feature 6621237..6621311 FT /note="similar to Sus scrofa EST BE013132 (NID:g8274085)" FT misc_feature 6621238..6621311 FT /note="match to EST AU126873 (NID:g10951589)" FT /note="match to EST AL529705 (NID:g12793198)" FT /note="similar to Mus musculus EST BG863297 FT (NID:g14213848)" FT /note="match to EST AL554486 (NID:g12895317)" FT /note="match to EST BG546775 (NID:g13545440)" FT /note="similar to Bos taurus EST BE485458 (NID:g9604991)" FT /note="match to EST AL555319 (NID:g12896940)" FT /note="similar to Homo sapiens EST AL577168 FT (NID:g12940033)" FT /note="match to EST BG750834 (NID:g14061487)" FT /note="match to EST BE796190 (NID:g10217388)" FT /note="match to EST BG469454 (NID:g13401729)" FT /note="match to EST BE786389 (NID:g10207587)" FT /note="match to EST AL524590 (NID:g12788083)" FT /note="similar to Homo sapiens EST BE537412 (NID:g9766057)" FT /note="match to EST BE544763 (NID:g9773408)" FT /note="match to EST BG700094 (NID:g13969090)" FT /note="similar to Homo sapiens EST BG024936 FT (NID:g12411050)" FT /note="match to EST BG283447 (NID:g13033406)" FT misc_feature 6621238..6621315 FT /note="match to EST AW352289 (NID:g6850002)" FT misc_feature 6621238..6621312 FT /note="match to EST AA296971 (NID:g1949356)" FT misc_feature 6621251..6621311 FT /note="similar to Mus musculus EST AA822396 (NID:g2892264) FT vw37c05.r1" FT misc_feature 6621613..6621882 FT /note="similar to Mus musculus EST BG863297 FT (NID:g14213848)" FT misc_feature 6621704..6621882 FT /note="match to EST AL563527 (NID:g12913008)" FT /note="similar to Sus scrofa EST BE013132 (NID:g8274085)" FT /note="match to EST BE544763 (NID:g9773408)" FT /note="match to EST BE786389 (NID:g10207587)" FT /note="match to EST BG546775 (NID:g13545440)" FT /note="match to EST AL529705 (NID:g12793198)" FT /note="match to EST BG750834 (NID:g14061487)" FT /note="match to EST BE796190 (NID:g10217388)" FT /note="match to EST AU126873 (NID:g10951589)" FT /note="match to EST AL524590 (NID:g12788083)" FT /note="similar to Bos taurus EST BE485458 (NID:g9604991)" FT /note="match to EST AL554486 (NID:g12895317)" FT /note="similar to Mus musculus EST AA822396 (NID:g2892264) FT vw37c05.r1" FT /note="similar to Homo sapiens EST AL577168 FT (NID:g12940033)" FT misc_feature 6621704..6621877 FT /note="match to EST BG469454 (NID:g13401729)" FT misc_feature 6621704..6621824 FT /note="similar to Homo sapiens EST BE537412 (NID:g9766057)" FT misc_feature 6621704..6621873 FT /note="match to EST AL555319 (NID:g12896940)" FT misc_feature 6621704..6621883 FT /note="match to EST BG700094 (NID:g13969090)" FT misc_feature 6621704..6621849 FT /note="similar to Homo sapiens EST BG024936 FT (NID:g12411050)" FT misc_feature 6621729..6621882 FT /note="match to EST AA161263 (NID:g1735714) zq41e11.r1" FT misc_feature 6621781..6621882 FT /note="match to EST AL519840 (NID:g12783333)" FT misc_feature 6621783..6621882 FT /note="match to EST AL519839 (NID:g12783332)" FT misc_feature 6621799..6621882 FT /note="match to EST BE142815 (NID:g8605536)" FT misc_feature 6621870..6621882 FT /note="match to EST BE762990 (NID:g10192914)" FT repeat_region 6621979..6622067 FT /rpt_family="L1" FT repeat_region 6622149..6622440 FT /rpt_family="Alu" FT repeat_region 6622446..6622512 FT /rpt_family="L1" FT repeat_region 6622523..6622824 FT /rpt_family="Alu" FT misc_feature 6622937..6623070 FT /note="match to EST BE786389 (NID:g10207587)" FT misc_feature 6622937..6623014 FT /note="match to EST AL529705 (NID:g12793198)" FT misc_feature 6622937..6623074 FT /note="match to EST BE796190 (NID:g10217388)" FT misc_feature 6622937..6623062 FT /note="match to EST BE762990 (NID:g10192914)" FT /note="match to EST AL519839 (NID:g12783332)" FT /note="similar to Homo sapiens EST AL577168 FT (NID:g12940033)" FT /note="match to EST AL563527 (NID:g12913008)" FT /note="match to EST AL519840 (NID:g12783333)" FT /note="similar to Sus scrofa EST BE013132 (NID:g8274085)" FT /note="match to EST BE544763 (NID:g9773408)" FT /note="match to EST BG546775 (NID:g13545440)" FT /note="match to EST AL554486 (NID:g12895317)" FT /note="match to EST AA161263 (NID:g1735714) zq41e11.r1" FT misc_feature 6622937..6623470 FT /note="match to EST BE142815 (NID:g8605536)" FT misc_feature 6622937..6623058 FT /note="similar to Mus musculus EST AA822396 (NID:g2892264) FT vw37c05.r1" FT misc_feature 6622937..6622993 FT /note="match to EST BG750834 (NID:g14061487)" FT misc_feature 6622937..6623278 FT /note="match to EST AL524590 (NID:g12788083)" FT misc_feature 6622937..6623060 FT /note="match to EST AU126873 (NID:g10951589)" FT misc_feature 6622937..6622995 FT /note="similar to Bos taurus EST BE485458 (NID:g9604991)" FT misc_feature 6622937..6623082 FT /note="similar to Mus musculus EST BG863297 FT (NID:g14213848)" FT misc_feature 6622949..6623062 FT /note="match to EST BE907873 (NID:g10401877)" FT misc_feature 6622983..6623154 FT /note="match to EST AA281197 (NID:g1923878) zt01e08.r1" FT misc_feature 6622996..6623062 FT /note="match to EST AV712240 (NID:g10731546)" FT misc_feature 6623038..6623062 FT /note="match to EST AA604374 (NID:g2445283) no87e01.s1" FT misc_feature 6623066..6623910 FT /note="match to EST AL524589 (NID:g12788082)" FT misc_feature 6623098..6623315 FT /note="match to EST AA078639 (NID:g1838134)" FT misc_feature 6623172..6623334 FT /note="match to EST AA282889 (NID:g1925980) zs91g04.r1" FT misc_feature 6623208..6623731 FT /note="match to EST H11704 (NID:g876524) ym12g07.r1" FT misc_feature 6623211..6623677 FT /note="match to EST AI591065 (NID:g4600113) tw28f11.x1" FT misc_feature 6623213..6623745 FT /note="match to EST R54572 (NID:g816474) yg81d09.r1" FT repeat_region 6623426..6623692 FT /rpt_family="Alu" FT repeat_region 6623750..6624259 FT /rpt_family="MER1_type" FT repeat_region 6624265..6624419 FT /rpt_family="Alu" FT misc_feature 6624367..6624411 FT /note="match to EST AA282889 (NID:g1925980) zs91g04.r1" FT repeat_region 6624438..6624500 FT /rpt_family="MER1_type" FT misc_feature 6624515..6624518 FT /note="match to EST H11704 (NID:g876524) ym12g07.r1" FT misc_feature 6624647..6624840 FT /note="match to EST BE762990 (NID:g10192914)" FT misc_feature 6624647..6624864 FT /note="match to EST AA161263 (NID:g1735714) zq41e11.r1" FT misc_feature 6624647..6624891 FT /note="match to EST AL519839 (NID:g12783332)" FT /note="match to EST AA604374 (NID:g2445283) no87e01.s1" FT /note="similar to Homo sapiens EST AL577168 FT (NID:g12940033)" FT /note="match to EST AL563527 (NID:g12913008)" FT /note="match to EST AV712240 (NID:g10731546)" FT /note="match to EST BE907873 (NID:g10401877)" FT /note="match to EST AL519840 (NID:g12783333)" FT /note="match to EST BE544763 (NID:g9773408)" FT misc_feature 6624647..6624771 FT /note="similar to Sus scrofa EST BE013132 (NID:g8274085)" FT /note="match to EST BG546775 (NID:g13545440)" FT misc_feature 6624647..6624780 FT /note="match to EST AL554486 (NID:g12895317)" FT misc_feature 6624664..6624891 FT /note="match to EST AI085412 (NID:g3423835) ow81h03.s1" FT misc_feature 6624692..6624891 FT /note="match to EST AA426587 (NID:g2106843) zw03a02.r1" FT misc_feature 6624700..6624891 FT /note="match to EST R09625 (NID:g761548) yf23h07.r1" FT misc_feature 6624707..6624891 FT /note="match to EST AL518390 (NID:g12781883)" FT misc_feature 6624753..6624891 FT /note="match to EST AA524602 (NID:g2265530) nh34b11.s1" FT misc_feature 6624832..6624833 FT /note="match to EST BG546775 (NID:g13545440)" FT misc_feature 6624868..6624891 FT /note="match to EST AA216343 (NID:g1816308) nc10b09.s1" FT misc_feature 6624876..6624891 FT /note="match to EST AI955333 (NID:g5747643) wx32h01.x1" FT repeat_region 6624977..6625153 FT /rpt_family="Alu" FT repeat_region 6625154..6625453 FT /rpt_family="Alu" FT repeat_region 6625500..6625806 FT /rpt_family="Alu" FT repeat_region 6625807..6626107 FT /rpt_family="L1" FT repeat_region 6626108..6626405 FT /rpt_family="Alu" FT repeat_region 6626406..6626679 FT /rpt_family="L1" FT repeat_region 6626680..6626836 FT /rpt_family="Alu" FT repeat_region 6627217..6627366 FT /rpt_family="L1" FT repeat_region 6627369..6627486 FT /rpt_family="Alu" FT repeat_region 6627485..6627513 FT /rpt_family="(TTTA)n" FT repeat_region 6627491..6627794 FT /rpt_family="Alu" FT misc_feature 6627920..6628390 FT /note="match to EST AI400292 (NID:g4243379) tg43d01.x1" FT misc_feature 6627923..6628125 FT /note="match to EST AI701777 (NID:g4989677) we81g02.x1" FT misc_feature 6628027..6628084 FT /note="match to EST BE544763 (NID:g9773408)" FT misc_feature 6628248..6628607 FT /note="match to EST BE907873 (NID:g10401877)" FT misc_feature 6628248..6628356 FT /note="match to EST AV712240 (NID:g10731546)" FT misc_feature 6628248..6628610 FT /note="match to EST AI085412 (NID:g3423835) ow81h03.s1" FT misc_feature 6628248..6628595 FT /note="match to EST AL519839 (NID:g12783332)" FT misc_feature 6628248..6628557 FT /note="match to EST AA604374 (NID:g2445283) no87e01.s1" FT misc_feature 6628248..6628514 FT /note="similar to Homo sapiens EST AL577168 FT (NID:g12940033)" FT misc_feature 6628248..6628413 FT /note="match to EST AL563527 (NID:g12913008)" FT misc_feature 6628248..6628549 FT /note="match to EST AA216343 (NID:g1816308) nc10b09.s1" FT misc_feature 6628248..6628471 FT /note="match to EST AA524602 (NID:g2265530) nh34b11.s1" FT misc_feature 6628248..6628613 FT /note="match to EST AI955333 (NID:g5747643) wx32h01.x1" FT /note="match to EST AL518390 (NID:g12781883)" FT misc_feature 6628248..6628460 FT /note="match to EST R09625 (NID:g761548) yf23h07.r1" FT misc_feature 6628248..6628308 FT /note="match to EST AA426587 (NID:g2106843) zw03a02.r1" FT misc_feature 6628248..6628625 FT /note="match to EST AL519840 (NID:g12783333)" FT misc_feature 6628326..6628605 FT /note="match to EST AA969047 (NID:g3144227) op43e01.s1" FT misc_feature 6628389..6628608 FT /note="match to EST AI740665 (NID:g5108953) wg07b05.x1" FT misc_feature 6628553..6629083 FT /note="match to EST AW511161 (NID:g7149239) hd22b08.x1" FT misc_feature 6628558..6628870 FT /note="match to EST AI027675 (NID:g3245114) ov83h11.x1" FT misc_feature 6628574..6628720 FT /note="match to EST AA077113 (NID:g1836587)" FT misc_feature 6628714..6629518 FT /note="match to EST BG721740 (NID:g14000927)" FT misc_feature 6629329..6630235 FT /note="CpG_island (%GC=74.8, o/e=0.80, #CpGs=117)" FT misc_feature 6629403..6629870 FT /note="match to EST AI916793 (NID:g5636648) wb26f07.x1" FT misc_feature 6629577 FT /note="match to EST AW250508 (NID:g6593501)" FT misc_feature 6629689..6630098 FT /note="similar to Mus musculus EST AI448356 (NID:g4281982) FT mo65a03.x1" FT misc_feature 6629706..6629893 FT /note="match to EST BF221609 (NID:g11128786)" FT misc_feature 6629765..6630106 FT /note="match to EST AW250508 (NID:g6593501)" FT misc_feature 6629830 FT /note="match to EST BG721740 (NID:g14000927)" FT repeat_region 6629888..6629911 FT /rpt_family="GC_rich" FT misc_feature 6629946..6630106 FT /note="match to EST AW268624 (NID:g6655654) xv41e06.x1" FT misc_feature 6629980..6630106 FT /note="match to EST AA972415 (NID:g3147705) op78a12.s1" FT misc_feature 6630053..6630106 FT /note="similar to Mus musculus EST AA024322 (NID:g1488742) FT mh93f03.r1" FT misc_feature 6630096..6630106 FT /note="match to EST AA077748 (NID:g1837432)" FT repeat_region 6630130..6630158 FT /rpt_family="GC_rich" FT repeat_region 6630449..6630486 FT /rpt_family="T-rich" FT repeat_region 6630455..6630765 FT /rpt_family="Alu" FT misc_feature 6630515..6630520 FT /note="match to EST BF204030 (NID:g11097616)" FT repeat_region 6630887..6631192 FT /rpt_family="Alu" FT repeat_region 6630894..6630916 FT /rpt_family="(T)n" FT misc_feature 6631082..6631083 FT /note="match to EST BE299998 (NID:g9183746)" FT misc_feature 6631277..6631486 FT /note="match to EST AA972415 (NID:g3147705) op78a12.s1" FT misc_feature 6631277..6631498 FT /note="similar to Mus musculus EST AA024322 (NID:g1488742) FT mh93f03.r1" FT /note="match to EST AA077748 (NID:g1837432)" FT /note="match to EST AW268624 (NID:g6655654) xv41e06.x1" FT misc_feature 6631334..6631409 FT /note="match to EST AW250508 (NID:g6593501)" FT misc_feature 6631337..6631498 FT /note="match to EST BF204030 (NID:g11097616)" FT misc_feature 6631361..6631498 FT /note="match to EST BE299998 (NID:g9183746)" FT misc_feature 6631364..6631498 FT /note="similar to Mus musculus EST W61961 (NID:g1368720) FT md55g10.r1" FT misc_feature 6631366..6631498 FT /note="match to EST AA078033 (NID:g1837507)" FT misc_feature 6631436..6631498 FT /note="match to EST BF769829 (NID:g12117729)" FT misc_feature 6631453..6631498 FT /note="similar to Rattus norvegicus EST BF559296 FT (NID:g11669026)" FT repeat_region 6631521..6631813 FT /rpt_family="Alu" FT repeat_region 6631915..6632207 FT /rpt_family="Alu" FT repeat_region 6632231..6632257 FT /rpt_family="(T)n" FT repeat_region 6632752..6632954 FT /rpt_family="MER1_type" FT repeat_region 6632961..6633262 FT /rpt_family="Alu" FT repeat_region 6633273..6633580 FT /rpt_family="Alu" FT repeat_region 6633633..6633656 FT /rpt_family="(T)n" FT misc_feature 6634066..6634225 FT /note="match to EST AA078033 (NID:g1837507)" FT misc_feature 6634066..6634231 FT /note="similar to Rattus norvegicus EST BF559296 FT (NID:g11669026)" FT /note="match to EST BF769829 (NID:g12117729)" FT /note="similar to Mus musculus EST AA024322 (NID:g1488742) FT mh93f03.r1" FT /note="match to EST BE299998 (NID:g9183746)" FT /note="match to EST BF204030 (NID:g11097616)" FT misc_feature 6634066..6634083 FT /note="match to EST AA077748 (NID:g1837432)" FT misc_feature 6634066..6634185 FT /note="match to EST AW268624 (NID:g6655654) xv41e06.x1" FT misc_feature 6634088..6634231 FT /note="match to EST R14639 (NID:g768912) yg45e01.r1" FT misc_feature 6634140..6634231 FT /note="match to EST BG027652 (NID:g12416675)" FT repeat_region 6634351..6634375 FT /rpt_family="AT_rich" FT repeat_region 6634355..6634658 FT /rpt_family="Alu" FT repeat_region 6634662..6634958 FT /rpt_family="Alu" FT repeat_region 6634962..6635093 FT /rpt_family="Alu" FT repeat_region 6635302..6635480 FT /rpt_family="Alu" FT repeat_region 6635679..6635983 FT /rpt_family="Alu" FT repeat_region 6636008..6636027 FT /rpt_family="(T)n" FT repeat_region 6636404..6636704 FT /rpt_family="Alu" FT repeat_region 6636924..6637224 FT /rpt_family="Alu" FT repeat_region 6637819..6638116 FT /rpt_family="Alu" FT misc_feature 6638097..6638116 FT /note="match to EST AL519840 (NID:g12783333)" FT repeat_region 6638367..6638417 FT /rpt_family="(TG)n" FT repeat_region 6638419..6638705 FT /rpt_family="Alu" FT misc_feature 6638679..6639100 FT /note="match to EST BF855242 (NID:g12242986)" FT misc_feature 6638722..6639077 FT /note="match to EST BF869934 (NID:g12260064)" FT repeat_region 6638729..6638876 FT /rpt_family="MIR" FT repeat_region 6639207..6639331 FT /rpt_family="L2" FT misc_feature 6639457..6639778 FT /note="similar to Mus musculus EST W83694 (NID:g1540987) FT mf32e05.r1" FT misc_feature 6639460..6639519 FT /note="similar to Rattus norvegicus EST BF559296 FT (NID:g11669026)" FT misc_feature 6639460..6639778 FT /note="similar to Mus musculus EST W61961 (NID:g1368720) FT md55g10.r1" FT misc_feature 6639460..6639677 FT /note="match to EST BF769829 (NID:g12117729)" FT misc_feature 6639460..6639942 FT /note="match to EST BG027652 (NID:g12416675)" FT misc_feature 6639460..6639698 FT /note="match to EST R14639 (NID:g768912) yg45e01.r1" FT misc_feature 6639460..6639932 FT /note="match to EST BE299998 (NID:g9183746)" FT misc_feature 6639460..6639590 FT /note="match to EST BF204030 (NID:g11097616)" FT misc_feature 6639461..6639894 FT /note="match to EST AA164280 (NID:g1741227) zq46h04.s1" FT misc_feature 6639520..6639849 FT /note="match to EST Z43987 (NID:g573105)" FT misc_feature 6639561..6639987 FT /note="match to EST BF341285 (NID:g11287776)" FT misc_feature 6639613..6639987 FT /note="match to EST AW835273 (NID:g7929247)" FT misc_feature 6639743..6639987 FT /note="match to EST BG113919 (NID:g12607425)" FT misc_feature 6639750..6639893 FT /note="match to EST AW796844 (NID:g7848714)" FT misc_feature 6639774..6639987 FT /note="match to EST BE733654 (NID:g10147646)" FT misc_feature 6639831..6639987 FT /note="match to EST BF342202 (NID:g11289066)" FT /note="match to EST AA077654 (NID:g1837128)" FT misc_feature 6639921..6639956 FT /note="match to EST BE300101 (NID:g9183849)" FT repeat_region 6640270..6640306 FT /rpt_family="AT_rich" FT repeat_region 6640277..6640562 FT /rpt_family="Alu" FT repeat_region 6640564..6640614 FT /rpt_family="T-rich" FT repeat_region 6640585..6640878 FT /rpt_family="Alu" FT misc_feature 6640690..6640694 FT /note="match to EST AW796844 (NID:g7848714)" FT repeat_region 6640913..6640944 FT /rpt_family="AT_rich" FT repeat_region 6640917..6641225 FT /rpt_family="Alu" FT misc_feature 6640948..6641054 FT /note="match to EST AA077654 (NID:g1837128)" FT repeat_region 6641275..6641304 FT /rpt_family="(T)n" FT repeat_region 6641276..6641587 FT /rpt_family="Alu" FT misc_feature 6641732..6641890 FT /note="match to EST AW835273 (NID:g7929247)" FT misc_feature 6641732..6641771 FT /note="match to EST BF342202 (NID:g11289066)" FT /note="match to EST BE733654 (NID:g10147646)" FT /note="match to EST BG113919 (NID:g12607425)" FT /note="match to EST BF341285 (NID:g11287776)" FT misc_feature 6641916..6642180 FT /note="match to EST BF858314 (NID:g12246058)" FT repeat_region 6642172..6642313 FT /rpt_family="MIR" FT misc_feature 6642295..6642383 FT /note="match to EST BF342202 (NID:g11289066)" FT repeat_region 6642383..6642591 FT /rpt_family="MIR" FT repeat_region 6642603..6642896 FT /rpt_family="Alu" FT repeat_region 6642897..6643190 FT /rpt_family="Alu" FT repeat_region 6643191..6643481 FT /rpt_family="Alu" FT repeat_region 6643482..6643653 FT /rpt_family="Alu" FT repeat_region 6643714..6643883 FT /rpt_family="Alu" FT repeat_region 6643920..6644034 FT /rpt_family="L1" FT repeat_region 6644603..6644641 FT /rpt_family="T-rich" FT repeat_region 6644612..6644918 FT /rpt_family="Alu" FT repeat_region 6645328..6645628 FT /rpt_family="Alu" FT repeat_region 6646327..6646628 FT /rpt_family="Alu" FT misc_feature 6646885..6647956 FT /note="CpG_island (%GC=69.8, o/e=0.80, #CpGs=87)" FT misc_feature 6647168..6647228 FT /note="match to EST BF342202 (NID:g11289066)" FT /note="match to EST BG113919 (NID:g12607425)" FT misc_feature 6647552..6647962 FT /note="similar to Sus scrofa EST BF080099 (NID:g10873929)" FT misc_feature 6647591..6647701 FT /note="match to EST BF342202 (NID:g11289066)" FT misc_feature 6647591..6647717 FT /note="match to EST BE733654 (NID:g10147646)" FT misc_feature 6647591..6647662 FT /note="match to EST BG113919 (NID:g12607425)" FT misc_feature 6647591..6647669 FT /note="match to EST BF341285 (NID:g11287776)" FT misc_feature 6647595..6647647 FT /note="match to EST BG027652 (NID:g12416675)" FT misc_feature 6647621..6648300 FT /note="match to EST BE300101 (NID:g9183849)" FT misc_feature 6647668..6648261 FT /note="similar to Homo sapiens EST AL561564 FT (NID:g12909119)" FT misc_feature 6647705..6648353 FT /note="match to EST AL561591 (NID:g12909172)" FT misc_feature 6647707..6648121 FT /note="match to EST AI193738 (NID:g3744947) qe73h03.x1" FT misc_feature 6647896..6648359 FT /note="match to EST AA845108 (NID:g2931559) ak58e07.s1" FT misc_feature 6647916..6648356 FT /note="match to EST D52963 (NID:g954860)" FT misc_feature 6647916..6648125 FT /note="match to EST C15102 (NID:g1569809)" FT misc_feature 6648092..6648356 FT /note="match to EST D52962 (NID:g954859)" FT misc_feature 6648270..6648355 FT /note="similar to Rattus norvegicus EST BF559296 FT (NID:g11669026)" FT repeat_region 6648433..6648463 FT /rpt_family="(T)n" FT repeat_region 6648866..6649161 FT /rpt_family="Alu" FT repeat_region 6649402..6649696 FT /rpt_family="Alu" FT repeat_region 6649699..6649905 FT /rpt_family="Alu" FT repeat_region 6649913..6650201 FT /rpt_family="Alu" FT repeat_region 6650323..6650350 FT /rpt_family="AT_rich" FT repeat_region 6650643..6650713 FT /rpt_family="L1" FT repeat_region 6650735..6650837 FT /rpt_family="Alu" FT repeat_region 6650838..6651133 FT /rpt_family="Alu" FT misc_feature 6651114..6651127 FT /note="match to EST AL561591 (NID:g12909172)" FT misc_feature 6651117..6651127 FT /note="match to EST AL518390 (NID:g12781883)" FT repeat_region 6651134..6651252 FT /rpt_family="Alu" FT repeat_region 6651293..6651434 FT /rpt_family="L1" FT repeat_region 6651532..6651822 FT /rpt_family="Alu" FT repeat_region 6651833..6652136 FT /rpt_family="Alu" FT repeat_region 6652116..6652135 FT /rpt_family="(TAAA)n" FT repeat_region 6652138..6652433 FT /rpt_family="Alu" FT misc_feature 6652686..6652690 FT /note="similar to Homo sapiens EST AL567236 FT (NID:g12920396)" FT repeat_region 6652797..6653120 FT /rpt_family="Alu" FT repeat_region 6652799..6652818 FT /rpt_family="(T)n" FT repeat_region 6652963..6652987 FT /rpt_family="(TA)n" FT repeat_region 6653125..6653267 FT /rpt_family="Alu" FT repeat_region 6653831..6654043 FT /rpt_family="Alu" FT repeat_region 6654047..6654340 FT /rpt_family="Alu" FT misc_feature 6654746..6655860 FT /note="CpG_island (%GC=78.0, o/e=0.80, #CpGs=135)" FT repeat_region 6655119..6655174 FT /rpt_family="(CGG)n" FT repeat_region 6655223..6655326 FT /rpt_family="GC_rich" FT misc_feature 6655253..6655433 FT /note="similar to Homo sapiens EST AL567236 FT (NID:g12920396)" FT repeat_region 6655327..6655350 FT /rpt_family="(CCCCCG)n" FT repeat_region 6655351..6655373 FT /rpt_family="GC_rich" FT misc_feature 6655496..6655811 FT /note="similar to Homo sapiens EST AL567236 FT (NID:g12920396)" FT misc_feature 6655563..6655791 FT /note="match to EST BF934712 (NID:g12352036)" FT misc_feature 6655796..6655817 FT /note="match to EST BF204282 (NID:g11097868)" FT misc_feature 6655929..6655941 FT /note="similar to Homo sapiens EST AL567236 FT (NID:g12920396)" FT repeat_region 6656090..6656401 FT /rpt_family="Alu" FT repeat_region 6656369..6656398 FT /rpt_family="AT_rich" FT misc_feature 6656816..6656938 FT /note="match to EST BF204282 (NID:g11097868)" FT misc_feature 6656826..6657073 FT /note="similar to Homo sapiens EST AL567236 FT (NID:g12920396)" FT repeat_region 6657649..6657952 FT /rpt_family="Alu" FT repeat_region 6658058..6658362 FT /rpt_family="Alu" FT repeat_region 6658664..6658688 FT /rpt_family="(T)n" FT misc_feature 6658665..6658686 FT /note="match to EST BF196904 (NID:g11085437)" FT repeat_region 6658891..6658922 FT /rpt_family="(TTTG)n" FT repeat_region 6658892..6659199 FT /rpt_family="Alu" FT repeat_region 6659488..6659566 FT /rpt_family="Alu" FT repeat_region 6660194..6660269 FT /rpt_family="CT-rich" FT repeat_region 6660251..6660543 FT /rpt_family="Alu" FT misc_feature 6660745..6661180 FT /note="match to EST BE207274 (NID:g8750672) ba15b06.y1" FT misc_feature 6660753..6661349 FT /note="match to EST BF204282 (NID:g11097868)" FT misc_feature 6660793..6661085 FT /note="match to EST AI362808 (NID:g4114429) qy80e05.x1" FT repeat_region 6660877..6661010 FT /rpt_family="(CAG)n" FT repeat_region 6661081..6661343 FT /rpt_family="(CAG)n" FT repeat_region 6661373..6661547 FT /rpt_family="(CAG)n" FT misc_feature 6661480..6661499 FT /note="match to EST BG105146 (NID:g12598992)" FT repeat_region 6661617..6661768 FT /rpt_family="(CAG)n" FT misc_feature 6661876..6662695 FT /note="CpG_island (%GC=74.5, o/e=0.80, #CpGs=107)" FT misc_feature 6661945..6662506 FT /note="similar to Homo sapiens EST BE388726 (NID:g9334091)" FT misc_feature 6662108..6662550 FT /note="similar to Mus musculus EST BG277278 (NID:g13072421) FT ux41f07.y1" FT misc_feature 6662370..6662604 FT /note="match to EST AW411483 (NID:g6937024) fh12f01.x1" FT misc_feature 6662653..6662654 FT /note="similar to Homo sapiens EST AL567235 FT (NID:g12920394)" FT misc_feature 6662714..6662981 FT /note="match to EST AA076810 (NID:g1836284)" FT misc_feature 6662842..6663814 FT /note="similar to Homo sapiens EST AL567235 FT (NID:g12920394)" FT misc_feature 6662882..6663631 FT /note="match to EST BF033908 (NID:g10741540)" FT misc_feature 6663122..6663571 FT /note="match to EST AA488226 (NID:g2215657) ad08b09.r1" FT misc_feature 6663256..6663921 FT /note="match to EST BF527438 (NID:g11614801)" FT misc_feature 6663437..6663917 FT /note="match to EST BE220037 (NID:g8907355) hv66c08.x1" FT misc_feature 6663529..6663800 FT /note="match to EST AA503353 (NID:g2238320) nh59d04.s1" FT misc_feature 6663652..6663919 FT /note="match to EST BF437357 (NID:g11449710)" FT repeat_region 6663972..6664103 FT /rpt_family="CT-rich" FT repeat_region 6664082..6664203 FT /rpt_family="Alu" FT repeat_region 6664218..6664378 FT /rpt_family="Alu" FT repeat_region 6664379..6664402 FT /rpt_family="(T)n" FT misc_feature 6664420..6664504 FT /note="match to EST BE147951 (NID:g8610675)" FT repeat_region 6664683..6664743 FT /rpt_family="Alu" FT repeat_region 6664986..6665099 FT /rpt_family="Alu" FT repeat_region 6665268..6665297 FT /rpt_family="(TTCA)n" FT repeat_region 6665308..6665585 FT /rpt_family="Alu" FT repeat_region 6665784..6665927 FT /rpt_family="Alu" FT repeat_region 6665928..6666223 FT /rpt_family="Alu" FT repeat_region 6666224..6666371 FT /rpt_family="Alu" FT repeat_region 6666396..6666530 FT /rpt_family="ERVL" FT repeat_region 6666637..6666916 FT /rpt_family="Alu" FT repeat_region 6667099..6667389 FT /rpt_family="Alu" FT repeat_region 6667448..6667754 FT /rpt_family="Alu" FT repeat_region 6668654..6668843 FT /rpt_family="Alu" FT repeat_region 6668827..6668858 FT /rpt_family="(TTTTTA)n" FT repeat_region 6668844..6669157 FT /rpt_family="Alu" FT misc_feature 6668866..6668924 FT /note="similar to Homo sapiens EST BE147537 (NID:g8610261)" FT repeat_region 6669164..6669188 FT /rpt_family="(T)n" FT repeat_region 6669469..6669607 FT /rpt_family="Alu" FT repeat_region 6670027..6670447 FT /rpt_family="ERV1" FT repeat_region 6670448..6670707 FT /rpt_family="Alu" FT repeat_region 6670714..6670753 FT /rpt_family="MaLR" FT repeat_region 6670754..6671054 FT /rpt_family="Alu" FT repeat_region 6671055..6671418 FT /rpt_family="MaLR" FT misc_feature 6671313..6671317 FT /note="match to EST AA083502 (NID:g1625596) zn09b12.r1" FT repeat_region 6672017..6672319 FT /rpt_family="Alu" FT repeat_region 6672332..6672616 FT /rpt_family="Alu" FT repeat_region 6672619..6672671 FT /rpt_family="Alu" FT repeat_region 6672673..6672756 FT /rpt_family="Alu" FT repeat_region 6672755..6672781 FT /rpt_family="(TTTTA)n" FT repeat_region 6672757..6673064 FT /rpt_family="Alu" FT repeat_region 6673068..6673364 FT /rpt_family="Alu" FT repeat_region 6673365..6673489 FT /rpt_family="Alu" FT misc_feature 6673379..6673413 FT /note="similar to Homo sapiens EST BE148057 (NID:g8610781)" FT repeat_region 6673803..6673896 FT /rpt_family="GA-rich" FT misc_feature 6673858..6673860 FT /note="match to EST AA078058 (NID:g1837532)" FT misc_feature 6674029..6674212 FT /note="match to EST AA078058 (NID:g1837532)" FT repeat_region 6674330..6674405 FT /rpt_family="MaLR" FT repeat_region 6674406..6674705 FT /rpt_family="Alu" FT repeat_region 6674705..6674749 FT /rpt_family="(CCA)n" FT repeat_region 6674706..6675049 FT /rpt_family="MaLR" FT repeat_region 6675257..6675385 FT /rpt_family="MER1_type" FT repeat_region 6675388..6675545 FT /rpt_family="Alu" FT repeat_region 6675762..6676050 FT /rpt_family="Alu" FT misc_feature 6676455..6677551 FT /note="CpG_island (%GC=80.2, o/e=1.00, #CpGs=151)" FT repeat_region 6676790..6676893 FT /rpt_family="C-rich" FT repeat_region 6676910..6676947 FT /rpt_family="GC_rich" FT repeat_region 6677004..6677079 FT /rpt_family="GC_rich" FT repeat_region 6677092..6677228 FT /rpt_family="G-rich" FT misc_feature 6677429..6678025 FT /note="match to EST AW292940 (NID:g6699576)" FT misc_feature 6677926..6678371 FT /note="match to EST BF872006 (NID:g12262136)" FT repeat_region 6678285..6678367 FT /rpt_family="Alu" FT misc_feature 6678577..6678772 FT /note="match to EST AA078156 (NID:g1837630)" FT misc_feature 6678578..6678772 FT /note="match to EST AA077933 (NID:g1837407)" FT misc_feature 6679688..6679917 FT /note="match to EST AA077142 (NID:g1836616)" FT repeat_region 6679831..6679855 FT /rpt_family="MaLR" FT repeat_region 6679856..6680273 FT /rpt_family="MaLR" FT repeat_region 6680274..6680668 FT /rpt_family="MaLR" FT misc_feature 6680800..6681013 FT /note="similar to EST BG954498 (NID:g14372669)" FT misc_feature 6681103..6681313 FT /note="match to EST AA077788 (NID:g1837262)" FT misc_feature 6681456..6681480 FT /note="match to EST AA078156 (NID:g1837630)" FT misc_feature 6681456..6681475 FT /note="match to EST AA077933 (NID:g1837407)" FT misc_feature 6681487..6682039 FT /note="similar to EST BG949010 (NID:g14367181)" FT misc_feature 6681811..6682034 FT /note="similar to EST BG980092 (NID:g14382827)" FT misc_feature 6681887..6682078 FT /note="similar to Homo sapiens EST BF828816 FT (NID:g12173690)" FT repeat_region 6682123..6682294 FT /rpt_family="GA-rich" FT misc_feature 6682190..6682395 FT /note="match to EST AA078492 (NID:g1837966)" FT misc_feature 6682220..6682395 FT /note="match to EST AA077450 (NID:g1836924)" FT /note="match to EST AA077746 (NID:g1837234)" FT misc_feature 6682300..6682395 FT /note="match to EST AA076896 (NID:g1836370)" FT misc_feature 6682595..6682618 FT /note="match to EST AA077450 (NID:g1836924)" FT misc_feature 6682595..6682633 FT /note="match to EST AA078492 (NID:g1837966)" FT misc_feature 6682595..6682666 FT /note="match to EST AA077746 (NID:g1837234)" FT misc_feature 6682595..6682704 FT /note="match to EST AA076896 (NID:g1836370)" FT repeat_region 6682641..6682679 FT /rpt_family="(GGA)n" FT misc_feature 6682671..6682704 FT /note="similar to Homo sapiens EST BF327084 FT (NID:g11297832)" FT misc_feature 6682681..6682704 FT /note="match to EST BF348138 (NID:g11295733)" FT misc_feature 6682683..6682704 FT /note="match to EST BF842559 (NID:g12196494)" FT misc_feature 6683006..6683010 FT /note="similar to Homo sapiens EST BF805417 FT (NID:g12134406)" FT misc_feature 6683057..6683381 FT /note="match to EST AA083502 (NID:g1625596) zn09b12.r1" FT misc_feature 6683453..6683579 FT /note="match to EST BF348138 (NID:g11295733)" FT /note="match to EST BF842559 (NID:g12196494)" FT /note="similar to Homo sapiens EST BF327084 FT (NID:g11297832)" FT misc_feature 6683453..6683499 FT /note="match to EST AA076896 (NID:g1836370)" FT misc_feature 6683581..6683996 FT /note="match to EST AA720845 (NID:g2736980) nw08d08.s1" FT misc_feature 6683684..6683687 FT /note="match to EST AA083502 (NID:g1625596) zn09b12.r1" FT misc_feature 6684111..6684224 FT /note="match to EST BF842559 (NID:g12196494)" FT /note="match to EST BF348138 (NID:g11295733)" FT misc_feature 6684111..6684230 FT /note="similar to Homo sapiens EST BF327084 FT (NID:g11297832)" FT misc_feature 6684687..6685073 FT /note="match to EST AA083503 (NID:g1625597) zn09b12.s1" FT repeat_region 6685033..6685342 FT /rpt_family="Alu" FT repeat_region 6685315..6685344 FT /rpt_family="AT_rich" FT repeat_region 6685345..6685645 FT /rpt_family="Alu" FT repeat_region 6685625..6685645 FT /rpt_family="(A)n" FT repeat_region 6685646..6685801 FT /rpt_family="MaLR" FT repeat_region 6686606..6686715 FT /rpt_family="L2" FT misc_feature 6688140..6688587 FT /note="similar to EST BI001435 (NID:g14405509)" FT repeat_region 6688178..6688320 FT /rpt_family="MIR" FT misc_feature 6689974..6690403 FT /note="match to EST AW471195 (NID:g7041301) xv13d07.x1" FT repeat_region 6690699..6691003 FT /rpt_family="Alu" FT repeat_region 6690822..6690845 FT /rpt_family="(CAT)n" FT repeat_region 6691004..6691233 FT /rpt_family="Alu" FT repeat_region 6691237..6691410 FT /rpt_family="Alu" FT misc_feature 6691931..6692619 FT /note="match to EST BE857979 (NID:g10372545)" FT misc_feature 6691934..6692517 FT /note="match to EST BF348138 (NID:g11295733)" FT misc_feature 6691934..6692048 FT /note="match to EST BF842559 (NID:g12196494)" FT misc_feature 6691937..6692013 FT /note="similar to Homo sapiens EST BF327084 FT (NID:g11297832)" FT misc_feature 6691949..6695242 FT /note="CpG_island (%GC=71.8, o/e=0.90, #CpGs=404)" FT misc_feature 6692120..6692394 FT /note="match to EST BE246610 (NID:g9098359)" FT misc_feature 6692240..6692573 FT /note="similar to Homo sapiens EST AW131104 (NID:g6132711) FT xf57f11.x1" FT misc_feature 6692335..6692796 FT /note="similar to Mus musculus EST BF150100 (NID:g11031495) FT uy81g10.y1" FT repeat_region 6692772..6692818 FT /rpt_family="GC_rich" FT misc_feature 6692829..6693012 FT /note="match to EST AI685357 (NID:g4896651) wa76f05.x1" FT misc_feature 6692929..6693381 FT /note="similar to Mus musculus EST AW125535 (NID:g6101065)" FT repeat_region 6693111..6693145 FT /rpt_family="GC_rich" FT repeat_region 6693186..6693228 FT /rpt_family="GC_rich" FT misc_feature 6693399..6693822 FT /note="similar to Mus musculus EST BE571474 (NID:g9815194)" FT misc_feature 6693819..6694062 FT /note="similar to Mus musculus EST AI849727 (NID:g5493633)" FT misc_feature 6693819..6694244 FT /note="similar to Mus musculus EST BE950655 FT (NID:g10589321)" FT /note="similar to Mus musculus EST AI851156 (NID:g5495027)" FT misc_feature 6694099..6694587 FT /note="match to EST BE674951 (NID:g10035492)" FT misc_feature 6694100..6694362 FT /note="match to EST BF515999 (NID:g11601178)" FT misc_feature 6694183..6694519 FT /note="similar to Homo sapiens EST AA761318 (NID:g2810248) FT nz21c11.s1" FT misc_feature 6694580 FT /note="similar to Homo sapiens EST BE076600 (NID:g8426581)" FT misc_feature 6694598..6694814 FT /note="similar to Homo sapiens EST BE076600 (NID:g8426581)" FT misc_feature 6694604..6695261 FT /note="match to EST AW968297 (NID:g8158032)" FT misc_feature 6694604..6695117 FT /note="match to EST BF344441 (NID:g11291741)" FT misc_feature 6694636..6695328 FT /note="match to EST BF983851 (NID:g12386663)" FT misc_feature 6694691..6694915 FT /note="match to EST AA077725 (NID:g1837199)" FT misc_feature 6694807..6695258 FT /note="match to EST AA258948 (NID:g1894073) zs34a09.r1" FT misc_feature 6694841..6695159 FT /note="similar to Homo sapiens EST BE162625 (NID:g8625346)" FT misc_feature 6694873..6695750 FT /note="similar to EST BG750379 (NID:g14061032)" FT misc_feature 6694874..6695377 FT /note="match to EST R53645 (NID:g815547) yg84b05.r1" FT misc_feature 6694875..6695117 FT /note="match to EST BF344324 (NID:g11291538)" FT misc_feature 6695033..6695035 FT /note="match to EST BF508762 (NID:g11592060)" FT misc_feature 6695039..6695426 FT /note="match to EST BF808996 (NID:g12137985)" FT misc_feature 6695099..6695657 FT /note="match to EST AA469981 (NID:g2197290) zu10a06.r1" FT misc_feature 6695159..6695715 FT /note="similar to Homo sapiens EST BF805417 FT (NID:g12134406)" FT misc_feature 6695340..6695772 FT /note="match to EST BE048211 (NID:g8365189) tz47d04.y1" FT misc_feature 6695396..6696063 FT /note="match to EST BF338409 (NID:g11284811)" FT misc_feature 6695503..6696063 FT /note="match to EST BE675975 (NID:g10036516)" FT misc_feature 6695536..6695841 FT /note="match to EST AA922614 (NID:g3069923) oh89h06.s1" FT misc_feature 6695589..6695900 FT /note="match to EST AI393054 (NID:g4222601) tg25d04.x1" FT misc_feature 6695728..6695730 FT /note="match to EST AA469981 (NID:g2197290) zu10a06.r1" FT misc_feature 6695753..6696062 FT /note="match to EST AI223814 (NID:g3806527) qi33c10.x1" FT misc_feature 6695851..6696033 FT /note="match to EST AI685357 (NID:g4896651) wa76f05.x1" FT misc_feature 6695858..6696061 FT /note="match to EST AA365454 (NID:g2017774)" FT misc_feature 6695976..6696063 FT /note="match to EST AI393054 (NID:g4222601) tg25d04.x1" FT misc_feature 6696261..6696501 FT /note="match to EST AA077911 (NID:g1837385)" FT misc_feature 6696363..6696367 FT /note="similar to Homo sapiens EST AW371883 (NID:g6876537)" FT misc_feature 6696493..6696948 FT /note="match to EST BG396956 (NID:g13290404)" FT repeat_region 6696663..6696923 FT /rpt_family="Alu" FT misc_feature 6696882..6696902 FT /note="similar to Homo sapiens EST BE799618 FT (NID:g10220816)" FT repeat_region 6696943..6696969 FT /rpt_family="(A)n" FT misc_feature 6696945..6696963 FT /note="match to EST AI393054 (NID:g4222601) tg25d04.x1" FT repeat_region 6696970..6697089 FT /rpt_family="Alu" FT repeat_region 6697180..6697488 FT /rpt_family="Alu" FT misc_feature 6697447..6697452 FT /note="match to EST BF170340 (NID:g13436554)" FT misc_feature 6697462..6697911 FT /note="match to EST BF508762 (NID:g11592060)" FT repeat_region 6697463..6697488 FT /rpt_family="(A)n" FT repeat_region 6697949..6698205 FT /rpt_family="Alu" FT repeat_region 6698853..6698981 FT /rpt_family="MIR" FT repeat_region 6699235..6699518 FT /rpt_family="MaLR" FT repeat_region 6699519..6699814 FT /rpt_family="Alu" FT repeat_region 6699792..6699814 FT /rpt_family="(A)n" FT repeat_region 6699815..6699950 FT /rpt_family="MaLR" FT misc_feature 6699943..6700041 FT /note="similar to Homo sapiens EST AA854120 (NID:g2941658) FT aj71b09.s1" FT misc_feature 6699944..6700041 FT /note="similar to Homo sapiens EST AV717645 FT (NID:g10814797)" FT repeat_region 6700069..6700346 FT /rpt_family="Alu" FT misc_feature 6700348..6700541 FT /note="similar to Homo sapiens EST AA854120 (NID:g2941658) FT aj71b09.s1" FT /note="similar to Homo sapiens EST AV717645 FT (NID:g10814797)" FT misc_feature 6700352..6700541 FT /note="similar to Homo sapiens EST BG272935 FT (NID:g12982588)" FT /note="similar to Homo sapiens EST AW241640 (NID:g6575394) FT xm77e12.x1" FT repeat_region 6700556..6700830 FT /rpt_family="Alu" FT repeat_region 6700880..6700977 FT /rpt_family="L1" FT repeat_region 6701005..6701169 FT /rpt_family="L1" FT misc_feature 6701030..6701034 FT /note="match to EST AW856494 (NID:g7952187)" FT repeat_region 6701248..6701517 FT /rpt_family="Alu" FT repeat_region 6701520..6701618 FT /rpt_family="MaLR" FT repeat_region 6701691..6701884 FT /rpt_family="MaLR" FT repeat_region 6701977..6702279 FT /rpt_family="Alu" FT repeat_region 6702282..6702306 FT /rpt_family="(T)n" FT repeat_region 6702591..6702770 FT /rpt_family="L2" FT repeat_region 6702879..6703161 FT /rpt_family="Alu" FT repeat_region 6703216..6703278 FT /rpt_family="G-rich" FT repeat_region 6703294..6703473 FT /rpt_family="G-rich" FT repeat_region 6704335..6704426 FT /rpt_family="Alu" FT repeat_region 6704932..6705227 FT /rpt_family="Alu" FT misc_feature 6705012..6705018 FT /note="similar to Homo sapiens EST BG431402 FT (NID:g13337908)" FT misc_feature 6705603..6705615 FT /note="similar to Homo sapiens EST AL042806 (NID:g5422249)" FT repeat_region 6705605..6705769 FT /rpt_family="Alu" FT repeat_region 6705770..6706062 FT /rpt_family="Alu" FT repeat_region 6706063..6706197 FT /rpt_family="Alu" FT repeat_region 6706245..6706739 FT /rpt_family="L1" FT repeat_region 6707105..6707211 FT /rpt_family="ERV1" FT repeat_region 6707212..6707512 FT /rpt_family="Alu" FT misc_feature 6707277..6707317 FT /note="similar to Homo sapiens EST BF934190 FT (NID:g12351514)" FT repeat_region 6707513..6707627 FT /rpt_family="ERV1" FT repeat_region 6707631..6707656 FT /rpt_family="L1" FT repeat_region 6707657..6707862 FT /rpt_family="Alu" FT repeat_region 6707863..6708646 FT /rpt_family="L1" FT repeat_region 6708657..6708963 FT /rpt_family="L1" FT repeat_region 6708964..6709262 FT /rpt_family="Alu" FT repeat_region 6709263..6709278 FT /rpt_family="L1" FT repeat_region 6709864..6709886 FT /rpt_family="(T)n" FT repeat_region 6709867..6710854 FT /rpt_family="SVA" FT misc_feature 6710427..6711953 FT /note="CpG_island (%GC=73.4, o/e=0.80, #CpGs=121)" FT repeat_region 6710872..6712087 FT /rpt_family="SVA" FT repeat_region 6712036..6712087 FT /rpt_family="GA-rich" FT repeat_region 6712089..6712389 FT /rpt_family="Alu" FT misc_feature 6713916..6713971 FT /note="similar to Homo sapiens EST AV724641 FT (NID:g10829230)" FT misc_feature 6713922..6713986 FT /note="similar to Homo sapiens EST BG435830 FT (NID:g13342336)" FT repeat_region 6714143..6714446 FT /rpt_family="Alu" FT repeat_region 6714424..6714446 FT /rpt_family="(A)n" FT misc_feature 6714445..6714708 FT /note="similar to Homo sapiens EST BG482615 FT (NID:g13414894)" FT misc_feature 6714483..6714530 FT /note="similar to Homo sapiens EST BG435830 FT (NID:g13342336)" FT misc_feature 6714674..6714706 FT /note="similar to Homo sapiens EST AW610214 (NID:g7314955)" FT misc_feature 6714676..6714710 FT /note="similar to Homo sapiens EST AV724641 FT (NID:g10829230)" FT misc_feature 6714687..6714704 FT /note="similar to Homo sapiens EST BG435830 FT (NID:g13342336)" FT misc_feature 6714900..6714916 FT /note="similar to Homo sapiens EST BG482615 FT (NID:g13414894)" FT misc_feature 6714934..6714960 FT /note="similar to Homo sapiens EST BG435830 FT (NID:g13342336)" FT repeat_region 6714962..6714986 FT /rpt_family="AT_rich" FT misc_feature 6714988..6715014 FT /note="match to EST BE277344 (NID:g9152312)" FT misc_feature 6715295..6715458 FT /note="similar to Homo sapiens EST AU124182 FT (NID:g10948898)" FT misc_feature 6715304..6715446 FT /note="similar to Homo sapiens EST AW610214 (NID:g7314955)" FT misc_feature 6715344..6715512 FT /note="similar to Homo sapiens EST BG435830 FT (NID:g13342336)" FT misc_feature 6715533..6715543 FT /note="similar to Homo sapiens EST AW610214 (NID:g7314955)" FT misc_feature 6715619..6715743 FT /note="similar to Homo sapiens EST BF541624 FT (NID:g11629005)" FT misc_feature 6715624..6715657 FT /note="similar to Homo sapiens EST AV724641 FT (NID:g10829230)" FT misc_feature 6715624..6715638 FT /note="similar to Homo sapiens EST BG435830 FT (NID:g13342336)" FT misc_feature 6715626..6715647 FT /note="similar to Homo sapiens EST AU124182 FT (NID:g10948898)" FT misc_feature 6715626..6715651 FT /note="similar to Homo sapiens EST AW610214 (NID:g7314955)" FT misc_feature 6715630..6715664 FT /note="similar to Homo sapiens EST BG482615 FT (NID:g13414894)" FT misc_feature 6715697..6716132 FT /note="match to EST BE161479 (NID:g8624200)" FT misc_feature 6715711..6715756 FT /note="similar to Homo sapiens EST AV724641 FT (NID:g10829230)" FT misc_feature 6715720..6715754 FT /note="similar to Homo sapiens EST BG435830 FT (NID:g13342336)" FT misc_feature 6715729..6715736 FT /note="similar to Homo sapiens EST AU124182 FT (NID:g10948898)" FT misc_feature 6715832..6715988 FT /note="similar to Homo sapiens EST BF541624 FT (NID:g11629005)" FT misc_feature 6715837..6715855 FT /note="similar to Homo sapiens EST AU124182 FT (NID:g10948898)" FT misc_feature 6715926..6715975 FT /note="similar to Homo sapiens EST AV724641 FT (NID:g10829230)" FT misc_feature 6715935..6715983 FT /note="similar to Homo sapiens EST AW610214 (NID:g7314955)" FT misc_feature 6715941..6716118 FT /note="similar to Homo sapiens EST AU124182 FT (NID:g10948898)" FT repeat_region 6716245..6716556 FT /rpt_family="Alu" FT misc_feature 6716256..6716298 FT /note="similar to Homo sapiens EST BE147985 (NID:g8610709)" FT misc_feature 6716353..6716354 FT /note="match to EST BE161479 (NID:g8624200)" FT misc_feature 6716368..6716387 FT /note="similar to Homo sapiens EST AW363264 (NID:g6867914)" FT repeat_region 6716832..6717121 FT /rpt_family="Alu" FT misc_feature 6717025..6717394 FT /note="match to EST BF907743 (NID:g12299201)" FT repeat_region 6717466..6717773 FT /rpt_family="Alu" FT repeat_region 6717915..6717996 FT /rpt_family="(TA)n" FT repeat_region 6717978..6718111 FT /rpt_family="Alu" FT repeat_region 6718113..6718140 FT /rpt_family="AT_rich" FT repeat_region 6718209..6718323 FT /rpt_family="L1" FT repeat_region 6718536..6718819 FT /rpt_family="Alu" FT repeat_region 6718864..6719061 FT /rpt_family="L1" FT repeat_region 6719236..6719534 FT /rpt_family="Alu" FT misc_feature 6719493..6719511 FT /note="similar to Homo sapiens EST AW578524 (NID:g7253586)" FT repeat_region 6719864..6719986 FT /rpt_family="MaLR" FT repeat_region 6720046..6720217 FT /rpt_family="MaLR" FT repeat_region 6720226..6720336 FT /rpt_family="Alu" FT repeat_region 6720472..6720534 FT /rpt_family="MER2_type" FT repeat_region 6720551..6720744 FT /rpt_family="MER2_type" FT repeat_region 6720987..6721019 FT /rpt_family="AT_rich" FT repeat_region 6720995..6721310 FT /rpt_family="Alu" FT repeat_region 6721170..6721192 FT /rpt_family="AT_rich" FT repeat_region 6721662..6721966 FT /rpt_family="MER2_type" FT misc_feature 6721988..6722473 FT /note="match to EST BF913176 (NID:g12304738)" FT misc_feature 6722091..6722218 FT /note="match to EST BF353005 (NID:g11312079)" FT repeat_region 6722973..6723048 FT /rpt_family="MaLR" FT repeat_region 6723056..6723282 FT /rpt_family="Alu" FT repeat_region 6723090..6723121 FT /rpt_family="(A)n" FT repeat_region 6723576..6723858 FT /rpt_family="Alu" FT repeat_region 6723910..6724252 FT /rpt_family="MaLR" FT repeat_region 6724623..6724931 FT /rpt_family="Alu" FT misc_feature 6724674..6724681 FT /note="similar to Homo sapiens EST AU124182 FT (NID:g10948898)" FT repeat_region 6725007..6725032 FT /rpt_family="(A)n" FT repeat_region 6725066..6725235 FT /rpt_family="L1" FT repeat_region 6725240..6725545 FT /rpt_family="Alu" FT repeat_region 6725516..6725555 FT /rpt_family="(A)n" FT repeat_region 6725743..6725766 FT /rpt_family="(T)n" FT misc_feature 6725757..6725811 FT /note="similar to Homo sapiens EST BF830104 FT (NID:g12176392)" FT repeat_region 6726453..6726744 FT /rpt_family="Alu" FT repeat_region 6727103..6727415 FT /rpt_family="Alu" FT repeat_region 6727389..6727427 FT /rpt_family="(CAAA)n" FT misc_feature 6728064..6728448 FT /note="match to EST H01882 (NID:g864815) yj32c12.s1" FT misc_feature 6728064..6728739 FT /note="match to EST AI865669 (NID:g5529776) wk49e05.x1" FT misc_feature 6728067..6728351 FT /note="match to EST AI915837 (NID:g5635692) wg94e10.x1" FT misc_feature 6728068..6728752 FT /note="match to EST BG026666 (NID:g12414510)" FT misc_feature 6728069..6728556 FT /note="match to EST BF196904 (NID:g11085437)" FT misc_feature 6728190..6728497 FT /note="match to EST BE708120 (NID:g10096385)" FT misc_feature 6728317..6728321 FT /note="match to EST AW815913 (NID:g7908907)" FT misc_feature 6728366..6729152 FT /note="similar to EST BG679385 (NID:g13910782)" FT misc_feature 6728454..6728883 FT /note="match to EST AW957496 (NID:g8147074)" FT misc_feature 6728563..6728853 FT /note="match to EST BE008167 (NID:g8268400)" FT repeat_region 6728724..6729152 FT /rpt_family="MaLR" FT misc_feature 6728788..6729287 FT /note="match to EST W95181 (NID:g1425089) ze03d09.r1" FT misc_feature 6728987..6729347 FT /note="match to EST R24868 (NID:g779756) yg29h01.r1" FT misc_feature 6729024..6729512 FT /note="match to EST AI951631 (NID:g5743941) wv37e11.x1" FT misc_feature 6729066..6729716 FT /note="match to EST BE779447 (NID:g10200645)" FT misc_feature 6729359..6729814 FT /note="match to EST T74228 (NID:g690903) yc83f12.r1" FT misc_feature 6729537..6729800 FT /note="similar to Homo sapiens EST F12490 (NID:g708483)" FT misc_feature 6729698..6730102 FT /note="match to EST AA182934 (NID:g1766177) zp51e08.r1" FT misc_feature 6730039..6730801 FT /note="similar to Homo sapiens EST AU131235 FT (NID:g10991589)" FT misc_feature 6730092..6730690 FT /note="match to EST AI769811 (NID:g5236320) wj26h03.x1" FT misc_feature 6730095..6730246 FT /note="match to EST AA230216 (NID:g1852623) nc13e11.r1" FT misc_feature 6730095..6730541 FT /note="match to EST AA167615 (NID:g1744801) zq38a03.s1" FT misc_feature 6730096..6730716 FT /note="similar to Bos taurus EST AW289331 (NID:g9257803)" FT misc_feature 6730096..6730594 FT /note="match to EST BF593155 (NID:g11685479)" FT misc_feature 6730134..6730458 FT /note="match to EST AA230255 (NID:g1852568) nc13e11.s1" FT misc_feature 6730387..6730818 FT /note="similar to EST BI002896 (NID:g14406970)" FT misc_feature 6730387..6730768 FT /note="similar to EST BI002371 (NID:g14406445)" FT misc_feature 6730415..6731083 FT /note="similar to Homo sapiens EST BE884869 FT (NID:g10333645)" FT misc_feature 6730462..6730678 FT /note="similar to EST BI002370 (NID:g14406444)" FT /note="similar to EST BI002120 (NID:g14406194)" FT misc_feature 6730464..6730678 FT /note="similar to EST BI002114 (NID:g14406188)" FT misc_feature 6730472..6730757 FT /note="similar to EST BI001783 (NID:g14405857)" FT misc_feature 6730490..6730678 FT /note="similar to EST BI001786 (NID:g14405860)" FT misc_feature 6730508..6730678 FT /note="similar to EST BI002111 (NID:g14406185)" FT /note="similar to EST BI001645 (NID:g14405719)" FT misc_feature 6730517..6730541 FT /note="similar to Homo sapiens EST AU121463 FT (NID:g10936698)" FT misc_feature 6730529..6730757 FT /note="similar to EST BI002406 (NID:g14406480)" FT misc_feature 6730534..6731213 FT /note="similar to Homo sapiens EST BE568216 (NID:g9811936)" FT misc_feature 6730571..6730690 FT /note="similar to Homo sapiens EST BE396279 (NID:g9341644)" FT misc_feature 6730626 FT /note="similar to Homo sapiens EST AL539492 FT (NID:g12868755)" FT misc_feature 6730628..6730838 FT /note="similar to Homo sapiens EST AU121463 FT (NID:g10936698)" FT misc_feature 6730636..6731043 FT /note="similar to EST BI001641 (NID:g14405715)" FT misc_feature 6730644..6730687 FT /note="similar to Homo sapiens EST BF794596 FT (NID:g12099650)" FT misc_feature 6730646..6730685 FT /note="similar to Homo sapiens EST AL542242 FT (NID:g12874093)" FT misc_feature 6730651..6730678 FT /note="similar to Homo sapiens EST AL539492 FT (NID:g12868755)" FT misc_feature 6730657..6731197 FT /note="similar to EST BI001772 (NID:g14405846)" FT misc_feature 6730708..6731510 FT /note="similar to Mus musculus EST BF163546 FT (NID:g11043819)" FT misc_feature 6730720..6730757 FT /note="similar to Homo sapiens EST AL542243 FT (NID:g12874095)" FT misc_feature 6730762..6731211 FT /note="similar to EST BI001645 (NID:g14405719)" FT /note="similar to EST BI002120 (NID:g14406194)" FT /note="similar to EST BI002114 (NID:g14406188)" FT misc_feature 6730762..6731210 FT /note="similar to EST BI001786 (NID:g14405860)" FT /note="similar to EST BI002111 (NID:g14406185)" FT misc_feature 6730762..6731209 FT /note="similar to EST BI002370 (NID:g14406444)" FT misc_feature 6730762..6730818 FT /note="similar to Homo sapiens EST AL539492 FT (NID:g12868755)" FT misc_feature 6730772..6730833 FT /note="similar to Homo sapiens EST BF794596 FT (NID:g12099650)" FT misc_feature 6730809..6730847 FT /note="similar to Homo sapiens EST BF038724 FT (NID:g10745775)" FT misc_feature 6730815..6730931 FT /note="similar to Homo sapiens EST BE065355 (NID:g8409914)" FT misc_feature 6730821..6730856 FT /note="similar to Homo sapiens EST BE396279 (NID:g9341644)" FT misc_feature 6730821..6730850 FT /note="similar to Homo sapiens EST AW996149 (NID:g8256383)" FT misc_feature 6730846..6731211 FT /note="similar to EST BI002406 (NID:g14406480)" FT misc_feature 6730846..6731220 FT /note="similar to EST BI001783 (NID:g14405857)" FT misc_feature 6730900..6730939 FT /note="similar to Homo sapiens EST AL542243 FT (NID:g12874095)" FT /note="similar to Homo sapiens EST BE790015 FT (NID:g10211213)" FT misc_feature 6730913..6730939 FT /note="similar to Homo sapiens EST BF794596 FT (NID:g12099650)" FT misc_feature 6730927..6731014 FT /note="similar to Homo sapiens EST BF038724 FT (NID:g10745775)" FT misc_feature 6730961..6731241 FT /note="similar to EST BG961527 (NID:g14379698)" FT misc_feature 6730971..6731014 FT /note="similar to Homo sapiens EST BG285369 FT (NID:g13037105)" FT misc_feature 6730975..6730996 FT /note="similar to Homo sapiens EST AU121463 FT (NID:g10936698)" FT misc_feature 6730987..6731051 FT /note="similar to Homo sapiens EST AL539492 FT (NID:g12868755)" FT misc_feature 6730989..6731014 FT /note="similar to Homo sapiens EST BE065355 (NID:g8409914)" FT misc_feature 6731000..6731461 FT /note="similar to Homo sapiens EST AW604536 (NID:g7309277)" FT misc_feature 6731003..6731500 FT /note="similar to Bos taurus EST BF045373 (NID:g10762428)" FT misc_feature 6731022..6731273 FT /note="similar to EST BI002371 (NID:g14406445)" FT misc_feature 6731073..6731282 FT /note="similar to Homo sapiens EST AL539191 FT (NID:g12868186)" FT misc_feature 6731081..6731090 FT /note="similar to Homo sapiens EST AU121463 FT (NID:g10936698)" FT misc_feature 6731086..6731098 FT /note="similar to Homo sapiens EST BE396279 (NID:g9341644)" FT misc_feature 6731099..6731206 FT /note="similar to Homo sapiens EST BE065355 (NID:g8409914)" FT misc_feature 6731099..6731189 FT /note="similar to Homo sapiens EST BG285369 FT (NID:g13037105)" FT /note="similar to Homo sapiens EST BF038724 FT (NID:g10745775)" FT misc_feature 6731104..6731186 FT /note="similar to Homo sapiens EST AW996149 (NID:g8256383)" FT misc_feature 6731136..6731211 FT /note="similar to Homo sapiens EST AL539492 FT (NID:g12868755)" FT misc_feature 6731143..6731417 FT /note="similar to Homo sapiens EST AW949334 (NID:g8138958)" FT misc_feature 6731143..6731406 FT /note="similar to Homo sapiens EST AL542242 FT (NID:g12874093)" FT misc_feature 6731155..6731204 FT /note="similar to Homo sapiens EST BE396279 (NID:g9341644)" FT misc_feature 6731178..6731189 FT /note="similar to Homo sapiens EST AU121463 FT (NID:g10936698)" FT misc_feature 6731213..6731976 FT /note="similar to Homo sapiens EST AU125576 FT (NID:g10950292)" FT misc_feature 6731232..6731775 FT /note="similar to EST BG911227 (NID:g14291703)" FT misc_feature 6731245..6731273 FT /note="similar to Homo sapiens EST BG285369 FT (NID:g13037105)" FT /note="similar to Homo sapiens EST BF038724 FT (NID:g10745775)" FT misc_feature 6731251..6731283 FT /note="similar to Homo sapiens EST AU121463 FT (NID:g10936698)" FT misc_feature 6731266..6731337 FT /note="similar to Homo sapiens EST AL539492 FT (NID:g12868755)" FT misc_feature 6731326..6731363 FT /note="similar to Homo sapiens EST AW996149 (NID:g8256383)" FT misc_feature 6731358..6731630 FT /note="similar to Homo sapiens EST AL542243 FT (NID:g12874095)" FT misc_feature 6731360..6731630 FT /note="similar to Homo sapiens EST BF794596 FT (NID:g12099650)" FT /note="similar to Homo sapiens EST BE790015 FT (NID:g10211213)" FT misc_feature 6731403..6731415 FT /note="similar to Homo sapiens EST BG285369 FT (NID:g13037105)" FT misc_feature 6731403..6731417 FT /note="similar to Homo sapiens EST BF038724 FT (NID:g10745775)" FT misc_feature 6731407..6731640 FT /note="similar to Homo sapiens EST AL539492 FT (NID:g12868755)" FT misc_feature 6731412..6731859 FT /note="similar to Mus musculus EST AA880983 (NID:g2989966) FT vx34f02.r1" FT misc_feature 6731450..6731473 FT /note="similar to Homo sapiens EST AW996149 (NID:g8256383)" FT misc_feature 6731501..6731630 FT /note="similar to Homo sapiens EST BG285369 FT (NID:g13037105)" FT misc_feature 6731503..6731611 FT /note="similar to Homo sapiens EST BF038724 FT (NID:g10745775)" FT misc_feature 6731505..6731546 FT /note="similar to Homo sapiens EST BE065355 (NID:g8409914)" FT misc_feature 6731518..6731546 FT /note="match to EST BF593155 (NID:g11685479)" FT misc_feature 6731537..6731630 FT /note="similar to Homo sapiens EST AU121463 FT (NID:g10936698)" FT misc_feature 6731537..6732091 FT /note="similar to EST BG957653 (NID:g14375824)" FT misc_feature 6731556..6731632 FT /note="similar to Homo sapiens EST AW996149 (NID:g8256383)" FT misc_feature 6731575..6731773 FT /note="similar to Homo sapiens EST AL542242 FT (NID:g12874093)" FT misc_feature 6731587..6731769 FT /note="similar to Homo sapiens EST AW949334 (NID:g8138958)" FT misc_feature 6731628..6732091 FT /note="similar to EST BG958440 (NID:g14376611)" FT misc_feature 6731645 FT /note="similar to Homo sapiens EST BF038724 FT (NID:g10745775)" FT misc_feature 6731686..6731766 FT /note="similar to Homo sapiens EST AU121463 FT (NID:g10936698)" FT misc_feature 6731706..6732299 FT /note="match to EST BG008761 (NID:g12454280)" FT misc_feature 6731745..6731757 FT /note="similar to Homo sapiens EST AL539492 FT (NID:g12868755)" FT misc_feature 6731789..6732238 FT /note="match to EST AW959423 (NID:g8149107)" FT misc_feature 6731916..6731934 FT /note="similar to Homo sapiens EST AL539492 FT (NID:g12868755)" FT misc_feature 6731951..6732334 FT /note="match to EST AA167752 (NID:g1744902) zq38a03.r1" FT misc_feature 6732016..6732342 FT /note="match to EST AA249112 (NID:g1879711)" FT misc_feature 6732139..6732334 FT /note="match to EST AI825935 (NID:g5446606) to92e03.x1" FT misc_feature 6732201..6732334 FT /note="match to EST BF327141 (NID:g11297889)" FT misc_feature 6732278..6732318 FT /note="match to EST BG105146 (NID:g12598992)" FT /note="similar to Homo sapiens EST AA502797 (NID:g2237764) FT ne43h04.s1" FT repeat_region 6732506..6732536 FT /rpt_family="(CA)n" FT repeat_region 6733211..6733379 FT /rpt_family="MIR" FT misc_feature 6733279..6733283 FT /note="match to EST AA133934 (NID:g1691001) zo16f11.s1" FT repeat_region 6733517..6733826 FT /rpt_family="Alu" FT repeat_region 6733797..6733834 FT /rpt_family="(CAAA)n" FT repeat_region 6734559..6734844 FT /rpt_family="Alu" FT repeat_region 6735011..6735134 FT /rpt_family="Alu" FT misc_feature 6735027..6735473 FT /note="match to EST AA772690 (NID:g2824473) ai35b07.s1" FT misc_feature 6735132..6735169 FT /note="similar to Homo sapiens EST AV690699 FT (NID:g10292562)" FT misc_feature 6735262..6735355 FT /note="similar to Homo sapiens EST AV690699 FT (NID:g10292562)" FT misc_feature 6735281..6735759 FT /note="similar to EST BI015572 (NID:g14419643)" FT misc_feature 6735442..6735445 FT /note="match to EST AA133933 (NID:g1691000) zo16f11.r1" FT misc_feature 6735528..6735887 FT /note="match to EST T97575 (NID:g746920) ye55g03.r1" FT misc_feature 6736097..6736722 FT /note="match to EST BF750624 (NID:g12077300)" FT repeat_region 6736291..6736357 FT /rpt_family="L2" FT misc_feature 6736582..6736996 FT /note="match to EST AA133933 (NID:g1691000) zo16f11.r1" FT misc_feature 6736586..6737013 FT /note="match to EST AA133934 (NID:g1691001) zo16f11.s1" FT misc_feature 6736966..6737065 FT /note="match to EST BF170340 (NID:g13436554)" FT misc_feature 6736970..6737065 FT /note="match to EST AI825935 (NID:g5446606) to92e03.x1" FT /note="match to EST BF327141 (NID:g11297889)" FT /note="match to EST AA167752 (NID:g1744902) zq38a03.r1" FT misc_feature 6737004..6737033 FT /note="similar to Homo sapiens EST AA502797 (NID:g2237764) FT ne43h04.s1" FT /note="match to EST BG105146 (NID:g12598992)" FT misc_feature 6737308..6737445 FT /note="similar to Homo sapiens EST BE408300 (NID:g9344750)" FT misc_feature 6737308..6737455 FT /note="similar to Homo sapiens EST BG334189 FT (NID:g13140627)" FT /note="similar to Homo sapiens EST AL560771 FT (NID:g12907552)" FT misc_feature 6737309..6737455 FT /note="similar to Homo sapiens EST AL559978 FT (NID:g12905995)" FT misc_feature 6737315..6737455 FT /note="match to EST BG105146 (NID:g12598992)" FT misc_feature 6737316..6737483 FT /note="match to EST AI825935 (NID:g5446606) to92e03.x1" FT misc_feature 6737316..6737410 FT /note="match to EST BF327141 (NID:g11297889)" FT misc_feature 6737316..6737383 FT /note="match to EST AA167752 (NID:g1744902) zq38a03.r1" FT misc_feature 6737320..6737395 FT /note="match to EST BF170340 (NID:g13436554)" FT misc_feature 6737356..6737455 FT /note="similar to Homo sapiens EST AA502797 (NID:g2237764) FT ne43h04.s1" FT misc_feature 6737381..6737442 FT /note="similar to Homo sapiens EST BE781995 FT (NID:g10203206)" FT misc_feature 6737400..6737444 FT /note="similar to Homo sapiens EST C15518 (NID:g1570225)" FT misc_feature 6737504..6738071 FT /note="match to EST AW052028 (NID:g5914387) wx25c09.x1" FT repeat_region 6737774..6738091 FT /rpt_family="L2" FT repeat_region 6738488..6738583 FT /rpt_family="MIR" FT misc_feature 6738900..6739380 FT /note="match to EST BF369936 (NID:g11331987)" FT misc_feature 6739166..6739362 FT /note="similar to Homo sapiens EST BF887891 FT (NID:g12279137)" FT misc_feature 6739338..6739343 FT /note="similar to Homo sapiens EST AW604536 (NID:g7309277)" FT repeat_region 6739635..6739932 FT /rpt_family="Alu" FT repeat_region 6739936..6739978 FT /rpt_family="(CA)n" FT misc_feature 6739961..6740622 FT /note="match to EST BE549143 (NID:g9777788)" FT misc_feature 6740219..6740450 FT /note="match to EST BE277344 (NID:g9152312)" FT repeat_region 6740578..6740626 FT /rpt_family="(TTCA)n" FT repeat_region 6740624..6740773 FT /rpt_family="Alu" FT repeat_region 6741366..6741881 FT /rpt_family="L2" FT repeat_region 6741583..6741602 FT /rpt_family="(A)n" FT repeat_region 6741930..6741956 FT /rpt_family="(CA)n" FT repeat_region 6741976..6742068 FT /rpt_family="(CA)n" FT misc_feature 6742011..6742027 FT /note="similar to Homo sapiens EST AA076814 (NID:g1836288)" FT repeat_region 6742118..6742177 FT /rpt_family="(CA)n" FT repeat_region 6742306..6742328 FT /rpt_family="(CA)n" FT repeat_region 6742388..6742421 FT /rpt_family="(CA)n" FT repeat_region 6742443..6742499 FT /rpt_family="(CA)n" FT repeat_region 6742590..6742611 FT /rpt_family="(CA)n" FT repeat_region 6742671..6742696 FT /rpt_family="(CA)n" FT repeat_region 6742699..6742846 FT /rpt_family="L2" FT misc_feature 6742796..6743109 FT /note="match to EST BF328002 (NID:g11298750)" FT misc_feature 6742854..6743370 FT /note="match to EST AW809081 (NID:g7902075)" FT misc_feature 6742887..6742890 FT /note="similar to Homo sapiens EST BF678424 FT (NID:g11952319)" FT misc_feature 6743116..6743363 FT /note="match to EST BE141848 (NID:g8604569)" FT repeat_region 6743676..6743968 FT /rpt_family="Alu" FT misc_feature 6743794..6743942 FT /note="similar to Homo sapiens EST BF934190 FT (NID:g12351514)" FT repeat_region 6744078..6744401 FT /rpt_family="Alu" FT repeat_region 6744200..6744223 FT /rpt_family="(A)n" FT repeat_region 6744372..6744406 FT /rpt_family="(A)n" FT misc_feature 6744593..6744947 FT /note="match to EST AW815913 (NID:g7908907)" FT misc_feature 6744599..6744950 FT /note="match to EST AW856494 (NID:g7952187)" FT misc_feature 6744790..6744854 FT /note="similar to Homo sapiens EST BF934190 FT (NID:g12351514)" FT misc_feature 6744801..6744823 FT /note="match to EST BG105146 (NID:g12598992)" FT /note="similar to Homo sapiens EST AL559978 FT (NID:g12905995)" FT /note="similar to Homo sapiens EST BG334189 FT (NID:g13140627)" FT /note="similar to Homo sapiens EST AA502797 (NID:g2237764) FT ne43h04.s1" FT /note="similar to Homo sapiens EST AL560771 FT (NID:g12907552)" FT repeat_region 6745138..6745376 FT /rpt_family="Alu" FT misc_feature 6745333..6745334 FT /note="similar to Homo sapiens EST AA973626 (NID:g3148806) FT oo48a07.s1" FT repeat_region 6745351..6745383 FT /rpt_family="(CAAA)n" FT misc_feature 6745868..6746716 FT /note="CpG_island (%GC=72.3, o/e=1.00, #CpGs=98)" FT misc_feature 6746061..6746262 FT /note="similar to Homo sapiens EST C15518 (NID:g1570225)" FT misc_feature 6746061..6746346 FT /note="similar to Homo sapiens EST BE408300 (NID:g9344750)" FT misc_feature 6746062..6746187 FT /note="similar to Homo sapiens EST BG334189 FT (NID:g13140627)" FT misc_feature 6746062..6746395 FT /note="similar to Homo sapiens EST AL560771 FT (NID:g12907552)" FT misc_feature 6746063..6746163 FT /note="similar to Homo sapiens EST BF934190 FT (NID:g12351514)" FT misc_feature 6746063..6746553 FT /note="similar to Homo sapiens EST BE781995 FT (NID:g10203206)" FT misc_feature 6746067..6746206 FT /note="similar to Homo sapiens EST AA502797 (NID:g2237764) FT ne43h04.s1" FT misc_feature 6746107..6746605 FT /note="similar to Homo sapiens EST AI879099 (NID:g5553148) FT au54e04.y1" FT misc_feature 6746295..6746552 FT /note="similar to Homo sapiens EST AL559978 FT (NID:g12905995)" FT misc_feature 6746915..6747305 FT /note="match to EST BF919988 (NID:g12315876)" FT repeat_region 6747252..6747525 FT /rpt_family="ERV1" FT misc_feature 6747419..6747422 FT /note="similar to Homo sapiens EST BF934190 FT (NID:g12351514)" FT repeat_region 6747526..6747807 FT /rpt_family="Alu" FT repeat_region 6747808..6747938 FT /rpt_family="ERV1" FT repeat_region 6748175..6748477 FT /rpt_family="Alu" FT repeat_region 6748671..6748847 FT /rpt_family="ERV1" FT repeat_region 6748848..6749137 FT /rpt_family="Alu" FT repeat_region 6749138..6749228 FT /rpt_family="ERV1" FT misc_feature 6749156..6749159 FT /note="match to EST AW809081 (NID:g7902075)" FT repeat_region 6749335..6749797 FT /rpt_family="ERV1" FT repeat_region 6749807..6750069 FT /rpt_family="Alu" FT repeat_region 6750143..6750487 FT /rpt_family="ERV1" FT misc_feature 6750378..6750382 FT /note="similar to Homo sapiens EST BF932450 FT (NID:g12349774)" FT repeat_region 6750488..6750773 FT /rpt_family="Alu" FT repeat_region 6750750..6750774 FT /rpt_family="(TAAA)n" FT repeat_region 6750774..6750794 FT /rpt_family="ERV1" FT repeat_region 6750795..6751179 FT /rpt_family="MaLR" FT misc_feature 6751014..6751100 FT /note="similar to Homo sapiens EST AU120696 FT (NID:g10935931)" FT repeat_region 6751180..6751254 FT /rpt_family="ERV1" FT repeat_region 6751255..6751309 FT /rpt_family="ERVL" FT repeat_region 6751310..6751346 FT /rpt_family="ERV1" FT repeat_region 6751356..6751472 FT /rpt_family="ERV1" FT repeat_region 6751526..6751826 FT /rpt_family="Alu" FT misc_feature 6751707..6751711 FT /note="match to EST AA167615 (NID:g1744801) zq38a03.s1" FT repeat_region 6751829..6752129 FT /rpt_family="Alu" FT repeat_region 6752199..6752234 FT /rpt_family="Alu" FT repeat_region 6752353..6752659 FT /rpt_family="Alu" FT repeat_region 6752633..6752667 FT /rpt_family="(CAAA)n" FT misc_feature 6752645..6753063 FT /note="similar to EST BI002812 (NID:g14406886)" FT repeat_region 6752697..6752731 FT /rpt_family="AT_rich" FT repeat_region 6752705..6752842 FT /rpt_family="Alu" FT misc_feature 6752723..6753104 FT /note="similar to Homo sapiens EST AI348322 (NID:g4085528) FT qo15c02.x1" FT misc_feature 6752764..6753340 FT /note="similar to Homo sapiens EST AW961627 (NID:g8151311)" FT misc_feature 6752876..6753331 FT /note="similar to Homo sapiens EST AI347247 (NID:g4084453) FT tc05a04.x1" FT misc_feature 6752962..6753457 FT /note="similar to Homo sapiens EST AL042806 (NID:g5422249)" FT misc_feature 6752987..6753295 FT /note="similar to Homo sapiens EST AW371883 (NID:g6876537)" FT misc_feature 6752992..6753412 FT /note="similar to Homo sapiens EST AA973626 (NID:g3148806) FT oo48a07.s1" FT misc_feature 6753231..6753333 FT /note="similar to Homo sapiens EST Z21240 (NID:g27983)" FT misc_feature 6753251..6753759 FT /note="similar to Homo sapiens EST AW974453 (NID:g8165651)" FT misc_feature 6753447..6753772 FT /note="similar to Homo sapiens EST AA648432 (NID:g2574861) FT ns22d06.s1" FT misc_feature 6753479..6754121 FT /note="similar to Homo sapiens EST BE087537 (NID:g8477932)" FT misc_feature 6753645 FT /note="similar to Homo sapiens EST AI908172 (NID:g6498852)" FT misc_feature 6753695..6753974 FT /note="similar to Homo sapiens EST AI908172 (NID:g6498852)" FT misc_feature 6753761..6753924 FT /note="similar to Homo sapiens EST Z21240 (NID:g27983)" FT misc_feature 6753870..6754311 FT /note="similar to Homo sapiens EST H00596 (NID:g863529) FT yj25b05.s1" FT misc_feature 6753901..6754169 FT /note="similar to Homo sapiens EST AA076961 (NID:g1836449)" FT misc_feature 6753927..6754189 FT /note="similar to Homo sapiens EST AA077194 (NID:g1836878)" FT misc_feature 6753988..6754351 FT /note="similar to Homo sapiens EST AA324662 (NID:g1976960)" FT misc_feature 6754077..6754420 FT /note="similar to Homo sapiens EST AW796439 (NID:g7848309)" FT misc_feature 6754101..6754334 FT /note="similar to Homo sapiens EST AA025225 (NID:g1490167) FT ze81d08.s1" FT misc_feature 6754166..6754358 FT /note="similar to Homo sapiens EST AI025190 (NID:g3240803) FT ov40e04.x1" FT misc_feature 6754168..6754588 FT /note="similar to Homo sapiens EST AA782132 (NID:g2841463) FT ai48e06.s1" FT misc_feature 6754168..6754358 FT /note="similar to Homo sapiens EST AI015925 (NID:g3230261) FT ov26b12.x1" FT misc_feature 6754169..6754588 FT /note="similar to Homo sapiens EST AU120696 FT (NID:g10935931)" FT misc_feature 6754233..6754446 FT /note="similar to Homo sapiens EST AA076895 (NID:g1836369)" FT misc_feature 6754247..6754668 FT /note="similar to Homo sapiens EST N44656 (NID:g1185822) FT yy33e11.r1" FT misc_feature 6754289..6754435 FT /note="similar to Homo sapiens EST AW904804 (NID:g8069009)" FT misc_feature 6754311..6755197 FT /note="similar to Homo sapiens EST BG477267 FT (NID:g13409546)" FT misc_feature 6754311..6755049 FT /note="similar to Homo sapiens EST BG334567 FT (NID:g13141005)" FT misc_feature 6754314..6754418 FT /note="similar to Homo sapiens EST AA922998 (NID:g3070307) FT ok76b04.s1" FT misc_feature 6754357..6754864 FT /note="similar to Homo sapiens EST BE148061 (NID:g8610785)" FT misc_feature 6754357..6755024 FT /note="similar to Homo sapiens EST BF025816 FT (NID:g10733528)" FT misc_feature 6754357..6754879 FT /note="similar to Homo sapiens EST BE384992 (NID:g9330357)" FT misc_feature 6754369..6754430 FT /note="similar to Homo sapiens EST BE148002 (NID:g8610726)" FT misc_feature 6754399..6754402 FT /note="similar to Homo sapiens EST AW974453 (NID:g8165651)" FT misc_feature 6754443..6754753 FT /note="similar to Homo sapiens EST AA922998 (NID:g3070307) FT ok76b04.s1" FT misc_feature 6754453..6754959 FT /note="similar to Homo sapiens EST BE148002 (NID:g8610726)" FT misc_feature 6754463..6754541 FT /note="similar to Homo sapiens EST AW904804 (NID:g8069009)" FT misc_feature 6754471..6755337 FT /note="similar to EST BG745375 (NID:g14056028)" FT misc_feature 6754471..6754546 FT /note="similar to Homo sapiens EST AA076895 (NID:g1836369)" FT misc_feature 6754494..6754748 FT /note="similar to Homo sapiens EST BF821178 FT (NID:g12160180)" FT misc_feature 6754575 FT /note="match to EST AA077390 (NID:g1836864)" FT misc_feature 6754576..6754787 FT /note="similar to Homo sapiens EST BF910906 FT (NID:g12302364)" FT misc_feature 6754612..6754910 FT /note="match to EST AA077390 (NID:g1836864)" FT misc_feature 6754665..6754988 FT /note="similar to Homo sapiens EST AA347166 (NID:g1999402)" FT misc_feature 6754711..6754937 FT /note="similar to Homo sapiens EST BF914410 FT (NID:g12305868)" FT misc_feature 6754748..6755234 FT /note="match to EST AW408503 (NID:g6927560)" FT misc_feature 6754792..6754913 FT /note="similar to EST BG960913 (NID:g14379084)" FT misc_feature 6754854 FT /note="similar to Homo sapiens EST AA922998 (NID:g3070307) FT ok76b04.s1" FT misc_feature 6754916..6755543 FT /note="similar to Homo sapiens EST BE543950 (NID:g9772595)" FT misc_feature 6754919..6755367 FT /note="similar to Homo sapiens EST AW379014 (NID:g6883673)" FT repeat_region 6754928..6755130 FT /rpt_family="Alu" FT misc_feature 6755001..6755005 FT /note="similar to Homo sapiens EST BF872452 FT (NID:g12262582)" FT misc_feature 6755020..6755260 FT /note="similar to Homo sapiens EST AU120696 FT (NID:g10935931)" FT misc_feature 6755129..6755542 FT /note="similar to Homo sapiens EST BF893680 FT (NID:g12285139)" FT misc_feature 6755168..6755625 FT /note="similar to Homo sapiens EST BG030247 FT (NID:g12419345)" FT misc_feature 6755178..6755448 FT /note="similar to Homo sapiens EST H95299 (NID:g1102932) FT yu20c05.r1" FT misc_feature 6755216..6755279 FT /note="similar to Homo sapiens EST AI015925 (NID:g3230261) FT ov26b12.x1" FT misc_feature 6755216..6755320 FT /note="similar to Homo sapiens EST AI025190 (NID:g3240803) FT ov40e04.x1" FT misc_feature 6755248..6755492 FT /note="similar to EST BG960913 (NID:g14379084)" FT misc_feature 6755438..6755962 FT /note="similar to Homo sapiens EST BG178274 FT (NID:g12684977)" FT misc_feature 6755443..6755543 FT /note="similar to Homo sapiens EST AI025190 (NID:g3240803) FT ov40e04.x1" FT misc_feature 6755488..6755611 FT /note="similar to EST BG717935 (NID:g13997122)" FT misc_feature 6755518..6755706 FT /note="similar to Homo sapiens EST AA076958 (NID:g1836446)" FT misc_feature 6755525..6755949 FT /note="similar to Homo sapiens EST AW151989 (NID:g6199809) FT xf71d05.x1" FT misc_feature 6755525..6755611 FT /note="similar to Homo sapiens EST BF378894 FT (NID:g11368019)" FT misc_feature 6755568..6755966 FT /note="similar to Homo sapiens EST BE304791 (NID:g9176305)" FT repeat_region 6755829..6755966 FT /rpt_family="Alu" FT repeat_region 6755967..6756173 FT /rpt_family="Alu" FT repeat_region 6756174..6756474 FT /rpt_family="Alu" FT repeat_region 6756475..6756563 FT /rpt_family="Alu" FT misc_feature 6756548..6756550 FT /note="similar to Homo sapiens EST AA643257 (NID:g2568475) FT nr61h09.s1" FT misc_feature 6756554..6757135 FT /note="similar to Homo sapiens EST AW578524 (NID:g7253586)" FT repeat_region 6756564..6756745 FT /rpt_family="Alu" FT misc_feature 6756591..6757031 FT /note="similar to Homo sapiens EST AW363264 (NID:g6867914)" FT misc_feature 6756632..6757125 FT /note="similar to Homo sapiens EST AW851554 (NID:g7947071)" FT misc_feature 6756636..6756952 FT /note="similar to Homo sapiens EST BE147985 (NID:g8610709)" FT misc_feature 6756646..6756647 FT /note="similar to Homo sapiens EST BF910906 FT (NID:g12302364)" FT misc_feature 6756667..6756964 FT /note="similar to Homo sapiens EST AA077665 (NID:g1837139)" FT misc_feature 6756728..6756901 FT /note="similar to Homo sapiens EST AW797943 (NID:g7849813)" FT misc_feature 6756803..6757100 FT /note="similar to Homo sapiens EST AA077441 (NID:g1836915)" FT misc_feature 6756853..6757135 FT /note="similar to Homo sapiens EST AA077266 (NID:g1836740)" FT misc_feature 6756853..6756903 FT /note="similar to Homo sapiens EST BE696033 FT (NID:g10083193)" FT misc_feature 6756977..6757262 FT /note="similar to Homo sapiens EST BF885074 FT (NID:g12275683)" FT misc_feature 6757009..6757479 FT /note="match to EST AW369808 (NID:g6874462)" FT misc_feature 6757118..6757366 FT /note="similar to Homo sapiens EST BE696033 FT (NID:g10083193)" FT misc_feature 6757144..6757405 FT /note="similar to EST BI000825 (NID:g14404899)" FT misc_feature 6757163..6757164 FT /note="similar to Homo sapiens EST AW578524 (NID:g7253586)" FT misc_feature 6757185..6757603 FT /note="similar to Homo sapiens EST BF925134 FT (NID:g12321213)" FT misc_feature 6757393..6757396 FT /note="similar to Homo sapiens EST AA769080 (NID:g2820318) FT oa74d08.s1" FT repeat_region 6757493..6757799 FT /rpt_family="Alu" FT misc_feature 6757534..6758019 FT /note="similar to Homo sapiens EST AI909229 (NID:g6499909)" FT misc_feature 6757568..6757614 FT /note="similar to Homo sapiens EST BE147537 (NID:g8610261)" FT misc_feature 6757583..6758087 FT /note="similar to Homo sapiens EST BF920705 FT (NID:g12316593)" FT misc_feature 6757750..6758017 FT /note="similar to Homo sapiens EST BE147537 (NID:g8610261)" FT misc_feature 6757786..6758079 FT /note="similar to Homo sapiens EST BE147789 (NID:g8610422)" FT misc_feature 6757886..6758325 FT /note="similar to Homo sapiens EST AW804968 (NID:g7856838)" FT misc_feature 6757939..6758059 FT /note="similar to Homo sapiens EST AA609103 (NID:g2457531) FT af11c06.s1" FT /note="similar to Homo sapiens EST AI219824 (NID:g3802027) FT qg83b07.x1" FT misc_feature 6757961..6758240 FT /note="similar to Homo sapiens EST AA076927 (NID:g1836401)" FT misc_feature 6757976..6758059 FT /note="similar to EST BG717935 (NID:g13997122)" FT /note="similar to Homo sapiens EST BF378894 FT (NID:g11368019)" FT misc_feature 6758057..6758301 FT /note="similar to Homo sapiens EST AA078166 (NID:g1837640)" FT misc_feature 6758143..6758505 FT /note="similar to Homo sapiens EST AI672123 (NID:g4851854) FT tq92c02.x1" FT misc_feature 6758235..6758667 FT /note="similar to Homo sapiens EST AW937813 (NID:g8113242)" FT misc_feature 6758371..6759038 FT /note="similar to Homo sapiens EST BE266247 (NID:g9139821)" FT repeat_region 6758528..6758815 FT /rpt_family="Alu" FT repeat_region 6758853..6759159 FT /rpt_family="Alu" FT repeat_region 6759132..6759163 FT /rpt_family="(A)n" FT misc_feature 6759153..6759372 FT /note="similar to Homo sapiens EST BE709215 FT (NID:g10097480)" FT misc_feature 6759154..6759366 FT /note="similar to Homo sapiens EST AA077311 (NID:g1836995)" FT misc_feature 6759160..6759468 FT /note="similar to Homo sapiens EST AA076814 (NID:g1836288)" FT misc_feature 6759255..6759571 FT /note="similar to Homo sapiens EST BF932450 FT (NID:g12349774)" FT misc_feature 6759280..6759568 FT /note="similar to EST BG717935 (NID:g13997122)" FT misc_feature 6759280..6759337 FT /note="similar to Homo sapiens EST AA609103 (NID:g2457531) FT af11c06.s1" FT misc_feature 6759280..6759336 FT /note="similar to Homo sapiens EST AI219824 (NID:g3802027) FT qg83b07.x1" FT misc_feature 6759280..6759338 FT /note="similar to Homo sapiens EST BF378894 FT (NID:g11368019)" FT misc_feature 6759361..6759665 FT /note="similar to Homo sapiens EST BF770705 FT (NID:g12118605)" FT misc_feature 6759372..6759375 FT /note="similar to Homo sapiens EST AW904804 (NID:g8069009)" FT misc_feature 6759394..6759840 FT /note="similar to Homo sapiens EST AI498073 (NID:g4390055) FT tm65h09.x1" FT misc_feature 6759435..6759605 FT /note="similar to Homo sapiens EST AA077682 (NID:g1837156)" FT misc_feature 6759608..6759786 FT /note="match to EST BF352664 (NID:g11311738)" FT repeat_region 6759766..6759828 FT /rpt_family="(TTTA)n" FT repeat_region 6759808..6760132 FT /rpt_family="Alu" FT misc_feature 6759921..6760291 FT /note="similar to EST BG989085 (NID:g14393142)" FT misc_feature 6759924..6760353 FT /note="similar to Homo sapiens EST BF830104 FT (NID:g12176392)" FT misc_feature 6759925..6760485 FT /note="similar to Homo sapiens EST BG010263 FT (NID:g12457278)" FT misc_feature 6759942..6760598 FT /note="similar to Homo sapiens EST BE148062 (NID:g8610786)" FT misc_feature 6759973 FT /note="similar to Homo sapiens EST BE148655 (NID:g8611379)" FT misc_feature 6760023..6760707 FT /note="similar to Homo sapiens EST BE148655 (NID:g8611379)" FT misc_feature 6760042..6760455 FT /note="similar to Homo sapiens EST BF831818 FT (NID:g12179961)" FT misc_feature 6760047..6760627 FT /note="similar to Homo sapiens EST BE148057 (NID:g8610781)" FT misc_feature 6760162..6760440 FT /note="similar to Homo sapiens EST AW361975 (NID:g6866625)" FT misc_feature 6760162..6760312 FT /note="similar to Homo sapiens EST BF381077 FT (NID:g11370202)" FT misc_feature 6760165..6760520 FT /note="similar to Homo sapiens EST BF993042 FT (NID:g12399365)" FT misc_feature 6760261..6760726 FT /note="similar to Homo sapiens EST BE705969 FT (NID:g10094234)" FT misc_feature 6760268..6760450 FT /note="similar to Homo sapiens EST BF360674 FT (NID:g11319746)" FT misc_feature 6760287..6760781 FT /note="similar to Homo sapiens EST BF830629 FT (NID:g12177646)" FT misc_feature 6760301..6760765 FT /note="similar to Homo sapiens EST BF884251 FT (NID:g12274377)" FT misc_feature 6760354..6760480 FT /note="similar to Homo sapiens EST AI219824 (NID:g3802027) FT qg83b07.x1" FT misc_feature 6760354..6760572 FT /note="similar to Homo sapiens EST BF378894 FT (NID:g11368019)" FT misc_feature 6760372..6760768 FT /note="similar to Homo sapiens EST AW752330 (NID:g7667262)" FT misc_feature 6760456..6760749 FT /note="similar to Homo sapiens EST AW361975 (NID:g6866625)" FT misc_feature 6760456..6760573 FT /note="similar to EST BG771785 (NID:g14082438)" FT misc_feature 6760495..6760830 FT /note="similar to Homo sapiens EST BF333801 FT (NID:g11304549)" FT misc_feature 6760544..6760850 FT /note="similar to Homo sapiens EST AA704207 (NID:g2714125) FT zj17a03.s1" FT repeat_region 6760823..6761122 FT /rpt_family="Alu" FT misc_feature 6761095..6761174 FT /note="similar to Homo sapiens EST BF381077 FT (NID:g11370202)" FT misc_feature 6761187..6761188 FT /note="similar to Homo sapiens EST BF381077 FT (NID:g11370202)" FT repeat_region 6761188..6761209 FT /rpt_family="(T)n" FT misc_feature 6761246..6761730 FT /note="similar to Homo sapiens EST AA601208 (NID:g2434833) FT no14c12.s1" FT misc_feature 6761335..6762086 FT /note="similar to Homo sapiens EST BE799618 FT (NID:g10220816)" FT misc_feature 6761480..6761809 FT /note="similar to Homo sapiens EST AA311568 (NID:g1964052)" FT misc_feature 6761489..6761993 FT /note="similar to Homo sapiens EST BG006611 FT (NID:g12449967)" FT misc_feature 6761491..6761780 FT /note="similar to Homo sapiens EST AW878297 (NID:g8040307)" FT misc_feature 6761512..6762008 FT /note="similar to Homo sapiens EST BF964533 FT (NID:g12381808)" FT misc_feature 6761548..6762125 FT /note="similar to EST BG771785 (NID:g14082438)" FT misc_feature 6761684..6762430 FT /note="similar to EST BG679665 (NID:g13911062)" FT misc_feature 6761710..6761982 FT /note="similar to Homo sapiens EST AA078438 (NID:g1837912)" FT misc_feature 6761811..6762207 FT /note="similar to Homo sapiens EST AA643257 (NID:g2568475) FT nr61h09.s1" FT misc_feature 6761831..6762257 FT /note="similar to Homo sapiens EST BF872452 FT (NID:g12262582)" FT misc_feature 6761856..6762214 FT /note="similar to Homo sapiens EST BF839874 FT (NID:g12192293)" FT misc_feature 6762056..6762214 FT /note="similar to Homo sapiens EST AA078022 (NID:g1837496)" FT misc_feature 6762163 FT /note="similar to Homo sapiens EST BG622386 FT (NID:g13673757)" FT misc_feature 6762186..6762600 FT /note="similar to Homo sapiens EST AW236834 (NID:g6569223) FT xm49f08.x1" FT misc_feature 6762186..6762396 FT /note="similar to EST BI009449 (NID:g14413520)" FT misc_feature 6762198..6762633 FT /note="similar to Homo sapiens EST BG622386 FT (NID:g13673757)" FT misc_feature 6762216..6762596 FT /note="match to EST BF115004 (NID:g10984480) hr72g09.x1" FT misc_feature 6762231..6762606 FT /note="similar to Homo sapiens EST AW204636 (NID:g6504108)" FT misc_feature 6762331..6762556 FT /note="similar to Homo sapiens EST BF678424 FT (NID:g11952319)" FT misc_feature 6762469..6762686 FT /note="similar to EST BG959898 (NID:g14378069)" FT repeat_region 6762610..6762906 FT /rpt_family="Alu" FT misc_feature 6762616..6763080 FT /note="similar to Homo sapiens EST AW814824 (NID:g7907818)" FT misc_feature 6762644..6762645 FT /note="match to EST BF115004 (NID:g10984480) hr72g09.x1" FT repeat_region 6762975..6763276 FT /rpt_family="Alu" FT misc_feature 6762984..6763007 FT /note="similar to Homo sapiens EST BF678424 FT (NID:g11952319)" FT misc_feature 6763000..6763098 FT /note="similar to Homo sapiens EST BG622386 FT (NID:g13673757)" FT repeat_region 6763363..6763706 FT /rpt_family="CR1" FT misc_feature 6763467..6763469 FT /note="similar to Homo sapiens EST BF884251 FT (NID:g12274377)" FT repeat_region 6763707..6764010 FT /rpt_family="Alu" FT misc_feature 6763779..6763801 FT /note="similar to Homo sapiens EST BF678424 FT (NID:g11952319)" FT misc_feature 6763972..6764014 FT /note="similar to Homo sapiens EST BF678424 FT (NID:g11952319)" FT repeat_region 6763988..6764010 FT /rpt_family="(A)n" FT misc_feature 6763995..6764004 FT /note="similar to Homo sapiens EST AW204636 (NID:g6504108)" FT misc_feature 6763996..6764017 FT /note="similar to Homo sapiens EST BG622386 FT (NID:g13673757)" FT repeat_region 6764011..6764069 FT /rpt_family="CR1" FT repeat_region 6764165..6764316 FT /rpt_family="Alu" FT misc_feature 6764300..6764301 FT /note="similar to Homo sapiens EST AI869986 (NID:g5543954) FT wl63d11.x1" FT misc_feature 6764325..6765010 FT /note="similar to Homo sapiens EST BG431402 FT (NID:g13337908)" FT repeat_region 6764336..6764449 FT /rpt_family="MER1_type" FT misc_feature 6764398..6764783 FT /note="similar to Homo sapiens EST BF902948 FT (NID:g12294407)" FT misc_feature 6764596..6765010 FT /note="similar to Homo sapiens EST AI869986 (NID:g5543954) FT wl63d11.x1" FT misc_feature 6764606..6764946 FT /note="similar to Homo sapiens EST H62116 (NID:g1014948) FT yu40h02.r1" FT misc_feature 6764688..6765291 FT /note="similar to Homo sapiens EST AA570498 (NID:g2344478) FT nk64f04.s1" FT repeat_region 6764953..6764984 FT /rpt_family="(TTTTTG)n" FT repeat_region 6764957..6765270 FT /rpt_family="Alu" FT repeat_region 6765291..6765310 FT /rpt_family="(A)n" FT repeat_region 6765299..6765476 FT /rpt_family="ERV1" FT misc_feature 6765447..6765449 FT /note="similar to Homo sapiens EST BF830629 FT (NID:g12177646)" FT repeat_region 6765477..6765501 FT /rpt_family="(T)n" FT misc_feature 6765525..6765574 FT /note="similar to Homo sapiens EST BG431402 FT (NID:g13337908)" FT misc_feature 6765525..6765539 FT /note="similar to Homo sapiens EST AI869986 (NID:g5543954) FT wl63d11.x1" FT repeat_region 6765783..6766033 FT /rpt_family="ERV1" FT repeat_region 6766034..6766355 FT /rpt_family="Alu" FT repeat_region 6766331..6766355 FT /rpt_family="(A)n" FT repeat_region 6766356..6766453 FT /rpt_family="ERV1" FT repeat_region 6766454..6766753 FT /rpt_family="Alu" FT misc_feature 6766678..6766753 FT /note="similar to Homo sapiens EST AI869986 (NID:g5543954) FT wl63d11.x1" FT repeat_region 6766754..6766890 FT /rpt_family="ERV1" FT repeat_region 6766889..6766909 FT /rpt_family="AT_rich" FT repeat_region 6766894..6767187 FT /rpt_family="Alu" FT misc_feature 6766979..6767047 FT /note="similar to Homo sapiens EST BG431402 FT (NID:g13337908)" FT misc_feature 6767104..6767426 FT /note="similar to Homo sapiens EST AA316183 (NID:g1968512)" FT misc_feature 6767202..6767349 FT /note="similar to Homo sapiens EST AA343510 (NID:g1995749)" FT repeat_region 6767324..6767879 FT /rpt_family="ERV1" FT repeat_region 6767896..6767958 FT /rpt_family="(TCCC)n" FT repeat_region 6767970..6768233 FT /rpt_family="Alu" FT misc_feature 6768045..6768051 FT /note="similar to Homo sapiens EST C15518 (NID:g1570225)" FT repeat_region 6768101..6768121 FT /rpt_family="AT_rich" FT repeat_region 6768241..6768542 FT /rpt_family="ERV1" FT misc_feature 6768656..6769219 FT /note="similar to EST BG988745 (NID:g14392815)" FT repeat_region 6768669..6768943 FT /rpt_family="Alu" FT misc_feature 6769265..6769269 FT /note="similar to Homo sapiens EST W86048 (NID:g1398478) FT zh57d06.s1" FT misc_feature 6769322..6770216 FT /note="CpG_island (%GC=68.8, o/e=0.80, #CpGs=78)" FT misc_feature 6769390..6769652 FT /note="similar to EST BG831530 (NID:g14179117)" FT misc_feature 6769417..6769924 FT /note="similar to Homo sapiens EST AL561205 FT (NID:g12908402)" FT misc_feature 6769419..6769648 FT /note="similar to Homo sapiens EST BE243913 (NID:g9095653)" FT misc_feature 6769437..6769647 FT /note="similar to Homo sapiens EST AL521317 FT (NID:g12784810)" FT misc_feature 6769441..6769924 FT /note="similar to Homo sapiens EST BE613988 (NID:g9895585)" FT misc_feature 6769475..6769929 FT /note="similar to Homo sapiens EST BG387100 FT (NID:g13280546)" FT misc_feature 6769551..6769647 FT /note="similar to Homo sapiens EST BE560142 (NID:g9803774)" FT misc_feature 6769552..6769924 FT /note="similar to Homo sapiens EST BG330691 FT (NID:g13137129)" FT misc_feature 6769661..6769932 FT /note="similar to Homo sapiens EST BE676053 FT (NID:g10036594)" FT /note="similar to Homo sapiens EST AW501675 (NID:g7115429)" FT misc_feature 6769662..6769878 FT /note="similar to Homo sapiens EST BE243913 (NID:g9095653)" FT misc_feature 6769662..6769916 FT /note="similar to Homo sapiens EST AL521317 FT (NID:g12784810)" FT misc_feature 6769662..6769932 FT /note="similar to Homo sapiens EST BE560142 (NID:g9803774)" FT misc_feature 6769669..6769932 FT /note="similar to EST BG831530 (NID:g14179117)" FT misc_feature 6769676..6769932 FT /note="similar to EST BG681324 (NID:g13912721)" FT misc_feature 6769698..6769932 FT /note="similar to Homo sapiens EST BG472367 FT (NID:g13404642)" FT misc_feature 6769915..6770062 FT /note="similar to Homo sapiens EST BF360003 FT (NID:g11319075)" FT misc_feature 6770063..6770166 FT /note="similar to Homo sapiens EST BF360003 FT (NID:g11319075)" FT misc_feature 6770127..6770137 FT /note="similar to Homo sapiens EST AW501675 (NID:g7115429)" FT misc_feature 6770127..6770504 FT /note="similar to Homo sapiens EST BE151622 (NID:g8614343)" FT misc_feature 6770187..6770250 FT /note="similar to Homo sapiens EST AW501675 (NID:g7115429)" FT misc_feature 6770193..6770358 FT /note="similar to Homo sapiens EST BG472367 FT (NID:g13404642)" FT misc_feature 6770221..6770509 FT /note="match to EST BE833769 (NID:g10266147)" FT repeat_region 6770323..6770448 FT /rpt_family="MIR" FT misc_feature 6770335..6770733 FT /note="similar to Homo sapiens EST AW885648 (NID:g8047660)" FT misc_feature 6770368..6770565 FT /note="similar to Homo sapiens EST BF836998 FT (NID:g12189157)" FT repeat_region 6770628..6770932 FT /rpt_family="Alu" FT repeat_region 6771101..6771122 FT /rpt_family="(T)n" FT misc_feature 6771126..6771529 FT /note="similar to Homo sapiens EST W86048 (NID:g1398478) FT zh57d06.s1" FT misc_feature 6771151..6771598 FT /note="similar to Homo sapiens EST AA769080 (NID:g2820318) FT oa74d08.s1" FT misc_feature 6771220..6771598 FT /note="similar to Homo sapiens EST AW390296 (NID:g6894955)" FT misc_feature 6771304..6771565 FT /note="match to EST AA218750 (NID:g1832851) zq14e07.r1" FT repeat_region 6771321..6771378 FT /rpt_family="Alu" FT misc_feature 6771398..6771598 FT /note="similar to Homo sapiens EST AA078649 (NID:g1838144)" FT misc_feature 6771484..6771565 FT /note="similar to Homo sapiens EST BE676053 FT (NID:g10036594)" FT misc_feature 6771484..6771598 FT /note="similar to Homo sapiens EST BE560142 (NID:g9803774)" FT misc_feature 6771493..6771590 FT /note="similar to Homo sapiens EST AL521317 FT (NID:g12784810)" FT misc_feature 6771506..6771587 FT /note="similar to EST BG831530 (NID:g14179117)" FT misc_feature 6771527..6771598 FT /note="similar to Homo sapiens EST AL561205 FT (NID:g12908402)" FT /note="similar to Homo sapiens EST BG330691 FT (NID:g13137129)" FT misc_feature 6771528..6771586 FT /note="similar to EST BG681324 (NID:g13912721)" FT /note="similar to Homo sapiens EST BG472367 FT (NID:g13404642)" FT repeat_region 6771664..6771965 FT /rpt_family="Alu" FT misc_feature 6771912..6772345 FT /note="similar to Homo sapiens EST BF826087 FT (NID:g12169062)" FT misc_feature 6771921..6772262 FT /note="match to EST AW809316 (NID:g7902310)" FT repeat_region 6772152..6772535 FT /rpt_family="MaLR" FT misc_feature 6772281..6772353 FT /note="similar to Homo sapiens EST BF381901 FT (NID:g11363204)" FT misc_feature 6772475..6772794 FT /note="similar to Homo sapiens EST BF754129 FT (NID:g12080805)" FT misc_feature 6772477..6772979 FT /note="similar to Homo sapiens EST BF381901 FT (NID:g11363204)" FT misc_feature 6772481..6772798 FT /note="similar to Homo sapiens EST AA322269 (NID:g1974841)" FT repeat_region 6772971..6773148 FT /rpt_family="L2" FT misc_feature 6773030..6773158 FT /note="similar to EST BG681324 (NID:g13912721)" FT /note="similar to Homo sapiens EST BG472367 FT (NID:g13404642)" FT repeat_region 6773192..6773217 FT /rpt_family="(TTCTG)n" FT repeat_region 6773206..6773522 FT /rpt_family="Alu" FT repeat_region 6773524..6773640 FT /rpt_family="Alu" FT repeat_region 6773663..6773694 FT /rpt_family="AT_rich" FT repeat_region 6773871..6774172 FT /rpt_family="Alu" FT repeat_region 6774199..6774350 FT /rpt_family="L1" FT repeat_region 6774361..6774673 FT /rpt_family="Alu" FT repeat_region 6774644..6774678 FT /rpt_family="(A)n" FT repeat_region 6774684..6774826 FT /rpt_family="Alu" FT misc_feature 6774916..6775131 FT /note="similar to EST BG720607 (NID:g13999794)" FT misc_feature 6774936..6775020 FT /note="similar to EST BG681324 (NID:g13912721)" FT /note="similar to Homo sapiens EST BG472367 FT (NID:g13404642)" FT misc_feature 6775002..6775020 FT /note="match to EST AA151500 (NID:g1720112) zl27b02.r1" FT repeat_region 6775181..6775476 FT /rpt_family="Alu" FT repeat_region 6775477..6775744 FT /rpt_family="L1" FT repeat_region 6775745..6776024 FT /rpt_family="Alu" FT repeat_region 6776025..6776247 FT /rpt_family="L1" FT repeat_region 6776248..6776274 FT /rpt_family="(T)n" FT misc_feature 6776377..6776876 FT /note="match to EST BE147951 (NID:g8610675)" FT repeat_region 6776554..6776640 FT /rpt_family="L1" FT misc_feature 6776646..6777048 FT /note="similar to Homo sapiens EST BG011908 FT (NID:g12460585)" FT misc_feature 6776668..6777210 FT /note="similar to EST BG720607 (NID:g13999794)" FT misc_feature 6776707..6777051 FT /note="similar to EST BG681324 (NID:g13912721)" FT misc_feature 6776707..6776911 FT /note="similar to Homo sapiens EST BG472367 FT (NID:g13404642)" FT misc_feature 6776881..6777534 FT /note="match to EST BE304459 (NID:g9175590)" FT misc_feature 6777076..6777567 FT /note="similar to EST BG829980 (NID:g14177567)" FT misc_feature 6777263..6777567 FT /note="similar to Homo sapiens EST BE090126 (NID:g8480568)" FT misc_feature 6777306..6777567 FT /note="match to EST BE090067 (NID:g8480506)" FT misc_feature 6777306..6777521 FT /note="similar to Homo sapiens EST BF829714 FT (NID:g12175565)" FT misc_feature 6777361..6777542 FT /note="match to EST BG231225 (NID:g12726304)" FT misc_feature 6777380..6777567 FT /note="match to EST BF840055 (NID:g12192495)" FT misc_feature 6777383..6777567 FT /note="match to EST BE884933 (NID:g10333709)" FT misc_feature 6777391..6777567 FT /note="similar to Mus musculus EST BG087717 FT (NID:g12570204)" FT misc_feature 6777544..6777567 FT /note="similar to Homo sapiens EST AA089762 (NID:g1636262)" FT repeat_region 6777581..6777628 FT /rpt_family="(TTTTTA)n" FT repeat_region 6777601..6777910 FT /rpt_family="Alu" FT misc_feature 6777750..6777754 FT /note="match to EST BF327680 (NID:g11298428)" FT repeat_region 6777942..6778109 FT /rpt_family="Alu" FT repeat_region 6778470..6778771 FT /rpt_family="Alu" FT repeat_region 6778902..6779203 FT /rpt_family="Alu" FT repeat_region 6779204..6779262 FT /rpt_family="ERVL" FT repeat_region 6779509..6779782 FT /rpt_family="Alu" FT repeat_region 6780159..6780357 FT /rpt_family="L1" FT repeat_region 6780358..6780667 FT /rpt_family="Alu" FT repeat_region 6780668..6780882 FT /rpt_family="L1" FT repeat_region 6780754..6780781 FT /rpt_family="AT_rich" FT repeat_region 6780900..6781190 FT /rpt_family="Alu" FT misc_feature 6781316..6781488 FT /note="match to EST BE090067 (NID:g8480506)" FT misc_feature 6781316..6781457 FT /note="similar to Homo sapiens EST BE090126 (NID:g8480568)" FT misc_feature 6781316..6781483 FT /note="similar to Homo sapiens EST AA089762 (NID:g1636262)" FT /note="match to EST AA151500 (NID:g1720112) zl27b02.r1" FT /note="similar to Mus musculus EST BG087717 FT (NID:g12570204)" FT /note="match to EST BE884933 (NID:g10333709)" FT /note="match to EST BF840055 (NID:g12192495)" FT /note="similar to EST BG829980 (NID:g14177567)" FT misc_feature 6781341..6781483 FT /note="match to EST BE763779 (NID:g10193703)" FT misc_feature 6781345..6781483 FT /note="match to EST AI092272 (NID:g3427245) oz97e06.x1" FT repeat_region 6781538..6781623 FT /rpt_family="Alu" FT repeat_region 6781671..6781803 FT /rpt_family="Alu" FT repeat_region 6781804..6782114 FT /rpt_family="Alu" FT repeat_region 6782085..6782127 FT /rpt_family="AT_rich" FT repeat_region 6782115..6782284 FT /rpt_family="Alu" FT misc_feature 6782280..6782686 FT /note="match to EST AW814866 (NID:g7907860)" FT repeat_region 6782378..6782568 FT /rpt_family="MIR" FT repeat_region 6782765..6783085 FT /rpt_family="Alu" FT repeat_region 6783056..6783102 FT /rpt_family="AT_rich" FT misc_feature 6783287..6783534 FT /note="match to EST AW797314 (NID:g7849184)" FT repeat_region 6783627..6783928 FT /rpt_family="Alu" FT misc_feature 6783917..6784198 FT /note="match to EST AA308495 (NID:g1960844)" FT misc_feature 6783948..6784199 FT /note="match to EST BF327680 (NID:g11298428)" FT repeat_region 6784266..6784585 FT /rpt_family="L2" FT repeat_region 6784586..6784724 FT /rpt_family="Alu" FT misc_feature 6784852..6784854 FT /note="match to EST AA151555 (NID:g1720060) zl27b02.s1" FT repeat_region 6785004..6785179 FT /rpt_family="Alu" FT repeat_region 6785187..6785213 FT /rpt_family="(T)n" FT misc_feature 6785715..6785819 FT /note="match to EST AI831722 (NID:g5452383) wj09f10.x1" FT misc_feature 6785719..6785778 FT /note="similar to Homo sapiens EST AA089762 (NID:g1636262)" FT misc_feature 6785719..6785819 FT /note="match to EST AI092272 (NID:g3427245) oz97e06.x1" FT /note="match to EST BE763779 (NID:g10193703)" FT /note="match to EST AA151500 (NID:g1720112) zl27b02.r1" FT /note="similar to Mus musculus EST BG087717 FT (NID:g12570204)" FT /note="match to EST BE884933 (NID:g10333709)" FT /note="similar to EST BG829980 (NID:g14177567)" FT misc_feature 6785721..6785726 FT /note="similar to Homo sapiens EST AW752330 (NID:g7667262)" FT misc_feature 6785728..6785819 FT /note="match to EST D81337 (NID:g1179214)" FT repeat_region 6785845..6786144 FT /rpt_family="Alu" FT repeat_region 6786206..6786235 FT /rpt_family="AT_rich" FT repeat_region 6786287..6786585 FT /rpt_family="Alu" FT misc_feature 6786634..6786836 FT /note="match to EST AI831722 (NID:g5452383) wj09f10.x1" FT misc_feature 6786666..6786836 FT /note="similar to Bos taurus EST BF600780 (NID:g11698001)" FT misc_feature 6786667..6786838 FT /note="similar to Mus musculus EST BG087717 FT (NID:g12570204)" FT misc_feature 6786667..6786836 FT /note="match to EST BE763779 (NID:g10193703)" FT /note="match to EST AA151500 (NID:g1720112) zl27b02.r1" FT /note="match to EST BE884933 (NID:g10333709)" FT misc_feature 6786667..6786817 FT /note="match to EST BF840055 (NID:g12192495)" FT misc_feature 6786667..6786815 FT /note="similar to EST BG829980 (NID:g14177567)" FT misc_feature 6786710..6786836 FT /note="match to EST AI092272 (NID:g3427245) oz97e06.x1" FT /note="match to EST D81337 (NID:g1179214)" FT misc_feature 6786722..6786836 FT /note="match to EST AA151555 (NID:g1720060) zl27b02.s1" FT misc_feature 6786782..6786836 FT /note="match to EST BF529849 (NID:g11617212)" FT repeat_region 6787070..6787367 FT /rpt_family="Alu" FT misc_feature 6787085..6787824 FT /note="match to EST BE735961 (NID:g10149953)" FT repeat_region 6787375..6787635 FT /rpt_family="Alu" FT repeat_region 6787976..6788169 FT /rpt_family="L2" FT misc_feature 6787992..6787997 FT /note="similar to Homo sapiens EST BE090126 (NID:g8480568)" FT repeat_region 6788170..6788462 FT /rpt_family="Alu" FT repeat_region 6788463..6788584 FT /rpt_family="L2" FT repeat_region 6788585..6788884 FT /rpt_family="Alu" FT repeat_region 6788885..6788967 FT /rpt_family="L2" FT repeat_region 6789222..6789305 FT /rpt_family="L2" FT repeat_region 6789338..6789604 FT /rpt_family="Alu" FT repeat_region 6790288..6790665 FT /rpt_family="L2" FT misc_feature 6790642..6790924 FT /note="match to EST BF931584 (NID:g12348908)" FT misc_feature 6790787..6791155 FT /note="match to EST AA782931 (NID:g2842262) ai62d09.s1" FT misc_feature 6790880..6791149 FT /note="match to EST AI831722 (NID:g5452383) wj09f10.x1" FT misc_feature 6790880..6791156 FT /note="match to EST AA151555 (NID:g1720060) zl27b02.s1" FT /note="match to EST AI092272 (NID:g3427245) oz97e06.x1" FT misc_feature 6790880..6791375 FT /note="match to EST BF529849 (NID:g11617212)" FT misc_feature 6790880..6791024 FT /note="similar to Bos taurus EST BF600780 (NID:g11698001)" FT misc_feature 6790880..6791040 FT /note="match to EST D81337 (NID:g1179214)" FT misc_feature 6790880..6791028 FT /note="match to EST BE763779 (NID:g10193703)" FT misc_feature 6790880..6790884 FT /note="match to EST AA151500 (NID:g1720112) zl27b02.r1" FT misc_feature 6790880..6790987 FT /note="match to EST BE884933 (NID:g10333709)" FT repeat_region 6791281..6791593 FT /rpt_family="Alu" FT misc_feature 6791457..6791458 FT /note="match to EST BE763779 (NID:g10193703)" FT repeat_region 6791566..6791604 FT /rpt_family="(CAAAA)n" FT misc_feature 6791593..6792018 FT /note="match to EST AA113775 (NID:g1667696) zn66e07.r1" FT misc_feature 6791604..6792045 FT /note="match to EST AV708293 (NID:g10725558)" FT misc_feature 6791756..6792638 FT /note="similar to EST BG832185 (NID:g14179772)" FT misc_feature 6791774..6792066 FT /note="match to EST AW269204 (NID:g6656234) xs34c04.x1" FT misc_feature 6791882..6792100 FT /note="match to EST F08204 (NID:g677718)" FT misc_feature 6792018..6792356 FT /note="match to EST T31476 (NID:g613574)" FT misc_feature 6792050..6792426 FT /note="match to EST AA112409 (NID:g1664952) zn66e07.s1" FT misc_feature 6792081..6792935 FT /note="match to EST AL157580 (NID:g7057981)" FT misc_feature 6792100..6792330 FT /note="match to EST AV708293 (NID:g10725558)" FT repeat_region 6792268..6792374 FT /rpt_family="MaLR" FT repeat_region 6792375..6792674 FT /rpt_family="Alu" FT repeat_region 6792675..6792849 FT /rpt_family="MaLR" FT repeat_region 6792850..6793375 FT /rpt_family="MER1_type" FT repeat_region 6793376..6793539 FT /rpt_family="MaLR" FT misc_feature 6793740..6793805 FT /note="similar to EST BG722304 (NID:g14001491)" FT misc_feature 6793755..6793805 FT /note="similar to EST BG717722 (NID:g13996922)" FT misc_feature 6793791..6794140 FT /note="similar to Homo sapiens EST AA021177 (NID:g1485372) FT ze67d05.r1" FT repeat_region 6794240..6794529 FT /rpt_family="Alu" FT misc_feature 6794270..6794294 FT /note="match to EST BG396956 (NID:g13290404)" FT repeat_region 6795129..6795262 FT /rpt_family="Alu" FT repeat_region 6795246..6795281 FT /rpt_family="(A)n" FT repeat_region 6795284..6795600 FT /rpt_family="Alu" FT misc_feature 6795572..6795587 FT /note="match to EST BF508762 (NID:g11592060)" FT repeat_region 6795628..6795929 FT /rpt_family="Alu" FT repeat_region 6795903..6795929 FT /rpt_family="(TAAA)n" FT repeat_region 6796013..6796315 FT /rpt_family="Alu" FT repeat_region 6796445..6796738 FT /rpt_family="Alu" FT misc_feature 6796673..6796711 FT /note="match to EST AA112409 (NID:g1664952) zn66e07.s1" FT repeat_region 6796719..6796743 FT /rpt_family="AT_rich" FT repeat_region 6796815..6797103 FT /rpt_family="Alu" FT misc_feature 6796988..6797107 FT /note="similar to EST BG722304 (NID:g14001491)" FT misc_feature 6797224..6797320 FT /note="similar to Homo sapiens EST AA021177 (NID:g1485372) FT ze67d05.r1" FT misc_feature 6797224..6797562 FT /note="similar to EST BG722304 (NID:g14001491)" FT misc_feature 6797563..6797568 FT /note="match to EST T31476 (NID:g613574)" FT repeat_region 6797611..6797909 FT /rpt_family="Alu" FT repeat_region 6797917..6797951 FT /rpt_family="AT_rich" FT repeat_region 6797942..6798049 FT /rpt_family="L1" FT repeat_region 6798078..6798175 FT /rpt_family="L1" FT repeat_region 6798194..6798510 FT /rpt_family="Alu" FT repeat_region 6798581..6798601 FT /rpt_family="(TA)n" FT misc_feature 6798715..6798790 FT /note="similar to EST BG722304 (NID:g14001491)" FT repeat_region 6798987..6799306 FT /rpt_family="Alu" FT repeat_region 6799162..6799188 FT /rpt_family="AT_rich" FT repeat_region 6799514..6799798 FT /rpt_family="Alu" FT misc_feature 6799515..6799552 FT /note="similar to Homo sapiens EST BE304791 (NID:g9176305)" FT misc_feature 6799850..6800191 FT /note="match to EST AA601443 (NID:g2435068) no17b09.s1" FT misc_feature 6799857..6799925 FT /note="similar to EST BG722304 (NID:g14001491)" FT repeat_region 6800183..6800266 FT /rpt_family="Alu" FT repeat_region 6800347..6800642 FT /rpt_family="Alu" FT repeat_region 6800494..6800524 FT /rpt_family="AT_rich" FT misc_feature 6801120..6801125 FT /note="similar to Homo sapiens EST AA343510 (NID:g1995749)" FT repeat_region 6801202..6801502 FT /rpt_family="Alu" FT repeat_region 6801932..6802235 FT /rpt_family="Alu" FT repeat_region 6802300..6802457 FT /rpt_family="Alu" FT repeat_region 6802458..6802764 FT /rpt_family="Alu" FT repeat_region 6802765..6802777 FT /rpt_family="Alu" FT repeat_region 6802778..6803091 FT /rpt_family="Alu" FT repeat_region 6803092..6803212 FT /rpt_family="Alu" FT misc_feature 6803559..6803732 FT /note="similar to EST BG717722 (NID:g13996922)" FT misc_feature 6803559..6803626 FT /note="similar to EST BG722304 (NID:g14001491)" FT repeat_region 6803752..6803916 FT /rpt_family="G-rich" FT repeat_region 6803987..6804009 FT /rpt_family="AT_rich" FT repeat_region 6803988..6804292 FT /rpt_family="Alu" FT repeat_region 6804340..6804370 FT /rpt_family="(TG)n" FT repeat_region 6804803..6805101 FT /rpt_family="Alu" FT repeat_region 6805553..6805666 FT /rpt_family="Alu" FT repeat_region 6805667..6805722 FT /rpt_family="Alu" FT repeat_region 6805758..6805779 FT /rpt_family="AT_rich" FT repeat_region 6805875..6805906 FT /rpt_family="AT_rich" FT repeat_region 6805887..6806064 FT /rpt_family="Alu" FT repeat_region 6806105..6806241 FT /rpt_family="Alu" FT misc_feature 6806388..6806508 FT /note="similar to EST BG717722 (NID:g13996922)" FT repeat_region 6806577..6806904 FT /rpt_family="Alu" FT repeat_region 6806589..6806609 FT /rpt_family="(TTTTTG)n" FT repeat_region 6806908..6807213 FT /rpt_family="Alu" FT repeat_region 6807221..6807516 FT /rpt_family="Alu" FT repeat_region 6807377..6807401 FT /rpt_family="AT_rich" FT repeat_region 6807548..6807842 FT /rpt_family="Alu" FT repeat_region 6807813..6807833 FT /rpt_family="AT_rich" FT repeat_region 6807913..6807965 FT /rpt_family="Alu" FT repeat_region 6807966..6808117 FT /rpt_family="MIR" FT misc_feature 6808221..6808270 FT /note="similar to EST BG717722 (NID:g13996922)" FT repeat_region 6808466..6808632 FT /rpt_family="L1" FT repeat_region 6808633..6808934 FT /rpt_family="Alu" FT repeat_region 6808935..6809006 FT /rpt_family="L1" FT repeat_region 6809010..6809132 FT /rpt_family="L1" FT repeat_region 6809220..6809509 FT /rpt_family="Alu" FT repeat_region 6809386..6809409 FT /rpt_family="(T)n" FT repeat_region 6809575..6809603 FT /rpt_family="(TG)n" FT repeat_region 6809668..6809936 FT /rpt_family="MaLR" FT repeat_region 6809960..6810253 FT /rpt_family="Alu" FT misc_feature 6810237..6810254 FT /note="similar to Homo sapiens EST AA973626 (NID:g3148806) FT oo48a07.s1" FT repeat_region 6810259..6810544 FT /rpt_family="Alu" FT repeat_region 6810649..6810700 FT /rpt_family="GA-rich" FT repeat_region 6810813..6811117 FT /rpt_family="Alu" FT misc_feature 6811163..6811322 FT /note="similar to EST BG717722 (NID:g13996922)" FT repeat_region 6811358..6811671 FT /rpt_family="Alu" FT repeat_region 6811472..6811493 FT /rpt_family="AT_rich" FT repeat_region 6811774..6811922 FT /rpt_family="Alu" FT repeat_region 6811923..6812217 FT /rpt_family="Alu" FT repeat_region 6812218..6812362 FT /rpt_family="Alu" FT repeat_region 6812384..6812519 FT /rpt_family="Alu" FT repeat_region 6812632..6812930 FT /rpt_family="Alu" FT misc_feature 6812913..6812926 FT /note="similar to Homo sapiens EST AA782132 (NID:g2841463) FT ai48e06.s1" FT misc_feature 6812981..6813102 FT /note="similar to EST BG717722 (NID:g13996922)" FT misc_feature 6813058..6813102 FT /note="similar to Bos taurus EST AW437628 (NID:g6972934)" FT repeat_region 6813178..6813477 FT /rpt_family="Alu" FT repeat_region 6813814..6814107 FT /rpt_family="Alu" FT repeat_region 6814120..6814376 FT /rpt_family="L1" FT repeat_region 6814377..6814402 FT /rpt_family="(T)n" FT repeat_region 6814561..6814847 FT /rpt_family="Alu" FT repeat_region 6814848..6814995 FT /rpt_family="Alu" FT repeat_region 6814996..6815079 FT /rpt_family="L1" FT repeat_region 6815242..6815540 FT /rpt_family="Alu" FT repeat_region 6815637..6815657 FT /rpt_family="AT_rich" FT repeat_region 6815654..6815946 FT /rpt_family="Alu" FT misc_feature 6815772..6816233 FT /note="match to EST AW872691 (NID:g8006744) hm26g04.x1" FT misc_feature 6815988..6816177 FT /note="similar to Bos taurus EST AW437628 (NID:g6972934)" FT misc_feature 6815988..6816094 FT /note="similar to EST BG717722 (NID:g13996922)" FT repeat_region 6816226..6816508 FT /rpt_family="Alu" FT repeat_region 6816505..6816558 FT /rpt_family="(CA)n" FT repeat_region 6816564..6816673 FT /rpt_family="MER1_type" FT repeat_region 6816674..6816986 FT /rpt_family="Alu" FT repeat_region 6816676..6816704 FT /rpt_family="(TTTTG)n" FT repeat_region 6816987..6817425 FT /rpt_family="MER1_type" FT repeat_region 6817617..6817829 FT /rpt_family="MER1_type" FT repeat_region 6817893..6818177 FT /rpt_family="Alu" FT repeat_region 6818179..6818472 FT /rpt_family="Alu" FT repeat_region 6818786..6819082 FT /rpt_family="Alu" FT misc_feature 6819241..6819355 FT /note="similar to Bos taurus EST AW437628 (NID:g6972934)" FT repeat_region 6819443..6819752 FT /rpt_family="Alu" FT repeat_region 6819606..6819633 FT /rpt_family="(T)n" FT repeat_region 6819985..6820032 FT /rpt_family="AT_rich" FT repeat_region 6820022..6820306 FT /rpt_family="Alu" FT repeat_region 6820313..6820410 FT /rpt_family="MaLR" FT misc_feature 6820489..6820519 FT /note="match to EST AA383247 (NID:g2035661)" FT repeat_region 6820584..6820880 FT /rpt_family="Alu" FT misc_feature 6820959..6821107 FT /note="match to EST AA383247 (NID:g2035661)" FT repeat_region 6821389..6821462 FT /rpt_family="Alu" FT repeat_region 6821501..6821541 FT /rpt_family="(TA)n" FT repeat_region 6821541..6821844 FT /rpt_family="Alu" FT repeat_region 6821895..6822173 FT /rpt_family="Alu" FT repeat_region 6822178..6822252 FT /rpt_family="ERV1" FT repeat_region 6822263..6822523 FT /rpt_family="Alu" FT repeat_region 6822670..6822959 FT /rpt_family="Alu" FT repeat_region 6823110..6823402 FT /rpt_family="Alu" FT repeat_region 6823451..6823471 FT /rpt_family="(TAA)n" FT repeat_region 6823493..6823749 FT /rpt_family="Alu" FT repeat_region 6823750..6823884 FT /rpt_family="L1" FT repeat_region 6823886..6824102 FT /rpt_family="Alu" FT repeat_region 6824178..6824197 FT /rpt_family="MER2_type" FT repeat_region 6824198..6824495 FT /rpt_family="Alu" FT repeat_region 6824496..6824625 FT /rpt_family="MER2_type" FT repeat_region 6824774..6824823 FT /rpt_family="(TG)n" FT repeat_region 6824823..6825107 FT /rpt_family="Alu" FT repeat_region 6825172..6825472 FT /rpt_family="Alu" FT misc_feature 6825580..6825643 FT /note="match to EST AA383247 (NID:g2035661)" FT repeat_region 6825771..6825828 FT /rpt_family="T-rich" FT repeat_region 6825810..6826123 FT /rpt_family="Alu" FT repeat_region 6825978..6826007 FT /rpt_family="AT_rich" FT repeat_region 6826147..6826271 FT /rpt_family="Alu" FT repeat_region 6826323..6826398 FT /rpt_family="(TG)n" FT repeat_region 6826705..6827015 FT /rpt_family="Alu" FT repeat_region 6827121..6827301 FT /rpt_family="Alu" FT repeat_region 6827302..6827602 FT /rpt_family="Alu" FT repeat_region 6827603..6827736 FT /rpt_family="Alu" FT repeat_region 6828062..6828191 FT /rpt_family="Alu" FT repeat_region 6828360..6828607 FT /rpt_family="L1" FT repeat_region 6828631..6828917 FT /rpt_family="Alu" FT repeat_region 6828933..6829061 FT /rpt_family="Alu" FT repeat_region 6829076..6829175 FT /rpt_family="L1" FT repeat_region 6829427..6829532 FT /rpt_family="L2" FT repeat_region 6829606..6829773 FT /rpt_family="MIR" FT repeat_region 6829915..6830284 FT /rpt_family="L2" FT repeat_region 6830287..6830582 FT /rpt_family="Alu" FT repeat_region 6830631..6830932 FT /rpt_family="Alu" FT repeat_region 6831050..6831072 FT /rpt_family="AT_rich" FT repeat_region 6831093..6831394 FT /rpt_family="Alu" FT repeat_region 6831434..6831468 FT /rpt_family="AT_rich" FT repeat_region 6831713..6831849 FT /rpt_family="Alu" FT repeat_region 6832394..6832687 FT /rpt_family="Alu" FT repeat_region 6832699..6832982 FT /rpt_family="Alu" FT repeat_region 6833195..6833499 FT /rpt_family="Alu" FT repeat_region 6834485..6834779 FT /rpt_family="Alu" FT repeat_region 6835122..6835392 FT /rpt_family="Alu" FT repeat_region 6835403..6835591 FT /rpt_family="Alu" FT repeat_region 6835669..6835972 FT /rpt_family="Alu" FT repeat_region 6836532..6836624 FT /rpt_family="ERV1" FT repeat_region 6836644..6836931 FT /rpt_family="Alu" FT repeat_region 6836945..6837207 FT /rpt_family="ERV1" FT repeat_region 6837210..6837496 FT /rpt_family="Alu" FT repeat_region 6837498..6837519 FT /rpt_family="(CA)n" FT repeat_region 6837523..6837783 FT /rpt_family="Alu" FT repeat_region 6838323..6838508 FT /rpt_family="Alu" FT gene complement(6838572..6865861) FT /gene="CGI-43" FT mRNA complement(join(6838572..6838910,6840579..6840706, FT 6840996..6841154,6844569..6844686,6845635..6845668, FT 6851583..6851694,6852607..6852668,6854395..6854476, FT 6859397..6859572,6861912..6861995,6862944..6862991, FT 6863720..6863797,6864086..6864179,6864271..6864368, FT 6865709..6865861)) FT /gene="CGI-43" FT CDS complement(join(6838855..6838910,6840579..6840706, FT 6840996..6841154,6844569..6844686,6845635..6845668, FT 6851583..6851694,6852607..6852668,6854395..6854476, FT 6859397..6859572,6861912..6861995,6862944..6862991, FT 6863720..6863797,6864086..6864179,6864271..6864368, FT 6865709..6865828)) FT /codon_start=1 FT /gene="CGI-43" FT /product="unknown" FT /note="Homo sapiens, CGI-43 protein, clone MGC:19819 FT IMAGE:3953739, mRNA, complete cds.; H_NH0577O18.1" FT /protein_id="AAQ93370.1" FT /translation="MAAAAAGAGSGPWAAQEKQFPPALLSFFIYNPRFGPREGQEENKI FT LFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVM FT VVRNPIIEKQSKDGKPVIEYQEEELLDKVYSSVLRQCYSMYKLFNGTFLKAMEDGGVKL FT LKERLEKFFHRYLQTLHLQSCDLLDIFGGISFFPLDKMTYLKIQSFINRMEESLNIVKY FT TAFLYNDQLIWSGLEQDDMRILYKYLTTSLFPRHIEPELAGRDSPIRAEMPGNLQHYGR FT FLTGPLNLNDPDAKCRFPKIFVNTDDTYEELHLIVYKAMSAAVCFMIDASVHPTLDFCR FT RLDSIVGPQLTVLASDICEQFNINKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPS FT VSLTSVHPDLMKILGDINSDFTRVDEDEEIIVKAMSDYWVVGKKSDRRELYVILNQKNA FT NLIEVNEEVKKLCATQFNNIFFLD" FT repeat_region 6839054..6839327 FT /rpt_family="Alu" FT repeat_region 6840010..6840307 FT /rpt_family="Alu" FT repeat_region 6841206..6841504 FT /rpt_family="Alu" FT repeat_region 6841510..6841687 FT /rpt_family="MER1_type" FT repeat_region 6842388..6842697 FT /rpt_family="Alu" FT repeat_region 6842872..6843186 FT /rpt_family="Alu" FT repeat_region 6843313..6843605 FT /rpt_family="Alu" FT repeat_region 6843774..6844064 FT /rpt_family="Alu" FT repeat_region 6844963..6845141 FT /rpt_family="MIR" FT repeat_region 6845248..6845532 FT /rpt_family="Alu" FT repeat_region 6846590..6846675 FT /rpt_family="L1" FT repeat_region 6846676..6846985 FT /rpt_family="Alu" FT repeat_region 6846986..6847418 FT /rpt_family="L1" FT repeat_region 6847419..6847543 FT /rpt_family="T2_type" FT repeat_region 6847544..6847745 FT /rpt_family="L1" FT repeat_region 6847773..6847982 FT /rpt_family="ERVL" FT repeat_region 6848008..6848047 FT /rpt_family="(A)n" FT repeat_region 6848054..6848086 FT /rpt_family="(CAAAC)n" FT repeat_region 6848091..6848199 FT /rpt_family="ERVL" FT repeat_region 6848246..6848352 FT /rpt_family="MER2_type" FT repeat_region 6848353..6848639 FT /rpt_family="Alu" FT repeat_region 6848640..6848794 FT /rpt_family="MER2_type" FT repeat_region 6848803..6848867 FT /rpt_family="ERVL" FT repeat_region 6848922..6849005 FT /rpt_family="L1" FT repeat_region 6849475..6849643 FT /rpt_family="L1" FT repeat_region 6849644..6849939 FT /rpt_family="Alu" FT repeat_region 6849940..6850068 FT /rpt_family="L1" FT repeat_region 6850091..6850363 FT /rpt_family="Alu" FT repeat_region 6851838..6852151 FT /rpt_family="Alu" FT repeat_region 6852272..6852572 FT /rpt_family="Alu" FT repeat_region 6852766..6852934 FT /rpt_family="Alu" FT repeat_region 6852935..6853146 FT /rpt_family="Alu" FT repeat_region 6853495..6853834 FT /rpt_family="Alu" FT repeat_region 6853886..6854091 FT /rpt_family="Alu" FT repeat_region 6854133..6854180 FT /rpt_family="(CAAA)n" FT repeat_region 6854794..6855093 FT /rpt_family="Alu" FT repeat_region 6855097..6855241 FT /rpt_family="Alu" FT repeat_region 6855829..6856127 FT /rpt_family="Alu" FT repeat_region 6856187..6856324 FT /rpt_family="Alu" FT repeat_region 6856389..6856692 FT /rpt_family="Alu" FT repeat_region 6857364..6857650 FT /rpt_family="Alu" FT repeat_region 6857898..6858175 FT /rpt_family="Alu" FT repeat_region 6858178..6858361 FT /rpt_family="(GAAA)n" FT repeat_region 6858639..6858775 FT /rpt_family="Alu" FT repeat_region 6858869..6859164 FT /rpt_family="Alu" FT repeat_region 6859817..6860107 FT /rpt_family="Alu" FT repeat_region 6860113..6860245 FT /rpt_family="Alu" FT repeat_region 6860271..6860563 FT /rpt_family="Alu" FT repeat_region 6860658..6860940 FT /rpt_family="Alu" FT repeat_region 6861237..6861345 FT /rpt_family="Alu" FT repeat_region 6862329..6862636 FT /rpt_family="Alu" FT repeat_region 6863144..6863449 FT /rpt_family="Alu" FT repeat_region 6863679..6863701 FT /rpt_family="AT_rich" FT repeat_region 6864512..6864603 FT /rpt_family="Alu" FT repeat_region 6864869..6865180 FT /rpt_family="Alu" FT repeat_region 6865273..6865295 FT /rpt_family="(CA)n" FT misc_feature 6865511..6866094 FT /note="CpG_island (%GC=69.5, o/e=0.81, #CpGs=61)" FT repeat_region 6865671..6865699 FT /rpt_family="GC_rich" FT repeat_region 6865783..6865819 FT /rpt_family="GC_rich" FT repeat_region 6866102..6866396 FT /rpt_family="Alu" FT repeat_region 6866431..6866678 FT /rpt_family="Alu" FT repeat_region 6866707..6867207 FT /rpt_family="ERV1" FT repeat_region 6867213..6867259 FT /rpt_family="Alu" FT repeat_region 6867265..6867578 FT /rpt_family="Alu" FT repeat_region 6867644..6867935 FT /rpt_family="Alu" FT repeat_region 6868402..6868577 FT /rpt_family="MIR" FT repeat_region 6868678..6868997 FT /rpt_family="Alu" FT repeat_region 6869905..6870213 FT /rpt_family="Alu" FT repeat_region 6870283..6870389 FT /rpt_family="(TA)n" FT repeat_region 6870392..6870535 FT /rpt_family="Alu" FT repeat_region 6870554..6870660 FT /rpt_family="L2" FT repeat_region 6871071..6871310 FT /rpt_family="Alu" FT repeat_region 6871438..6871747 FT /rpt_family="Alu" FT repeat_region 6872562..6872738 FT /rpt_family="Alu" FT repeat_region 6872743..6872765 FT /rpt_family="AT_rich" FT repeat_region 6872809..6874384 FT /rpt_family="SATR2" FT repeat_region 6875870..6876178 FT /rpt_family="Alu" FT repeat_region 6876407..6876709 FT /rpt_family="Alu" FT repeat_region 6876768..6876871 FT /rpt_family="L2" FT repeat_region 6877264..6877575 FT /rpt_family="Alu" FT repeat_region 6878210..6878428 FT /rpt_family="Alu" FT repeat_region 6878430..6879950 FT /rpt_family="SATR2" FT repeat_region 6879924..6882001 FT /rpt_family="SATR1" FT repeat_region 6886434..6888555 FT /rpt_family="SATR1" FT repeat_region 6888565..6888721 FT /rpt_family="(TAA)n" FT repeat_region 6888738..6888916 FT /rpt_family="(TAA)n" FT repeat_region 6888936..6889967 FT /rpt_family="SATR1" FT repeat_region 6889972..6890277 FT /rpt_family="MaLR" FT repeat_region 6890295..6890574 FT /rpt_family="Alu" FT repeat_region 6890585..6890700 FT /rpt_family="Alu" FT repeat_region 6890701..6890770 FT /rpt_family="(TAAAA)n" FT repeat_region 6890773..6890895 FT /rpt_family="MaLR" FT repeat_region 6890943..6891151 FT /rpt_family="L1" FT repeat_region 6891152..6891440 FT /rpt_family="Alu" FT repeat_region 6891441..6891851 FT /rpt_family="L1" FT repeat_region 6891852..6891878 FT /rpt_family="(TTTTA)n" FT repeat_region 6891884..6892169 FT /rpt_family="Alu" FT repeat_region 6892170..6892259 FT /rpt_family="L1" FT repeat_region 6892327..6892641 FT /rpt_family="Alu" FT misc_feature 6894260..6895545 FT /note="CpG_island (%GC=71.6, o/e=0.83, #CpGs=120)" FT repeat_region 6895810..6895882 FT /rpt_family="MER1_type" FT repeat_region 6895962..6896208 FT /rpt_family="Alu" FT repeat_region 6896221..6896534 FT /rpt_family="Alu" FT repeat_region 6896554..6896867 FT /rpt_family="Alu" FT repeat_region 6897832..6897960 FT /rpt_family="MIR" FT repeat_region 6899866..6900880 FT /rpt_family="ERVK" FT repeat_region 6901338..6901368 FT /rpt_family="AT_rich" FT repeat_region 6901389..6901500 FT /rpt_family="L1" FT repeat_region 6901501..6901521 FT /rpt_family="AT_rich" FT repeat_region 6901522..6901729 FT /rpt_family="L1" FT repeat_region 6901730..6901961 FT /rpt_family="L1" FT repeat_region 6901962..6902112 FT /rpt_family="L1" FT repeat_region 6902113..6902395 FT /rpt_family="Alu" FT repeat_region 6902396..6902491 FT /rpt_family="L1" FT repeat_region 6902492..6902816 FT /rpt_family="Alu" FT repeat_region 6902817..6903800 FT /rpt_family="L1" FT repeat_region 6903846..6904154 FT /rpt_family="Alu" FT repeat_region 6904233..6904436 FT /rpt_family="L1" FT repeat_region 6904437..6904720 FT /rpt_family="Alu" FT repeat_region 6904721..6904903 FT /rpt_family="L1" FT repeat_region 6904946..6905084 FT /rpt_family="Tc2" FT repeat_region 6905090..6905414 FT /rpt_family="Alu" FT repeat_region 6905558..6905706 FT /rpt_family="MER1_type" FT repeat_region 6905812..6906009 FT /rpt_family="MER2_type" FT repeat_region 6907897..6908115 FT /rpt_family="Alu" FT repeat_region 6908117..6908508 FT /rpt_family="SATR2" FT repeat_region 6908479..6910858 FT /rpt_family="SATR1" FT repeat_region 6914967..6915156 FT /rpt_family="(TAA)n" FT repeat_region 6915256..6916110 FT /rpt_family="SATR1" FT repeat_region 6916090..6918722 FT /rpt_family="SATR2" FT repeat_region 6918742..6919183 FT /rpt_family="SATR2" FT repeat_region 6919730..6919752 FT /rpt_family="(CAAA)n" FT repeat_region 6920900..6921201 FT /rpt_family="Alu" FT repeat_region 6921260..6921395 FT /rpt_family="L2" FT repeat_region 6921760..6922073 FT /rpt_family="Alu" FT repeat_region 6922468..6922681 FT /rpt_family="MIR" FT repeat_region 6923006..6924020 FT /rpt_family="ERVK" FT repeat_region 6924480..6924511 FT /rpt_family="AT_rich" FT repeat_region 6924532..6924782 FT /rpt_family="L1" FT repeat_region 6924783..6925073 FT /rpt_family="Alu" FT repeat_region 6925074..6925169 FT /rpt_family="L1" FT repeat_region 6925189..6925510 FT /rpt_family="Alu" FT repeat_region 6925575..6925628 FT /rpt_family="(TA)n" FT repeat_region 6925629..6925698 FT /rpt_family="(GA)n" FT repeat_region 6925700..6925978 FT /rpt_family="Alu" FT repeat_region 6926164..6926282 FT /rpt_family="MER1_type" FT repeat_region 6926304..6926384 FT /rpt_family="L2" FT repeat_region 6926385..6926437 FT /rpt_family="Mariner" FT repeat_region 6926438..6926736 FT /rpt_family="Alu" FT repeat_region 6926737..6926775 FT /rpt_family="Mariner" FT repeat_region 6926776..6927244 FT /rpt_family="L2" FT repeat_region 6927552..6927612 FT /rpt_family="MIR" FT repeat_region 6928732..6928911 FT /rpt_family="(CA)n" FT repeat_region 6928952..6929129 FT /rpt_family="(CA)n" FT repeat_region 6929191..6929356 FT /rpt_family="(CA)n" FT repeat_region 6930407..6930553 FT /rpt_family="L2" FT repeat_region 6930697..6930835 FT /rpt_family="MIR" FT repeat_region 6930858..6930939 FT /rpt_family="MaLR" FT repeat_region 6930940..6930964 FT /rpt_family="(TCTCTG)n" FT repeat_region 6930965..6931141 FT /rpt_family="MaLR" FT repeat_region 6931542..6931904 FT /rpt_family="MaLR" FT repeat_region 6933145..6933466 FT /rpt_family="Alu" FT repeat_region 6933806..6933940 FT /rpt_family="Alu" FT repeat_region 6934331..6934349 FT /rpt_family="L1" FT repeat_region 6934350..6934655 FT /rpt_family="Alu" FT repeat_region 6934656..6934770 FT /rpt_family="L1" FT repeat_region 6934779..6934837 FT /rpt_family="GA-rich" FT repeat_region 6935558..6935621 FT /rpt_family="L1" FT repeat_region 6935622..6935910 FT /rpt_family="Alu" FT repeat_region 6935911..6936272 FT /rpt_family="L1" FT repeat_region 6936278..6936535 FT /rpt_family="Alu" FT repeat_region 6936537..6936558 FT /rpt_family="(TA)n" FT repeat_region 6937926..6937978 FT /rpt_family="MIR" FT repeat_region 6938117..6938277 FT /rpt_family="L2" FT repeat_region 6938279..6938585 FT /rpt_family="Alu" FT repeat_region 6938596..6938782 FT /rpt_family="Alu" FT repeat_region 6938791..6938928 FT /rpt_family="Alu" FT repeat_region 6939311..6939619 FT /rpt_family="Alu" FT repeat_region 6940458..6941255 FT /rpt_family="ERV1" FT repeat_region 6941585..6941627 FT /rpt_family="MaLR" FT repeat_region 6941628..6942594 FT /rpt_family="ERVK" FT repeat_region 6942595..6942969 FT /rpt_family="MaLR" FT repeat_region 6943422..6943831 FT /rpt_family="ERV1" FT repeat_region 6946807..6946954 FT /rpt_family="ERV1" FT repeat_region 6946945..6947447 FT /rpt_family="ERV1" FT repeat_region 6947447..6947618 FT /rpt_family="ERV1" FT repeat_region 6947622..6947836 FT /rpt_family="ERV1" FT repeat_region 6947837..6948213 FT /rpt_family="ERV1" FT repeat_region 6948215..6948623 FT /rpt_family="ERV1" FT repeat_region 6949312..6949433 FT /rpt_family="MaLR" FT repeat_region 6949770..6950085 FT /rpt_family="Alu" FT repeat_region 6950099..6950448 FT /rpt_family="L1" FT repeat_region 6950450..6950528 FT /rpt_family="Alu" FT repeat_region 6950590..6950743 FT /rpt_family="L1" FT repeat_region 6950879..6951021 FT /rpt_family="L2" FT repeat_region 6951022..6951326 FT /rpt_family="Alu" FT repeat_region 6951361..6951556 FT /rpt_family="MaLR" FT repeat_region 6951557..6951870 FT /rpt_family="Alu" FT repeat_region 6951871..6951908 FT /rpt_family="MaLR" FT repeat_region 6951921..6952210 FT /rpt_family="ERV1" FT repeat_region 6952323..6952692 FT /rpt_family="ERV1" FT repeat_region 6952693..6952981 FT /rpt_family="Alu" FT repeat_region 6952982..6953198 FT /rpt_family="ERV1" FT repeat_region 6953203..6953494 FT /rpt_family="Alu" FT repeat_region 6953511..6953711 FT /rpt_family="ERV1" FT repeat_region 6953712..6953907 FT /rpt_family="MaLR" FT repeat_region 6953908..6954202 FT /rpt_family="Alu" FT repeat_region 6954203..6954483 FT /rpt_family="MaLR" FT repeat_region 6954484..6954620 FT /rpt_family="ERV1" FT repeat_region 6954621..6954916 FT /rpt_family="Alu" FT repeat_region 6956448..6956760 FT /rpt_family="Alu" FT repeat_region 6956976..6957138 FT /rpt_family="MER2_type" FT repeat_region 6957201..6957480 FT /rpt_family="Alu" FT repeat_region 6958101..6958219 FT /rpt_family="L2" FT repeat_region 6958392..6958512 FT /rpt_family="AcHobo" FT repeat_region 6958513..6958808 FT /rpt_family="Alu" FT repeat_region 6958813..6959029 FT /rpt_family="ERV1" FT repeat_region 6959030..6959268 FT /rpt_family="Alu" FT repeat_region 6959273..6959376 FT /rpt_family="L1" FT repeat_region 6959377..6959406 FT /rpt_family="AT_rich" FT repeat_region 6959428..6959592 FT /rpt_family="MER1_type" FT repeat_region 6959445..6959600 FT /rpt_family="MER1_type" FT repeat_region 6959714..6959864 FT /rpt_family="MIR" FT repeat_region 6959905..6960059 FT /rpt_family="MaLR" FT repeat_region 6960060..6960359 FT /rpt_family="Alu" FT repeat_region 6960360..6960568 FT /rpt_family="MaLR" FT repeat_region 6961006..6961332 FT /rpt_family="MER1_type" FT repeat_region 6961375..6961396 FT /rpt_family="AT_rich" FT repeat_region 6961401..6961715 FT /rpt_family="Alu" FT repeat_region 6961722..6962030 FT /rpt_family="Alu" FT repeat_region 6962532..6962837 FT /rpt_family="Alu" FT repeat_region 6963647..6963855 FT /rpt_family="MER1_type" FT repeat_region 6964052..6964119 FT /rpt_family="L2" FT repeat_region 6964950..6965238 FT /rpt_family="Alu" FT repeat_region 6965618..6965916 FT /rpt_family="Alu" FT repeat_region 6967146..6967428 FT /rpt_family="Alu" FT repeat_region 6967508..6967815 FT /rpt_family="Alu" FT repeat_region 6967817..6967936 FT /rpt_family="Alu" FT repeat_region 6968473..6968540 FT /rpt_family="Mariner" FT repeat_region 6969774..6969973 FT /rpt_family="MER1_type" FT repeat_region 6971754..6972052 FT /rpt_family="Alu" FT repeat_region 6972054..6972101 FT /rpt_family="(CA)n" FT repeat_region 6972163..6972391 FT /rpt_family="Alu" FT repeat_region 6972392..6972697 FT /rpt_family="Alu" FT repeat_region 6972833..6973005 FT /rpt_family="MER1_type" FT repeat_region 6973084..6973190 FT /rpt_family="Alu" FT repeat_region 6973238..6973543 FT /rpt_family="Alu" FT repeat_region 6973647..6973946 FT /rpt_family="Alu" FT repeat_region 6974220..6974351 FT /rpt_family="MIR" FT repeat_region 6974510..6974576 FT /rpt_family="MIR" FT misc_feature 6974758..6974963 FT /note="CpG_island (%GC=65.5, o/e=0.76, #CpGs=16)" FT repeat_region 6976375..6976572 FT /rpt_family="L1" FT repeat_region 6976630..6976784 FT /rpt_family="Alu" FT repeat_region 6976785..6977081 FT /rpt_family="Alu" FT repeat_region 6977082..6977212 FT /rpt_family="Alu" FT repeat_region 6977292..6977445 FT /rpt_family="MIR" FT repeat_region 6977738..6977855 FT /rpt_family="Alu" FT repeat_region 6978353..6978660 FT /rpt_family="Alu" FT repeat_region 6978710..6978990 FT /rpt_family="ERVL" FT repeat_region 6979936..6980230 FT /rpt_family="Alu" FT repeat_region 6980373..6980493 FT /rpt_family="Alu" FT repeat_region 6980496..6980615 FT /rpt_family="MER1_type" FT repeat_region 6981332..6981639 FT /rpt_family="Alu" FT repeat_region 6981820..6981949 FT /rpt_family="Alu" FT repeat_region 6982311..6982384 FT /rpt_family="ERV1" FT repeat_region 6982464..6982506 FT /rpt_family="MER1_type" FT repeat_region 6982507..6982639 FT /rpt_family="Alu" FT repeat_region 6982640..6982696 FT /rpt_family="MER1_type" FT repeat_region 6983182..6983394 FT /rpt_family="ERVL" FT repeat_region 6983463..6983762 FT /rpt_family="Alu" FT repeat_region 6984070..6984150 FT /rpt_family="(TC)n" FT repeat_region 6984302..6984590 FT /rpt_family="Alu" FT repeat_region 6984825..6984858 FT /rpt_family="L2" FT repeat_region 6985133..6985257 FT /rpt_family="MaLR" FT repeat_region 6985368..6985394 FT /rpt_family="(ATG)n" FT repeat_region 6985678..6985986 FT /rpt_family="Alu" FT repeat_region 6986025..6986142 FT /rpt_family="L2" FT repeat_region 6987319..6987504 FT /rpt_family="MaLR" FT repeat_region 6987515..6987817 FT /rpt_family="Alu" FT repeat_region 6987832..6988229 FT /rpt_family="ERV1" FT repeat_region 6988231..6988607 FT /rpt_family="ERV1" FT repeat_region 6988608..6988818 FT /rpt_family="ERV1" FT repeat_region 6988820..6989482 FT /rpt_family="ERV1" FT repeat_region 6989485..6990039 FT /rpt_family="ERV1" FT repeat_region 6990040..6990535 FT /rpt_family="ERV1" FT repeat_region 6998377..6998681 FT /rpt_family="ERV1" FT repeat_region 7001544..7001894 FT /rpt_family="ERV1" FT repeat_region 7001929..7002102 FT /rpt_family="MaLR" FT repeat_region 7002103..7002409 FT /rpt_family="Alu" FT repeat_region 7002410..7002453 FT /rpt_family="MaLR" FT repeat_region 7002671..7002823 FT /rpt_family="MER1_type" FT repeat_region 7002900..7003165 FT /rpt_family="L1" FT repeat_region 7003177..7003462 FT /rpt_family="Alu" FT repeat_region 7003470..7003765 FT /rpt_family="Alu" FT repeat_region 7003770..7004079 FT /rpt_family="Alu" FT repeat_region 7004470..7004691 FT /rpt_family="MER1_type" FT repeat_region 7004822..7004932 FT /rpt_family="MER1_type" FT repeat_region 7005745..7005903 FT /rpt_family="MaLR" FT repeat_region 7006094..7006138 FT /rpt_family="Alu" FT repeat_region 7006220..7006510 FT /rpt_family="Alu" FT repeat_region 7006551..7006606 FT /rpt_family="Alu" FT repeat_region 7006635..7006727 FT /rpt_family="MaLR" FT repeat_region 7006728..7007033 FT /rpt_family="Alu" FT repeat_region 7007034..7007408 FT /rpt_family="MaLR" FT repeat_region 7007414..7007716 FT /rpt_family="Alu" FT repeat_region 7008002..7008268 FT /rpt_family="MaLR" FT repeat_region 7008269..7008573 FT /rpt_family="Alu" FT repeat_region 7008574..7008591 FT /rpt_family="MaLR" FT repeat_region 7008581..7008844 FT /rpt_family="MaLR" FT repeat_region 7008889..7009193 FT /rpt_family="Alu" FT repeat_region 7013949..7013975 FT /rpt_family="SVA" FT repeat_region 7013976..7014014 FT /rpt_family="(TTAA)n" FT repeat_region 7014015..7015756 FT /rpt_family="SVA" FT unsure 7014508..7015385 FT /note="unresolved tandem repeat" FT repeat_region 7015757..7015799 FT /rpt_family="(GGGAGA)n" FT repeat_region 7017709..7018029 FT /rpt_family="L2" FT repeat_region 7018029..7018260 FT /rpt_family="L2" FT repeat_region 7018281..7018309 FT /rpt_family="AT_rich" FT repeat_region 7018329..7018639 FT /rpt_family="Alu" FT repeat_region 7018665..7018936 FT /rpt_family="Alu" FT repeat_region 7019450..7019580 FT /rpt_family="L1" FT repeat_region 7019588..7019882 FT /rpt_family="Alu" FT repeat_region 7020079..7020386 FT /rpt_family="Alu" FT repeat_region 7020557..7020852 FT /rpt_family="Alu" FT repeat_region 7020853..7021204 FT /rpt_family="L1" FT repeat_region 7021223..7021337 FT /rpt_family="MER1_type" FT repeat_region 7021722..7021833 FT /rpt_family="MIR" FT repeat_region 7022087..7022251 FT /rpt_family="MaLR" FT repeat_region 7022261..7022323 FT /rpt_family="MIR" FT repeat_region 7023011..7023117 FT /rpt_family="Alu" FT repeat_region 7023120..7023215 FT /rpt_family="Alu" FT repeat_region 7023614..7023679 FT /rpt_family="MaLR" FT repeat_region 7023684..7024009 FT /rpt_family="ERVL" FT repeat_region 7024010..7024310 FT /rpt_family="Alu" FT repeat_region 7024432..7024464 FT /rpt_family="(TCTCTG)n" FT repeat_region 7024623..7024691 FT /rpt_family="MaLR" FT repeat_region 7024896..7025144 FT /rpt_family="Alu" FT repeat_region 7025429..7025466 FT /rpt_family="(TG)n" FT repeat_region 7025467..7025634 FT /rpt_family="MaLR" FT repeat_region 7025635..7025677 FT /rpt_family="ERV1" FT repeat_region 7025679..7025756 FT /rpt_family="Alu" FT repeat_region 7025757..7026026 FT /rpt_family="Alu" FT repeat_region 7026028..7026093 FT /rpt_family="ERV1" FT repeat_region 7026094..7026456 FT /rpt_family="ERV1" FT repeat_region 7026606..7026815 FT /rpt_family="MaLR" FT repeat_region 7027436..7027732 FT /rpt_family="Alu" FT repeat_region 7027990..7028546 FT /rpt_family="ERV1" FT repeat_region 7028547..7028863 FT /rpt_family="ERV1" FT repeat_region 7034887..7035336 FT /rpt_family="ERV1" FT repeat_region 7035335..7035681 FT /rpt_family="MaLR" FT repeat_region 7035681..7035798 FT /rpt_family="MER1_type" FT repeat_region 7035839..7036149 FT /rpt_family="Alu" FT repeat_region 7036150..7036276 FT /rpt_family="Alu" FT repeat_region 7036299..7036444 FT /rpt_family="CR1" FT repeat_region 7037111..7037341 FT /rpt_family="L2" FT repeat_region 7037342..7037656 FT /rpt_family="Alu" FT repeat_region 7037657..7038349 FT /rpt_family="L2" FT repeat_region 7038359..7039438 FT /rpt_family="ERVK" FT repeat_region 7039466..7039550 FT /rpt_family="L2" FT repeat_region 7039551..7039851 FT /rpt_family="ERVK" FT repeat_region 7040029..7040135 FT /rpt_family="Alu" FT repeat_region 7040181..7040222 FT /rpt_family="AT_rich" FT repeat_region 7040583..7040753 FT /rpt_family="MIR" FT repeat_region 7041120..7041407 FT /rpt_family="ERVL" FT repeat_region 7041408..7042331 FT /rpt_family="ERVK" FT repeat_region 7042332..7042621 FT /rpt_family="ERVL" FT repeat_region 7042638..7042726 FT /rpt_family="L2" FT repeat_region 7043144..7043484 FT /rpt_family="MaLR" FT repeat_region 7043919..7044014 FT /rpt_family="L2" FT repeat_region 7044183..7044309 FT /rpt_family="L2" FT repeat_region 7045265..7045434 FT /rpt_family="MaLR" FT repeat_region 7051601..7051859 FT /rpt_family="MaLR" FT repeat_region 7052364..7052425 FT /rpt_family="L2" FT repeat_region 7052942..7053068 FT /rpt_family="Alu" FT repeat_region 7053073..7053778 FT /rpt_family="ERV1" FT repeat_region 7053832..7054026 FT /rpt_family="MIR" FT repeat_region 7054341..7054418 FT /rpt_family="L1" FT repeat_region 7054435..7054574 FT /rpt_family="ERV1" FT repeat_region 7054598..7054971 FT /rpt_family="ERV1" FT repeat_region 7055041..7055136 FT /rpt_family="MER1_type" FT repeat_region 7055324..7055360 FT /rpt_family="Alu" FT repeat_region 7055361..7055559 FT /rpt_family="Alu" FT repeat_region 7055804..7056163 FT /rpt_family="L1" FT repeat_region 7056164..7056476 FT /rpt_family="Alu" FT repeat_region 7056477..7057197 FT /rpt_family="L1" FT repeat_region 7057597..7057774 FT /rpt_family="L1" FT repeat_region 7057866..7057886 FT /rpt_family="AT_rich" FT repeat_region 7058859..7059147 FT /rpt_family="Alu" FT repeat_region 7059166..7059197 FT /rpt_family="AT_rich" FT repeat_region 7059366..7059507 FT /rpt_family="L2" FT repeat_region 7059830..7060070 FT /rpt_family="MIR" FT repeat_region 7060097..7060428 FT /rpt_family="L2" FT repeat_region 7060578..7061285 FT /rpt_family="L2" FT repeat_region 7061346..7062187 FT /rpt_family="L1" FT repeat_region 7062188..7062467 FT /rpt_family="Alu" FT repeat_region 7062468..7062801 FT /rpt_family="L1" FT repeat_region 7062794..7064084 FT /rpt_family="L1" FT repeat_region 7064232..7064323 FT /rpt_family="MER1_type" FT repeat_region 7064312..7064697 FT /rpt_family="MER1_type" FT repeat_region 7064707..7066068 FT /rpt_family="L1" FT repeat_region 7066133..7067708 FT /rpt_family="L1" FT repeat_region 7067709..7068012 FT /rpt_family="Alu" FT repeat_region 7073173..7073770 FT /rpt_family="L1" FT repeat_region 7073771..7073908 FT /rpt_family="Alu" FT repeat_region 7073909..7075142 FT /rpt_family="L1" FT repeat_region 7075148..7075375 FT /rpt_family="L1" FT repeat_region 7075392..7075846 FT /rpt_family="L1" FT repeat_region 7075851..7076028 FT /rpt_family="MER1_type" FT repeat_region 7076062..7076316 FT /rpt_family="L1" FT repeat_region 7077253..7077377 FT /rpt_family="MER1_type" FT repeat_region 7078153..7078566 FT /rpt_family="MaLR" FT repeat_region 7079025..7079177 FT /rpt_family="Alu" FT repeat_region 7079177..7079379 FT /rpt_family="Alu" FT repeat_region 7079504..7079634 FT /rpt_family="MaLR" FT repeat_region 7079646..7080062 FT /rpt_family="MaLR" FT repeat_region 7080246..7080547 FT /rpt_family="Alu" FT repeat_region 7080866..7081124 FT /rpt_family="ERVL" FT repeat_region 7084200..7084375 FT /rpt_family="Alu" FT repeat_region 7084449..7084806 FT /rpt_family="MaLR" FT repeat_region 7085005..7085214 FT /rpt_family="MER1_type" FT repeat_region 7085536..7085777 FT /rpt_family="L2" FT repeat_region 7085900..7086206 FT /rpt_family="Alu" FT repeat_region 7086257..7086356 FT /rpt_family="L2" FT repeat_region 7086371..7086491 FT /rpt_family="MER1_type" FT repeat_region 7086647..7086744 FT /rpt_family="MER1_type" FT repeat_region 7087116..7087335 FT /rpt_family="MER1_type" FT repeat_region 7087433..7087676 FT /rpt_family="MIR" FT repeat_region 7088307..7088661 FT /rpt_family="MaLR" FT repeat_region 7088853..7088906 FT /rpt_family="L2" FT repeat_region 7088956..7089095 FT /rpt_family="MIR" FT repeat_region 7089594..7089646 FT /rpt_family="MER1_type" FT repeat_region 7089655..7090078 FT /rpt_family="L1" FT repeat_region 7090215..7090631 FT /rpt_family="L1" FT repeat_region 7091516..7091988 FT /rpt_family="ERV1" FT repeat_region 7091989..7092297 FT /rpt_family="Alu" FT repeat_region 7092298..7092320 FT /rpt_family="ERV1" FT repeat_region 7092321..7092630 FT /rpt_family="Alu" FT repeat_region 7092631..7092998 FT /rpt_family="ERV1" FT repeat_region 7093423..7093587 FT /rpt_family="MER1_type" FT repeat_region 7093898..7094089 FT /rpt_family="MIR" FT repeat_region 7094186..7094447 FT /rpt_family="L2" FT repeat_region 7094625..7094673 FT /rpt_family="L2" FT repeat_region 7094728..7095056 FT /rpt_family="L2" FT repeat_region 7095057..7095189 FT /rpt_family="MER1_type" FT repeat_region 7095172..7095307 FT /rpt_family="MER1_type" FT repeat_region 7095308..7095350 FT /rpt_family="MER1_type" FT repeat_region 7095467..7098530 FT /rpt_family="SATR1" FT repeat_region 7098561..7099516 FT /rpt_family="SATR1" FT repeat_region 7099540..7100702 FT /rpt_family="SATR1" FT repeat_region 7100726..7100787 FT /rpt_family="AT_rich" FT repeat_region 7100798..7100985 FT /rpt_family="(TTA)n" FT repeat_region 7101029..7101072 FT /rpt_family="AT_rich" FT repeat_region 7101077..7102935 FT /rpt_family="SATR1" FT repeat_region 7102961..7105833 FT /rpt_family="SATR1" FT repeat_region 7105856..7107467 FT /rpt_family="SATR1" FT repeat_region 7107393..7107895 FT /rpt_family="SATR2" FT repeat_region 7107642..7109990 FT /rpt_family="SATR1" FT repeat_region 7110000..7110053 FT /rpt_family="ERVK" FT repeat_region 7110054..7110184 FT /rpt_family="L1" FT repeat_region 7110185..7110647 FT /rpt_family="ERVK" FT repeat_region 7110648..7114350 FT /rpt_family="SATR1" FT repeat_region 7114276..7115500 FT /rpt_family="SATR2" FT repeat_region 7116044..7116359 FT /rpt_family="Alu" FT repeat_region 7117080..7117196 FT /rpt_family="Alu" FT repeat_region 7117201..7117243 FT /rpt_family="AT_rich" FT repeat_region 7120366..7120459 FT /rpt_family="L2" FT repeat_region 7120839..7121132 FT /rpt_family="Alu" FT repeat_region 7121238..7121281 FT /rpt_family="L2" FT repeat_region 7121418..7121468 FT /rpt_family="SATR1" FT repeat_region 7121469..7121515 FT /rpt_family="MIR" FT repeat_region 7121516..7121819 FT /rpt_family="Alu" FT repeat_region 7121820..7121967 FT /rpt_family="MIR" FT repeat_region 7122454..7122498 FT /rpt_family="AT_rich" FT repeat_region 7122510..7122531 FT /rpt_family="AT_rich" FT repeat_region 7122706..7122753 FT /rpt_family="(TG)n" FT repeat_region 7122779..7122921 FT /rpt_family="L1" FT repeat_region 7122902..7123072 FT /rpt_family="L1" FT repeat_region 7129370..7129599 FT /rpt_family="L1" FT repeat_region 7129868..7130111 FT /rpt_family="MIR" FT repeat_region 7130098..7130177 FT /rpt_family="L2" FT repeat_region 7130631..7130703 FT /rpt_family="Mariner" FT repeat_region 7130909..7131082 FT /rpt_family="MIR" FT repeat_region 7131392..7131499 FT /rpt_family="MIR" FT repeat_region 7131750..7132035 FT /rpt_family="Alu" FT repeat_region 7132352..7132377 FT /rpt_family="AT_rich" FT repeat_region 7132378..7132665 FT /rpt_family="Alu" FT repeat_region 7132666..7132702 FT /rpt_family="AT_rich" FT repeat_region 7132756..7132843 FT /rpt_family="MIR" FT repeat_region 7133357..7133519 FT /rpt_family="MER1_type" FT repeat_region 7133522..7133612 FT /rpt_family="MaLR" FT repeat_region 7134154..7134565 FT /rpt_family="MaLR" FT repeat_region 7135205..7135508 FT /rpt_family="Alu" FT repeat_region 7135722..7135907 FT /rpt_family="MER1_type" FT repeat_region 7136639..7137097 FT /rpt_family="ERV1" FT repeat_region 7138006..7138130 FT /rpt_family="L2" FT repeat_region 7138671..7138832 FT /rpt_family="MER1_type" FT repeat_region 7140357..7140758 FT /rpt_family="L2" FT repeat_region 7141300..7141404 FT /rpt_family="MER1_type" FT repeat_region 7141718..7142027 FT /rpt_family="L2" FT ncRNA complement(7142207..7142312) FT /product="scRNA-hY1_RNA-related" FT /ncRNA_class="scRNA" FT repeat_region 7142207..7142312 FT /rpt_family="HY1" FT repeat_region 7142535..7142573 FT /rpt_family="AT_rich" FT repeat_region 7142576..7142862 FT /rpt_family="Alu" FT repeat_region 7143324..7143633 FT /rpt_family="Alu" FT repeat_region 7143654..7143781 FT /rpt_family="Alu" FT repeat_region 7143819..7143970 FT /rpt_family="Alu" FT repeat_region 7144355..7144439 FT /rpt_family="L1" FT repeat_region 7144536..7144634 FT /rpt_family="ERV1" FT repeat_region 7144635..7144963 FT /rpt_family="ERV1" FT repeat_region 7144988..7145551 FT /rpt_family="ERV1" FT repeat_region 7145530..7145870 FT /rpt_family="ERV1" FT repeat_region 7145869..7146575 FT /rpt_family="ERV1" FT repeat_region 7146576..7146824 FT /rpt_family="ERV1" FT repeat_region 7146825..7147317 FT /rpt_family="ERV1" FT repeat_region 7149878..7149977 FT /rpt_family="ERV1" FT repeat_region 7149978..7150025 FT /rpt_family="ERV1" FT repeat_region 7150095..7150281 FT /rpt_family="ERV1" FT repeat_region 7150811..7150880 FT /rpt_family="MaLR" FT repeat_region 7150919..7151176 FT /rpt_family="MIR" FT repeat_region 7151360..7151402 FT /rpt_family="L1" FT repeat_region 7151430..7151727 FT /rpt_family="Alu" FT repeat_region 7151774..7151901 FT /rpt_family="Alu" FT repeat_region 7151915..7152472 FT /rpt_family="L1" FT repeat_region 7152611..7152771 FT /rpt_family="Alu" FT repeat_region 7153201..7153746 FT /rpt_family="ERV1" FT repeat_region 7154695..7155026 FT /rpt_family="L2" FT repeat_region 7155239..7155391 FT /rpt_family="L1" FT repeat_region 7155670..7155930 FT /rpt_family="L1" FT repeat_region 7156017..7156096 FT /rpt_family="L1" FT repeat_region 7156233..7156854 FT /rpt_family="MaLR" FT repeat_region 7156860..7157106 FT /rpt_family="L1" FT repeat_region 7157130..7157352 FT /rpt_family="Alu" FT repeat_region 7157498..7157820 FT /rpt_family="MaLR" FT repeat_region 7157821..7158116 FT /rpt_family="Alu" FT repeat_region 7158117..7158286 FT /rpt_family="MaLR" FT repeat_region 7158317..7158672 FT /rpt_family="L1" FT repeat_region 7158667..7159325 FT /rpt_family="L1" FT repeat_region 7159400..7159432 FT /rpt_family="(TG)n" FT repeat_region 7159824..7159895 FT /rpt_family="(TTTTTA)n" FT repeat_region 7160892..7161193 FT /rpt_family="Alu" FT repeat_region 7162538..7162602 FT /rpt_family="MER1_type" FT repeat_region 7162840..7162998 FT /rpt_family="MaLR" FT repeat_region 7164253..7164290 FT /rpt_family="(TTG)n" FT repeat_region 7164295..7164579 FT /rpt_family="Alu" FT repeat_region 7164791..7165572 FT /rpt_family="L1" FT repeat_region 7165901..7166130 FT /rpt_family="MIR" FT repeat_region 7166120..7166261 FT /rpt_family="L2" FT repeat_region 7166321..7166630 FT /rpt_family="MaLR" FT repeat_region 7166880..7167440 FT /rpt_family="ERV1" FT repeat_region 7168250..7168409 FT /rpt_family="MIR" FT repeat_region 7168615..7168829 FT /rpt_family="MIR" FT repeat_region 7168965..7169160 FT /rpt_family="MIR" FT repeat_region 7169216..7169473 FT /rpt_family="L1" FT repeat_region 7171537..7171608 FT /rpt_family="MIR" FT repeat_region 7171634..7172065 FT /rpt_family="MaLR" FT repeat_region 7172770..7173027 FT /rpt_family="MaLR" FT repeat_region 7173933..7174144 FT /rpt_family="L1" FT repeat_region 7174838..7175143 FT /rpt_family="MaLR" FT repeat_region 7175322..7175454 FT /rpt_family="L2" FT repeat_region 7175468..7175518 FT /rpt_family="MIR" FT repeat_region 7175519..7175891 FT /rpt_family="MaLR" FT repeat_region 7175892..7176012 FT /rpt_family="MIR" FT repeat_region 7176131..7176354 FT /rpt_family="MIR" FT repeat_region 7177622..7177976 FT /rpt_family="L2" FT repeat_region 7177977..7178136 FT /rpt_family="AcHobo" FT repeat_region 7178141..7178256 FT /rpt_family="L2" FT repeat_region 7178441..7178590 FT /rpt_family="MER2_type" FT repeat_region 7178599..7178836 FT /rpt_family="MER2_type" FT repeat_region 7179001..7179232 FT /rpt_family="ERV1" FT repeat_region 7179233..7179252 FT /rpt_family="(TTTG)n" FT repeat_region 7185434..7185725 FT /rpt_family="Alu" FT repeat_region 7185737..7186013 FT /rpt_family="ERV1" FT repeat_region 7187137..7188098 FT /rpt_family="L2" FT repeat_region 7188099..7188410 FT /rpt_family="MER2_type" FT repeat_region 7188990..7189017 FT /rpt_family="(TG)n" FT repeat_region 7189314..7189404 FT /rpt_family="AT_rich" FT repeat_region 7189405..7189536 FT /rpt_family="Alu" FT repeat_region 7189624..7189914 FT /rpt_family="Alu" FT repeat_region 7190584..7190775 FT /rpt_family="MIR" FT repeat_region 7190920..7191037 FT /rpt_family="(TA)n" FT repeat_region 7191596..7191661 FT /rpt_family="C-rich" FT repeat_region 7191665..7191716 FT /rpt_family="Alu" FT repeat_region 7191717..7191860 FT /rpt_family="Alu" FT repeat_region 7191878..7192181 FT /rpt_family="Alu" FT repeat_region 7192606..7192804 FT /rpt_family="L1" FT repeat_region 7192992..7193305 FT /rpt_family="Alu" FT repeat_region 7193325..7193489 FT /rpt_family="MIR" FT repeat_region 7193571..7194292 FT /rpt_family="MaLR" FT repeat_region 7194293..7194636 FT /rpt_family="MaLR" FT repeat_region 7194669..7194722 FT /rpt_family="(TTCA)n" FT repeat_region 7194774..7194923 FT /rpt_family="L1" FT repeat_region 7194924..7195225 FT /rpt_family="Alu" FT repeat_region 7195226..7195633 FT /rpt_family="L1" FT repeat_region 7196147..7196189 FT /rpt_family="AT_rich" FT repeat_region 7197888..7197936 FT /rpt_family="CR1" FT repeat_region 7198027..7198123 FT /rpt_family="MIR" FT repeat_region 7198187..7198313 FT /rpt_family="(TA)n" FT repeat_region 7199023..7199136 FT /rpt_family="GA-rich" FT repeat_region 7201156..7201367 FT /rpt_family="MIR" FT repeat_region 7201695..7201740 FT /rpt_family="T-rich" FT repeat_region 7201749..7202931 FT /rpt_family="L1" FT repeat_region 7202932..7203932 FT /rpt_family="L1" FT repeat_region 7204109..7204515 FT /rpt_family="ERVL" FT repeat_region 7205351..7205692 FT /rpt_family="MER2_type" FT repeat_region 7205693..7205841 FT /rpt_family="MIR" FT repeat_region 7205883..7206143 FT /rpt_family="L1" FT repeat_region 7206146..7206295 FT /rpt_family="L1" FT repeat_region 7206328..7206463 FT /rpt_family="MIR" FT repeat_region 7207083..7207103 FT /rpt_family="AT_rich" FT repeat_region 7208484..7210103 FT /rpt_family="L1" FT repeat_region 7209911..7210131 FT /rpt_family="L1" FT repeat_region 7210132..7210430 FT /rpt_family="Alu" FT repeat_region 7210431..7212254 FT /rpt_family="L1" FT repeat_region 7212274..7212684 FT /rpt_family="L1" FT repeat_region 7212685..7213105 FT /rpt_family="MaLR" FT repeat_region 7213106..7213207 FT /rpt_family="L1" FT repeat_region 7213208..7213252 FT /rpt_family="MaLR" FT repeat_region 7213254..7213540 FT /rpt_family="Alu" FT repeat_region 7213556..7213902 FT /rpt_family="MaLR" FT repeat_region 7213903..7214094 FT /rpt_family="L1" FT repeat_region 7214095..7214226 FT /rpt_family="Alu" FT repeat_region 7214227..7214271 FT /rpt_family="L1" FT repeat_region 7214267..7215201 FT /rpt_family="L1" FT repeat_region 7215302..7215596 FT /rpt_family="MaLR" FT repeat_region 7215581..7215800 FT /rpt_family="ERV1" FT repeat_region 7217450..7217609 FT /rpt_family="MIR" FT repeat_region 7218110..7218137 FT /rpt_family="AT_rich" FT repeat_region 7218368..7218428 FT /rpt_family="L2" FT repeat_region 7218441..7219009 FT /rpt_family="MaLR" FT repeat_region 7219307..7219486 FT /rpt_family="MaLR" FT repeat_region 7219936..7220134 FT /rpt_family="L1" FT repeat_region 7220152..7220360 FT /rpt_family="L1" FT repeat_region 7220375..7220555 FT /rpt_family="Alu" FT repeat_region 7220701..7220732 FT /rpt_family="AT_rich" FT repeat_region 7221048..7221120 FT /rpt_family="MIR" FT repeat_region 7221256..7221343 FT /rpt_family="MIR" FT misc_feature 7222021..7222974 FT /note="CpG_island (%GC=73.3, o/e=0.87, #CpGs=112)" FT repeat_region 7224993..7225447 FT /rpt_family="MaLR" FT repeat_region 7225538..7225560 FT /rpt_family="L2" FT repeat_region 7225561..7225774 FT /rpt_family="MaLR" FT repeat_region 7225775..7225798 FT /rpt_family="(TTTC)n" FT repeat_region 7225799..7225954 FT /rpt_family="MaLR" FT repeat_region 7225955..7226040 FT /rpt_family="L2" FT repeat_region 7226041..7226188 FT /rpt_family="MER1_type" FT repeat_region 7226189..7226405 FT /rpt_family="L2" FT repeat_region 7226412..7226470 FT /rpt_family="Mariner" FT repeat_region 7226478..7226759 FT /rpt_family="L2" FT repeat_region 7226886..7227083 FT /rpt_family="Alu" FT repeat_region 7227141..7227322 FT /rpt_family="MER1_type" FT repeat_region 7227350..7228074 FT /rpt_family="L2" FT repeat_region 7228214..7228234 FT /rpt_family="AT_rich" FT repeat_region 7228899..7229157 FT /rpt_family="L1" FT repeat_region 7229682..7230134 FT /rpt_family="ERV1" FT repeat_region 7230348..7230383 FT /rpt_family="AT_rich" FT repeat_region 7230599..7231770 FT /rpt_family="L1" FT misc_feature 7235549..7235655 FT /note="sequence derived from PCR product from clone DNA" FT repeat_region 7235658..7235688 FT /rpt_family="(TTG)n" FT misc_feature 7236028..7236389 FT /note="sequence derived from PCR product from clone DNA" FT repeat_region 7242011..7243333 FT /rpt_family="L1" FT repeat_region 7243334..7243634 FT /rpt_family="L1" FT repeat_region 7243635..7244845 FT /rpt_family="L1" FT repeat_region 7244846..7245244 FT /rpt_family="MER2_type" FT repeat_region 7245245..7246061 FT /rpt_family="L1" FT repeat_region 7246062..7246329 FT /rpt_family="Alu" FT repeat_region 7246330..7246979 FT /rpt_family="L1" FT repeat_region 7246980..7247105 FT /rpt_family="Alu" FT repeat_region 7247106..7247534 FT /rpt_family="L1" FT repeat_region 7247535..7248098 FT /rpt_family="MER2_type" FT repeat_region 7248099..7248689 FT /rpt_family="L1" FT repeat_region 7248703..7249114 FT /rpt_family="L1" FT repeat_region 7249362..7249781 FT /rpt_family="ERV1" FT repeat_region 7250044..7250066 FT /rpt_family="(T)n" FT repeat_region 7250067..7250594 FT /rpt_family="ERV1" FT repeat_region 7252159..7252458 FT /rpt_family="ERV1" FT repeat_region 7252430..7252506 FT /rpt_family="ERV1" FT repeat_region 7252555..7253514 FT /rpt_family="ERV1" FT repeat_region 7256525..7256673 FT /rpt_family="ERV1" FT repeat_region 7256669..7256744 FT /rpt_family="ERV1" FT repeat_region 7256759..7256984 FT /rpt_family="ERV1" FT repeat_region 7257001..7257128 FT /rpt_family="Alu" FT repeat_region 7257295..7257465 FT /rpt_family="Alu" FT repeat_region 7258462..7258767 FT /rpt_family="Alu" FT repeat_region 7258769..7258848 FT /rpt_family="MER1_type" FT repeat_region 7258849..7259159 FT /rpt_family="L1" FT repeat_region 7259160..7259285 FT /rpt_family="MER1_type" FT repeat_region 7260015..7260078 FT /rpt_family="L2" FT repeat_region 7260151..7260433 FT /rpt_family="Alu" FT repeat_region 7260438..7261284 FT /rpt_family="L1" FT repeat_region 7261430..7261789 FT /rpt_family="ERVL" FT repeat_region 7262282..7262452 FT /rpt_family="L1" FT repeat_region 7262794..7263093 FT /rpt_family="Alu" FT repeat_region 7263217..7264406 FT /rpt_family="L1" FT repeat_region 7264400..7264726 FT /rpt_family="L1" FT repeat_region 7264724..7264899 FT /rpt_family="L1" FT repeat_region 7265559..7265777 FT /rpt_family="MIR" FT repeat_region 7265990..7266012 FT /rpt_family="AT_rich" FT repeat_region 7266141..7266724 FT /rpt_family="L1" FT repeat_region 7266868..7267069 FT /rpt_family="MaLR" FT repeat_region 7267070..7267366 FT /rpt_family="Alu" FT misc_feature 7267073..7267308 FT /note="CpG_island (%GC=62.3, o/e=1.00, #CpGs=22)" FT repeat_region 7267367..7267608 FT /rpt_family="MaLR" FT repeat_region 7267611..7267713 FT /rpt_family="MIR" FT repeat_region 7267763..7267876 FT /rpt_family="L1" FT repeat_region 7267903..7267932 FT /rpt_family="AT_rich" FT repeat_region 7267944..7268042 FT /rpt_family="MER1_type" FT repeat_region 7269884..7269976 FT /rpt_family="L1" FT repeat_region 7270001..7271208 FT /rpt_family="L1" FT repeat_region 7272116..7272420 FT /rpt_family="Alu" FT repeat_region 7272578..7272606 FT /rpt_family="AT_rich" FT repeat_region 7272897..7273203 FT /rpt_family="Alu" FT repeat_region 7273205..7273407 FT /rpt_family="MER1_type" FT repeat_region 7273460..7273548 FT /rpt_family="MER1_type" FT gene 7273889..7283981 FT /gene="C1GALT1" FT mRNA join(7273889..7274170,7277886..7278553,7283155..7283981) FT /gene="C1GALT1" FT CDS join(7273951..7274170,7277886..7278553,7283155..7283358) FT /codon_start=1 FT /gene="C1GALT1" FT /product="unknown" FT /note="Homo sapiens core1 FT UDP-galactose:N-acetylgalactosamine-alpha-R beta FT 1,3-galactosyltransferase (C1GALT1), mRNA.; H_DJ0733B09.1" FT /protein_id="AAQ96887.1" FT /translation="MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHND FT PHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKA FT KHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDAD FT WFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKR FT FVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLP FT RTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLP FT ERILKEISQANKNEDTKVKLGNP" FT repeat_region 7275788..7275916 FT /rpt_family="L2" FT repeat_region 7276150..7276454 FT /rpt_family="Alu" FT repeat_region 7276690..7276876 FT /rpt_family="MER1_type" FT repeat_region 7277506..7277643 FT /rpt_family="MER1_type" FT repeat_region 7278735..7279074 FT /rpt_family="L2" FT repeat_region 7279083..7279284 FT /rpt_family="MIR" FT repeat_region 7279577..7279666 FT /rpt_family="MIR" FT repeat_region 7279749..7279977 FT /rpt_family="MER1_type" FT repeat_region 7280755..7280803 FT /rpt_family="Mariner" FT repeat_region 7280806..7281147 FT /rpt_family="L1" FT repeat_region 7281650..7281909 FT /rpt_family="MER1_type" FT repeat_region 7282464..7282667 FT /rpt_family="MIR" FT repeat_region 7284857..7284908 FT /rpt_family="Alu" FT repeat_region 7284910..7285108 FT /rpt_family="Alu" FT repeat_region 7285431..7285649 FT /rpt_family="MIR" FT repeat_region 7285723..7285915 FT /rpt_family="MIR" FT repeat_region 7286050..7286180 FT /rpt_family="MER1_type" FT repeat_region 7286181..7286380 FT /rpt_family="MER1_type" FT repeat_region 7286381..7286431 FT /rpt_family="MER1_type" FT repeat_region 7288588..7288825 FT /rpt_family="L2" FT repeat_region 7289620..7289716 FT /rpt_family="CR1" FT repeat_region 7290687..7290799 FT /rpt_family="Alu" FT repeat_region 7291241..7291347 FT /rpt_family="L2" FT repeat_region 7291392..7291450 FT /rpt_family="MIR" FT repeat_region 7291464..7291535 FT /rpt_family="MER2_type" FT repeat_region 7292345..7292439 FT /rpt_family="L1" FT repeat_region 7292486..7292664 FT /rpt_family="L1" FT repeat_region 7293588..7293731 FT /rpt_family="MIR" FT repeat_region 7293786..7294042 FT /rpt_family="L1" FT repeat_region 7294211..7294315 FT /rpt_family="Alu" FT repeat_region 7294336..7294408 FT /rpt_family="L1" FT repeat_region 7295624..7295964 FT /rpt_family="L1" FT repeat_region 7296285..7296378 FT /rpt_family="L1" FT repeat_region 7297339..7297627 FT /rpt_family="MER2_type" FT repeat_region 7298822..7299139 FT /rpt_family="Alu" FT misc_feature 7298826..7299110 FT /note="CpG_island (%GC=58.9, o/e=0.89, #CpGs=24)" FT repeat_region 7300500..7300797 FT /rpt_family="Alu" FT repeat_region 7300816..7300927 FT /rpt_family="L1" FT repeat_region 7301301..7301741 FT /rpt_family="ERV1" FT repeat_region 7302789..7302817 FT /rpt_family="ERVL" FT repeat_region 7302818..7303019 FT /rpt_family="MER1_type" FT repeat_region 7303020..7303387 FT /rpt_family="ERVL" FT repeat_region 7303533..7303839 FT /rpt_family="Alu" FT repeat_region 7304486..7305041 FT /rpt_family="MaLR" FT repeat_region 7305169..7305314 FT /rpt_family="MIR" FT repeat_region 7305395..7305526 FT /rpt_family="MER1_type" FT repeat_region 7305732..7306058 FT /rpt_family="ERVL" FT repeat_region 7306059..7306694 FT /rpt_family="ERV1" FT repeat_region 7306695..7306849 FT /rpt_family="ERVL" FT repeat_region 7306990..7307137 FT /rpt_family="MaLR" FT repeat_region 7307914..7308013 FT /rpt_family="L2" FT repeat_region 7308537..7308559 FT /rpt_family="AT_rich" FT repeat_region 7309175..7309484 FT /rpt_family="Alu" FT repeat_region 7317434..7317566 FT /rpt_family="L2" FT repeat_region 7318196..7318218 FT /rpt_family="(T)n" FT repeat_region 7318896..7319001 FT /rpt_family="Alu" FT repeat_region 7319711..7319900 FT /rpt_family="Alu" FT repeat_region 7320281..7320742 FT /rpt_family="ERV1" FT repeat_region 7321237..7321381 FT /rpt_family="L2" FT repeat_region 7321539..7321897 FT /rpt_family="MaLR" FT repeat_region 7321974..7322255 FT /rpt_family="MER1_type" FT repeat_region 7322293..7325864 FT /rpt_family="L1" FT repeat_region 7325665..7326121 FT /rpt_family="L1" FT repeat_region 7326131..7326232 FT /rpt_family="Alu" FT repeat_region 7326243..7327873 FT /rpt_family="L1" FT repeat_region 7327914..7328285 FT /rpt_family="L1" FT repeat_region 7329240..7329386 FT /rpt_family="MaLR" FT repeat_region 7329416..7329547 FT /rpt_family="Alu" FT repeat_region 7329556..7329886 FT /rpt_family="MaLR" FT repeat_region 7330067..7330306 FT /rpt_family="MIR" FT repeat_region 7330347..7330369 FT /rpt_family="(A)n" FT repeat_region 7330656..7330770 FT /rpt_family="L1" FT repeat_region 7330771..7331072 FT /rpt_family="Alu" FT repeat_region 7331073..7331235 FT /rpt_family="L1" FT repeat_region 7331348..7331916 FT /rpt_family="ERVL" FT repeat_region 7335170..7335478 FT /rpt_family="Alu" FT repeat_region 7336626..7338147 FT /rpt_family="L1" FT repeat_region 7338148..7339617 FT /rpt_family="L1" FT repeat_region 7339618..7341086 FT /rpt_family="L1" FT repeat_region 7340887..7341391 FT /rpt_family="L1" FT repeat_region 7341396..7343047 FT /rpt_family="L1" FT repeat_region 7343049..7343938 FT /rpt_family="L1" FT repeat_region 7344735..7344795 FT /rpt_family="MIR" FT repeat_region 7345187..7345649 FT /rpt_family="MaLR" FT repeat_region 7346549..7347165 FT /rpt_family="L1" FT repeat_region 7347343..7347631 FT /rpt_family="Alu" FT misc_feature 7347374..7347603 FT /note="CpG_island (%GC=61.7, o/e=0.95, #CpGs=21)" FT repeat_region 7349348..7349369 FT /rpt_family="AT_rich" FT repeat_region 7349533..7349588 FT /rpt_family="(TG)n" FT repeat_region 7349847..7349964 FT /rpt_family="L2" FT repeat_region 7350339..7350520 FT /rpt_family="L1" FT repeat_region 7351049..7351232 FT /rpt_family="L1" FT repeat_region 7351233..7351359 FT /rpt_family="L1" FT repeat_region 7351343..7352690 FT /rpt_family="L1" FT repeat_region 7352701..7353030 FT /rpt_family="L1" FT repeat_region 7353032..7353107 FT /rpt_family="L1" FT repeat_region 7353098..7353612 FT /rpt_family="L1" FT repeat_region 7354224..7354513 FT /rpt_family="Alu" FT repeat_region 7357475..7357936 FT /rpt_family="L2" FT repeat_region 7358556..7359015 FT /rpt_family="L2" FT repeat_region 7359016..7359322 FT /rpt_family="Alu" FT repeat_region 7359323..7359537 FT /rpt_family="L2" FT repeat_region 7359538..7359815 FT /rpt_family="Alu" FT repeat_region 7359816..7359893 FT /rpt_family="L2" FT repeat_region 7359975..7360463 FT /rpt_family="MaLR" FT repeat_region 7360528..7360670 FT /rpt_family="MIR" FT repeat_region 7360791..7360819 FT /rpt_family="(A)n" FT repeat_region 7361743..7361877 FT /rpt_family="ERV1" FT repeat_region 7361876..7361997 FT /rpt_family="ERV1" FT repeat_region 7362917..7363052 FT /rpt_family="L2" FT repeat_region 7363059..7363420 FT /rpt_family="L2" FT repeat_region 7366593..7366675 FT /rpt_family="MIR" FT repeat_region 7367598..7367642 FT /rpt_family="G-rich" FT repeat_region 7367646..7367969 FT /rpt_family="ERVL" FT repeat_region 7368084..7368399 FT /rpt_family="Alu" FT repeat_region 7369618..7370194 FT /rpt_family="ERV1" FT repeat_region 7371407..7371497 FT /rpt_family="MIR" FT repeat_region 7371835..7371962 FT /rpt_family="MIR" FT repeat_region 7372134..7372217 FT /rpt_family="MIR" FT repeat_region 7372289..7372477 FT /rpt_family="L1" FT repeat_region 7372487..7373231 FT /rpt_family="L1" FT repeat_region 7373241..7373970 FT /rpt_family="L1" FT repeat_region 7374082..7374139 FT /rpt_family="L1" FT repeat_region 7374193..7374275 FT /rpt_family="MIR" FT repeat_region 7374999..7375130 FT /rpt_family="L2" FT repeat_region 7375148..7375511 FT /rpt_family="MaLR" FT repeat_region 7375560..7375946 FT /rpt_family="L2" FT repeat_region 7376180..7378345 FT /rpt_family="L1" FT repeat_region 7378366..7378823 FT /rpt_family="MaLR" FT repeat_region 7378824..7379270 FT /rpt_family="L2" FT repeat_region 7379620..7379829 FT /rpt_family="Alu" FT repeat_region 7380477..7380731 FT /rpt_family="AcHobo" FT repeat_region 7380827..7380977 FT /rpt_family="L1" FT repeat_region 7381047..7381206 FT /rpt_family="Alu" FT repeat_region 7381308..7382168 FT /rpt_family="L1" FT repeat_region 7382568..7383120 FT /rpt_family="L1" FT repeat_region 7383247..7383356 FT /rpt_family="L1" FT repeat_region 7383357..7383662 FT /rpt_family="Alu" FT repeat_region 7383663..7383839 FT /rpt_family="L1" FT repeat_region 7383912..7384268 FT /rpt_family="L1" FT repeat_region 7384312..7384435 FT /rpt_family="MER1_type" FT repeat_region 7385040..7385549 FT /rpt_family="L1" FT repeat_region 7388150..7388236 FT /rpt_family="L1" FT repeat_region 7388237..7388417 FT /rpt_family="L1" FT repeat_region 7388429..7388676 FT /rpt_family="Alu" FT repeat_region 7388677..7388929 FT /rpt_family="L1" FT repeat_region 7388920..7389457 FT /rpt_family="L1" FT repeat_region 7389459..7389515 FT /rpt_family="GA-rich" FT repeat_region 7390270..7390305 FT /rpt_family="(T)n" FT repeat_region 7390950..7391187 FT /rpt_family="CR1" FT repeat_region 7391347..7391368 FT /rpt_family="AT_rich" FT repeat_region 7391379..7391412 FT /rpt_family="(TG)n" FT repeat_region 7391429..7391699 FT /rpt_family="ERV1" FT repeat_region 7391873..7391951 FT /rpt_family="L2" FT repeat_region 7391956..7392451 FT /rpt_family="MaLR" FT repeat_region 7392564..7393227 FT /rpt_family="ERV1" FT repeat_region 7393661..7393924 FT /rpt_family="Alu" FT repeat_region 7393961..7394512 FT /rpt_family="ERV1" FT repeat_region 7394669..7394964 FT /rpt_family="L1" FT repeat_region 7394965..7395259 FT /rpt_family="Alu" FT repeat_region 7395260..7395637 FT /rpt_family="L1" FT repeat_region 7396115..7396484 FT /rpt_family="L1" FT repeat_region 7396519..7396560 FT /rpt_family="AT_rich" FT repeat_region 7396671..7396980 FT /rpt_family="Alu" FT repeat_region 7397010..7397315 FT /rpt_family="Alu" FT repeat_region 7397959..7398151 FT /rpt_family="MIR" FT repeat_region 7400391..7400425 FT /rpt_family="(CA)n" FT repeat_region 7400944..7401342 FT /rpt_family="L1" FT repeat_region 7401343..7401819 FT /rpt_family="L1" FT repeat_region 7402490..7402588 FT /rpt_family="Alu" FT repeat_region 7403142..7403398 FT /rpt_family="L1" FT repeat_region 7403440..7403575 FT /rpt_family="Alu" FT repeat_region 7403852..7404373 FT /rpt_family="ERV1" FT repeat_region 7404437..7404475 FT /rpt_family="CT-rich" FT repeat_region 7405742..7405852 FT /rpt_family="MIR" FT repeat_region 7406007..7406051 FT /rpt_family="MIR" FT repeat_region 7406571..7406625 FT /rpt_family="(TG)n" FT repeat_region 7406626..7406962 FT /rpt_family="MER2_type" FT repeat_region 7407385..7408130 FT /rpt_family="L2" FT repeat_region 7408131..7408474 FT /rpt_family="MaLR" FT repeat_region 7408475..7408613 FT /rpt_family="L2" FT repeat_region 7408923..7409134 FT /rpt_family="MER1_type" FT repeat_region 7411461..7411706 FT /rpt_family="Alu" FT repeat_region 7411749..7412073 FT /rpt_family="Alu" FT repeat_region 7413333..7413629 FT /rpt_family="Alu" FT misc_feature 7413362..7413626 FT /note="CpG_island (%GC=60.8, o/e=0.77, #CpGs=20)" FT repeat_region 7413670..7413692 FT /rpt_family="(TA)n" FT repeat_region 7413749..7413773 FT /rpt_family="AT_rich" FT repeat_region 7413785..7413852 FT /rpt_family="L1" FT repeat_region 7415335..7415421 FT /rpt_family="MIR" FT repeat_region 7415781..7416200 FT /rpt_family="CR1" FT repeat_region 7416310..7416350 FT /rpt_family="AT_rich" FT repeat_region 7416470..7416767 FT /rpt_family="L1" FT repeat_region 7417417..7417843 FT /rpt_family="L2" FT repeat_region 7418332..7418444 FT /rpt_family="MIR" FT repeat_region 7418493..7418622 FT /rpt_family="AcHobo" FT repeat_region 7418668..7418822 FT /rpt_family="AcHobo" FT repeat_region 7419154..7419254 FT /rpt_family="L2" FT repeat_region 7419287..7419310 FT /rpt_family="(TGAA)n" FT repeat_region 7420886..7420979 FT /rpt_family="Alu" FT repeat_region 7421366..7421416 FT /rpt_family="(TATATG)n" FT repeat_region 7421420..7421541 FT /rpt_family="MER1_type" FT repeat_region 7421659..7421963 FT /rpt_family="Alu" FT repeat_region 7422331..7422495 FT /rpt_family="MER1_type" FT repeat_region 7422882..7422920 FT /rpt_family="(TG)n" FT repeat_region 7422921..7423209 FT /rpt_family="Alu" FT repeat_region 7423211..7423232 FT /rpt_family="AT_rich" FT repeat_region 7423298..7423341 FT /rpt_family="(TATATG)n" FT repeat_region 7423368..7423514 FT /rpt_family="L1" FT repeat_region 7424016..7424344 FT /rpt_family="MER2_type" FT repeat_region 7425982..7426389 FT /rpt_family="L1" FT repeat_region 7426429..7426783 FT /rpt_family="MaLR" FT repeat_region 7427015..7427361 FT /rpt_family="L1" FT repeat_region 7434641..7434941 FT /rpt_family="Alu" FT repeat_region 7435527..7435597 FT /rpt_family="L2" FT repeat_region 7435881..7435957 FT /rpt_family="MIR" FT repeat_region 7436678..7437109 FT /rpt_family="MaLR" FT repeat_region 7439781..7440119 FT /rpt_family="MaLR" FT repeat_region 7440120..7440183 FT /rpt_family="CR1" FT repeat_region 7440217..7440437 FT /rpt_family="L2" FT repeat_region 7440438..7440565 FT /rpt_family="L1" FT repeat_region 7440574..7440592 FT /rpt_family="L2" FT repeat_region 7440593..7440656 FT /rpt_family="(TG)n" FT repeat_region 7440657..7441468 FT /rpt_family="L2" FT repeat_region 7442388..7442503 FT /rpt_family="L2" FT repeat_region 7442576..7442960 FT /rpt_family="L2" FT repeat_region 7443606..7443692 FT /rpt_family="L2" FT repeat_region 7443940..7444509 FT /rpt_family="L2" FT repeat_region 7444515..7444684 FT /rpt_family="Alu" FT repeat_region 7446001..7446596 FT /rpt_family="L2" FT repeat_region 7446621..7447321 FT /rpt_family="L1" FT repeat_region 7448615..7448708 FT /rpt_family="MIR" FT repeat_region 7449051..7449098 FT /rpt_family="GA-rich" FT repeat_region 7451650..7452064 FT /rpt_family="MaLR" FT repeat_region 7452221..7452391 FT /rpt_family="MIR" FT repeat_region 7452463..7452585 FT /rpt_family="MIR" FT repeat_region 7453026..7453184 FT /rpt_family="MaLR" FT repeat_region 7454314..7454532 FT /rpt_family="L2" FT repeat_region 7454560..7454681 FT /rpt_family="L2" FT repeat_region 7455036..7455066 FT /rpt_family="Mariner" FT repeat_region 7455156..7455433 FT /rpt_family="Alu" FT repeat_region 7455437..7455733 FT /rpt_family="Alu" FT repeat_region 7456622..7456661 FT /rpt_family="AT_rich" FT repeat_region 7456920..7457088 FT /rpt_family="MER1_type" FT repeat_region 7457121..7457198 FT /rpt_family="GA-rich" FT repeat_region 7458104..7458247 FT /rpt_family="MER103" FT repeat_region 7458341..7458469 FT /rpt_family="L1" FT repeat_region 7458810..7459004 FT /rpt_family="MER1_type" FT repeat_region 7460454..7460502 FT /rpt_family="MIR" FT repeat_region 7460504..7461107 FT /rpt_family="L1" FT repeat_region 7461980..7462278 FT /rpt_family="Alu" FT repeat_region 7462438..7462972 FT /rpt_family="L1" FT repeat_region 7464684..7464743 FT /rpt_family="AT_rich" FT repeat_region 7464794..7464903 FT /rpt_family="MIR" FT repeat_region 7465339..7465477 FT /rpt_family="MIR" FT repeat_region 7467558..7467595 FT /rpt_family="(TTCA)n" FT repeat_region 7467657..7467707 FT /rpt_family="MIR" FT repeat_region 7467748..7467803 FT /rpt_family="(TAA)n" FT repeat_region 7469033..7469058 FT /rpt_family="(TC)n" FT repeat_region 7469092..7469139 FT /rpt_family="(TG)n" FT repeat_region 7469755..7470057 FT /rpt_family="Alu" FT repeat_region 7470879..7471921 FT /rpt_family="L2" FT repeat_region 7472985..7473287 FT /rpt_family="Alu" FT repeat_region 7475055..7475161 FT /rpt_family="AcHobo" FT repeat_region 7476389..7476676 FT /rpt_family="Alu" FT repeat_region 7476856..7476946 FT /rpt_family="MIR" FT repeat_region 7477584..7477893 FT /rpt_family="Alu" FT repeat_region 7478030..7478174 FT /rpt_family="MER1_type" FT repeat_region 7478202..7478277 FT /rpt_family="MER1_type" FT repeat_region 7478429..7478595 FT /rpt_family="MER1_type" FT repeat_region 7479345..7479535 FT /rpt_family="MER1_type" FT repeat_region 7479870..7480005 FT /rpt_family="MIR" FT repeat_region 7481230..7481408 FT /rpt_family="MER1_type" FT repeat_region 7481731..7481880 FT /rpt_family="L2" FT repeat_region 7482388..7482681 FT /rpt_family="Alu" FT repeat_region 7483618..7483638 FT /rpt_family="(T)n" FT repeat_region 7484241..7484292 FT /rpt_family="MIR" FT repeat_region 7484305..7484454 FT /rpt_family="MaLR" FT repeat_region 7484455..7484859 FT /rpt_family="MaLR" FT repeat_region 7484860..7485163 FT /rpt_family="MaLR" FT repeat_region 7485495..7485788 FT /rpt_family="Alu" FT repeat_region 7486027..7486327 FT /rpt_family="L1" FT repeat_region 7486369..7486933 FT /rpt_family="L1" FT repeat_region 7486942..7487049 FT /rpt_family="Alu" FT repeat_region 7487050..7487080 FT /rpt_family="AT_rich" FT repeat_region 7487081..7487501 FT /rpt_family="L1" FT repeat_region 7487502..7487709 FT /rpt_family="Alu" FT repeat_region 7487753..7488088 FT /rpt_family="L1" FT repeat_region 7488109..7488756 FT /rpt_family="L1" FT repeat_region 7488769..7489309 FT /rpt_family="L1" FT repeat_region 7489310..7489333 FT /rpt_family="(CAAAA)n" FT repeat_region 7489334..7490117 FT /rpt_family="L1" FT repeat_region 7490157..7490725 FT /rpt_family="L1" FT repeat_region 7490758..7490833 FT /rpt_family="L1" FT repeat_region 7490860..7491153 FT /rpt_family="Alu" FT repeat_region 7491277..7491349 FT /rpt_family="(CATATA)n" FT repeat_region 7491634..7491742 FT /rpt_family="L2" FT repeat_region 7491745..7491832 FT /rpt_family="MER1_type" FT repeat_region 7493141..7493164 FT /rpt_family="AT_rich" FT repeat_region 7493264..7493584 FT /rpt_family="MaLR" FT repeat_region 7494496..7494523 FT /rpt_family="AT_rich" FT repeat_region 7496315..7497483 FT /rpt_family="L2" FT repeat_region 7497527..7497704 FT /rpt_family="MER1_type" FT repeat_region 7497767..7498077 FT /rpt_family="Alu" FT repeat_region 7498286..7498480 FT /rpt_family="MIR" FT repeat_region 7499353..7499901 FT /rpt_family="ERV1" FT repeat_region 7500009..7500312 FT /rpt_family="Alu" FT repeat_region 7500523..7501499 FT /rpt_family="L1" FT repeat_region 7501501..7502207 FT /rpt_family="L1" FT repeat_region 7502208..7502521 FT /rpt_family="Alu" FT repeat_region 7502522..7504723 FT /rpt_family="L1" FT misc_feature 7504744..7505169 FT /note="CpG_island (%GC=60.6, o/e=0.85, #CpGs=33)" FT repeat_region 7510757..7510780 FT /rpt_family="(A)n" FT repeat_region 7510782..7511243 FT /rpt_family="L1" FT repeat_region 7511244..7511550 FT /rpt_family="Alu" FT repeat_region 7511551..7513465 FT /rpt_family="L1" FT repeat_region 7513470..7513559 FT /rpt_family="(TG)n" FT repeat_region 7513565..7513710 FT /rpt_family="(TA)n" FT repeat_region 7513711..7514078 FT /rpt_family="L1" FT repeat_region 7515994..7516218 FT /rpt_family="MER1_type" FT repeat_region 7516818..7516895 FT /rpt_family="GA-rich" FT repeat_region 7516926..7517108 FT /rpt_family="MER2_type" FT repeat_region 7517109..7518736 FT /rpt_family="ERV1" FT repeat_region 7518737..7518824 FT /rpt_family="MER2_type" FT repeat_region 7519018..7519142 FT /rpt_family="CR1" FT repeat_region 7520307..7520408 FT /rpt_family="L2" FT repeat_region 7520409..7520654 FT /rpt_family="MIR" FT repeat_region 7521874..7522174 FT /rpt_family="Alu" FT repeat_region 7522319..7522629 FT /rpt_family="L1" FT repeat_region 7522676..7522735 FT /rpt_family="MER2_type" FT repeat_region 7522705..7522768 FT /rpt_family="MER2_type" FT repeat_region 7522795..7522882 FT /rpt_family="MER2_type" FT repeat_region 7522899..7522981 FT /rpt_family="MER2_type" FT repeat_region 7522989..7523620 FT /rpt_family="L1" FT repeat_region 7523630..7523734 FT /rpt_family="L1" FT repeat_region 7523737..7524134 FT /rpt_family="L1" FT repeat_region 7524172..7524193 FT /rpt_family="AT_rich" FT repeat_region 7524351..7524776 FT /rpt_family="L1" FT repeat_region 7524816..7524866 FT /rpt_family="(TA)n" FT repeat_region 7524922..7526525 FT /rpt_family="L1" FT repeat_region 7526326..7526631 FT /rpt_family="L1" FT repeat_region 7526928..7527214 FT /rpt_family="Alu" FT repeat_region 7527332..7527799 FT /rpt_family="MaLR" FT repeat_region 7528655..7528918 FT /rpt_family="Alu" FT repeat_region 7529433..7529538 FT /rpt_family="L2" FT repeat_region 7530448..7530682 FT /rpt_family="ORSL" FT repeat_region 7530763..7530805 FT /rpt_family="MER4-group" FT repeat_region 7531053..7531193 FT /rpt_family="MaLR" FT repeat_region 7531291..7531350 FT /rpt_family="MIR" FT repeat_region 7531931..7532242 FT /rpt_family="Alu" FT repeat_region 7533789..7533884 FT /rpt_family="MIR" FT repeat_region 7533904..7533987 FT /rpt_family="Alu" FT repeat_region 7534089..7534221 FT /rpt_family="MIR" FT repeat_region 7534678..7534980 FT /rpt_family="MER1_type" FT repeat_region 7535110..7535925 FT /rpt_family="L2" FT repeat_region 7535940..7536042 FT /rpt_family="L2" FT repeat_region 7536936..7537186 FT /rpt_family="MIR" FT repeat_region 7538083..7538281 FT /rpt_family="L1" FT repeat_region 7539702..7539948 FT /rpt_family="L2" FT repeat_region 7541532..7541830 FT /rpt_family="Alu" FT repeat_region 7542323..7542611 FT /rpt_family="Alu" FT repeat_region 7542804..7543033 FT /rpt_family="MIR" FT repeat_region 7543846..7544160 FT /rpt_family="Alu" FT repeat_region 7546566..7546716 FT /rpt_family="MER1_type" FT repeat_region 7546596..7546731 FT /rpt_family="MER1_type" FT repeat_region 7547582..7547878 FT /rpt_family="Alu" FT repeat_region 7548328..7548428 FT /rpt_family="Alu" FT repeat_region 7548468..7548764 FT /rpt_family="Alu" FT repeat_region 7548767..7549010 FT /rpt_family="Alu" FT repeat_region 7549931..7550215 FT /rpt_family="Alu" FT repeat_region 7551069..7551265 FT /rpt_family="MIR" FT repeat_region 7551624..7552130 FT /rpt_family="L1" FT repeat_region 7552791..7552931 FT /rpt_family="MIR" FT repeat_region 7553969..7554104 FT /rpt_family="MIR" FT repeat_region 7556390..7556524 FT /rpt_family="Alu" FT repeat_region 7558677..7559044 FT /rpt_family="MaLR" FT repeat_region 7562336..7562581 FT /rpt_family="MER1_type" FT repeat_region 7562779..7563088 FT /rpt_family="Alu" FT STS complement(7564813..7565001) FT STS 7565008..7565264 FT repeat_region 7565402..7565500 FT /rpt_family="MIR" FT repeat_region 7565938..7566061 FT /rpt_family="L1" FT repeat_region 7566266..7566565 FT /rpt_family="Alu" FT repeat_region 7568181..7568524 FT /rpt_family="L1" FT repeat_region 7568651..7568937 FT /rpt_family="Alu" FT repeat_region 7569798..7569942 FT /rpt_family="MIR" FT repeat_region 7572015..7572196 FT /rpt_family="MIR" FT repeat_region 7575870..7575951 FT /rpt_family="L1" FT repeat_region 7576411..7576513 FT /rpt_family="MIR" FT repeat_region 7576517..7577107 FT /rpt_family="MER2_type" FT repeat_region 7577146..7577261 FT /rpt_family="MIR" FT repeat_region 7578763..7579182 FT /rpt_family="MaLR" FT repeat_region 7580088..7580207 FT /rpt_family="MIR" FT repeat_region 7581442..7581545 FT /rpt_family="L2" FT repeat_region 7581617..7581698 FT /rpt_family="L1" FT repeat_region 7581699..7581986 FT /rpt_family="Alu" FT repeat_region 7581987..7582138 FT /rpt_family="L1" FT repeat_region 7582229..7582586 FT /rpt_family="L2" FT repeat_region 7582592..7583515 FT /rpt_family="MER1_type" FT repeat_region 7583833..7587220 FT /rpt_family="L1" FT repeat_region 7587329..7587732 FT /rpt_family="L1" FT STS 7588587..7588962 FT repeat_region 7589012..7589137 FT /rpt_family="MER53" FT repeat_region 7590572..7590695 FT /rpt_family="MER1_type?" FT repeat_region 7593538..7593768 FT /rpt_family="L2" FT repeat_region 7594428..7594630 FT /rpt_family="MER1_type" FT repeat_region 7594702..7594872 FT /rpt_family="MIR" FT repeat_region 7594887..7595320 FT /rpt_family="Retroviral" FT repeat_region 7595410..7595513 FT /rpt_family="MER1_type" FT repeat_region 7595647..7595716 FT /rpt_family="L1" FT repeat_region 7595991..7597783 FT /rpt_family="L1" FT repeat_region 7597745..7601748 FT /rpt_family="L1" FT repeat_region 7601837..7602141 FT /rpt_family="Alu" FT repeat_region 7602671..7602973 FT /rpt_family="Alu" FT repeat_region 7603432..7603521 FT /rpt_family="L2" FT repeat_region 7603755..7603990 FT /rpt_family="MaLR" FT repeat_region 7604012..7604235 FT /rpt_family="L2" FT repeat_region 7604222..7604778 FT /rpt_family="L2" FT repeat_region 7605105..7605161 FT /rpt_family="Other" FT repeat_region 7605185..7605409 FT /rpt_family="L2" FT repeat_region 7605410..7605713 FT /rpt_family="Alu" FT repeat_region 7605714..7606208 FT /rpt_family="L2" FT repeat_region 7607421..7607661 FT /rpt_family="MER1_type" FT repeat_region 7608163..7608341 FT /rpt_family="MER1_type" FT repeat_region 7608929..7609053 FT /rpt_family="L2" FT repeat_region 7609185..7609765 FT /rpt_family="L2" FT repeat_region 7610038..7610559 FT /rpt_family="MER1_type" FT repeat_region 7611290..7611385 FT /rpt_family="MIR" FT repeat_region 7611486..7611671 FT /rpt_family="MER1_type" FT repeat_region 7614494..7614716 FT /rpt_family="MER2_type" FT repeat_region 7615838..7616815 FT /rpt_family="L2" FT repeat_region 7616816..7616850 FT /rpt_family="Mariner" FT repeat_region 7616851..7617579 FT /rpt_family="L2" FT repeat_region 7617585..7617833 FT /rpt_family="L2" FT repeat_region 7618031..7618123 FT /rpt_family="Alu" FT repeat_region 7618344..7618641 FT /rpt_family="Alu" FT repeat_region 7619016..7619188 FT /rpt_family="MER2_type" FT repeat_region 7619189..7619395 FT /rpt_family="MER1_type" FT repeat_region 7619396..7619553 FT /rpt_family="MER2_type" FT repeat_region 7620326..7620617 FT /rpt_family="Alu" FT repeat_region 7620671..7620951 FT /rpt_family="Alu" FT repeat_region 7621085..7621422 FT /rpt_family="MaLR" FT repeat_region 7621556..7621621 FT /rpt_family="MaLR" FT repeat_region 7622291..7622498 FT /rpt_family="L2" FT gene 7622751..7645706 FT /gene="WUGSC:H_DJ1159O04.1" FT CDS join(7622751..7623003,7625267..7625436,7628129..7628194, FT 7629036..7629194,7634611..7634763,7635888..7636092, FT 7645573..7645706) FT /codon_start=1 FT /gene="WUGSC:H_DJ1159O04.1" FT /product="similar to yeast hypothetical protein ybk4; FT similar to P38164 (PID:g586461)" FT /note="H_DJ1159O04.1" FT /inference="non-experimental evidence, no additional FT details recorded" FT /protein_id="AAC31788.1" FT /translation="MVESSRHNWSGLDKQSDIQNLNEERILALQLCGWIKKGTDVDVGP FT FLNSLVQEGEWERAAAVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKN FT SLWREMCSTLRLQLNNPYLCVMFAFLTSETGSYDGVLYENKVAVRDRVAFACKFLSDTQ FT LNRYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDV FT LKDERVQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISY FT SCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKS FT DEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFR" FT repeat_region 7625064..7625133 FT /rpt_family="MER4-group" FT misc_feature 7625288..7625436 FT /gene="WUGSC:H_DJ1159O04.1" FT /note="match to EST AA147157 (NID:g1716532) zo32e04.r1" FT repeat_region 7626621..7626950 FT /rpt_family="Alu" FT misc_feature 7628128..7628194 FT /gene="WUGSC:H_DJ1159O04.1" FT /note="match to EST AA147157 (NID:g1716532) zo32e04.r1" FT misc_feature 7629033..7629195 FT /gene="WUGSC:H_DJ1159O04.1" FT /note="match to EST AA147157 (NID:g1716532) zo32e04.r1" FT repeat_region 7630126..7630916 FT /rpt_family="L1" FT repeat_region 7630917..7631210 FT /rpt_family="Alu" FT repeat_region 7631211..7631615 FT /rpt_family="L1" FT repeat_region 7631616..7631919 FT /rpt_family="Alu" FT repeat_region 7631920..7632044 FT /rpt_family="L1" FT repeat_region 7632045..7632537 FT /rpt_family="MER1_type" FT repeat_region 7632538..7632561 FT /rpt_family="L1" FT repeat_region 7633243..7633537 FT /rpt_family="Alu" FT repeat_region 7633943..7634225 FT /rpt_family="Alu" FT misc_feature 7634609..7634762 FT /gene="WUGSC:H_DJ1159O04.1" FT /note="match to EST AA147157 (NID:g1716532) zo32e04.r1" FT misc_feature complement(7634685..7634765) FT /note="match to EST AA146978 (NID:g1716473) zo32e04.s1" FT misc_feature 7635888..7635953 FT /gene="WUGSC:H_DJ1159O04.1" FT /note="match to EST AA147157 (NID:g1716532) zo32e04.r1" FT misc_feature complement(7635890..7636093) FT /note="match to EST AA146978 (NID:g1716473) zo32e04.s1" FT misc_feature complement(7635932..7636093) FT /note="match to EST AA521351 (NID:g2261894) aa68h09.s1" FT repeat_region 7636544..7636669 FT /rpt_family="Alu" FT repeat_region 7636676..7636974 FT /rpt_family="Alu" FT repeat_region 7637319..7637595 FT /rpt_family="Alu" FT repeat_region 7637793..7637895 FT /rpt_family="MIR" FT repeat_region 7638733..7639026 FT /rpt_family="MER2_type" FT repeat_region 7639393..7639809 FT /rpt_family="L1" FT repeat_region 7639902..7643849 FT /rpt_family="L1" FT repeat_region 7644073..7644187 FT /rpt_family="L2" FT repeat_region 7644833..7644928 FT /rpt_family="L1" FT repeat_region 7644929..7645225 FT /rpt_family="Alu" FT repeat_region 7645226..7645322 FT /rpt_family="L1" FT misc_feature complement(7645565..7645703) FT /note="match to EST AA521351 (NID:g2261894) aa68h09.s1" FT /note="match to EST AA146978 (NID:g1716473) zo32e04.s1" FT misc_feature complement(7645641..7645703) FT /note="match to EST AA810777 (NID:g2880388) oa82e07.s1" FT repeat_region 7646439..7646566 FT /rpt_family="Alu" FT misc_feature complement(7646625..7647112) FT /note="match to EST AA810777 (NID:g2880388) oa82e07.s1" FT misc_feature complement(7646625..7646860) FT /note="match to EST AA146978 (NID:g1716473) zo32e04.s1" FT misc_feature complement(7646625..7646857) FT /note="match to EST AA521351 (NID:g2261894) aa68h09.s1" FT repeat_region 7649085..7649255 FT /rpt_family="MIR" FT repeat_region 7650288..7650515 FT /rpt_family="MIR" FT repeat_region 7651348..7651435 FT /rpt_family="L1" FT STS 7652890..7653148 FT repeat_region 7655972..7656030 FT /rpt_family="L1" FT repeat_region 7656031..7656335 FT /rpt_family="Alu" FT repeat_region 7656164..7656329 FT /rpt_family="Alu" FT repeat_region 7656331..7656559 FT /rpt_family="L1" FT repeat_region 7656560..7656856 FT /rpt_family="Alu" FT repeat_region 7656857..7657205 FT /rpt_family="L1" FT repeat_region 7657589..7658016 FT /rpt_family="L1" FT repeat_region 7658148..7658215 FT /rpt_family="(TTCC)n" FT repeat_region 7658216..7658350 FT /rpt_family="Alu" FT repeat_region 7658802..7658838 FT /rpt_family="ERVL" FT repeat_region 7658839..7658890 FT /rpt_family="(CA)n" FT repeat_region 7658891..7659057 FT /rpt_family="ERVL" FT repeat_region 7659058..7659092 FT /rpt_family="(TG)n" FT repeat_region 7659093..7659408 FT /rpt_family="ERVL" FT repeat_region 7661107..7661401 FT /rpt_family="Alu" FT repeat_region 7661692..7661984 FT /rpt_family="Alu" FT repeat_region 7664263..7664557 FT /rpt_family="Alu" FT repeat_region 7664591..7664643 FT /rpt_family="L2" FT repeat_region 7664787..7665026 FT /rpt_family="MER2_type" FT repeat_region 7665027..7665282 FT /rpt_family="Alu" FT repeat_region 7665283..7665382 FT /rpt_family="MER2_type" FT repeat_region 7665642..7666702 FT /rpt_family="ERVK" FT repeat_region 7666894..7666954 FT /rpt_family="L1" FT repeat_region 7667003..7667305 FT /rpt_family="Alu" FT repeat_region 7667807..7668104 FT /rpt_family="Alu" FT repeat_region 7668400..7668458 FT /rpt_family="L1" FT repeat_region 7668534..7669117 FT /rpt_family="L1" FT repeat_region 7669174..7669309 FT /rpt_family="L2" FT repeat_region 7669361..7670109 FT /rpt_family="L1" FT repeat_region 7670393..7670748 FT /rpt_family="MaLR" FT repeat_region 7670749..7672232 FT /rpt_family="MaLR" FT repeat_region 7672233..7672402 FT /rpt_family="MaLR" FT repeat_region 7672403..7672677 FT /rpt_family="Alu" FT repeat_region 7672678..7672889 FT /rpt_family="MaLR" FT repeat_region 7672968..7673182 FT /rpt_family="MER2_type" FT repeat_region 7673185..7673484 FT /rpt_family="Alu" FT repeat_region 7673509..7673685 FT /rpt_family="Alu" FT repeat_region 7673674..7673924 FT /rpt_family="MER2_type" FT repeat_region 7673925..7674075 FT /rpt_family="Alu" FT repeat_region 7674100..7674409 FT /rpt_family="Alu" FT repeat_region 7674417..7675066 FT /rpt_family="MER2_type" FT repeat_region 7675500..7675781 FT /rpt_family="Alu" FT repeat_region 7675844..7676133 FT /rpt_family="Alu" FT gene complement(7676347..7726959) FT /gene="RPA3" FT mRNA complement(join(7676347..7676713,7677495..7677603, FT 7678701..7678775,7679951..7680072)) FT /gene="RPA3" FT mRNA complement(join(7676557..7676713,7677495..7677603, FT 7678701..7678775,7679951..7680094)) FT /gene="RPA3" FT mRNA complement(join(7676575..7676713,7677495..7677603, FT 7678701..7678775,7679951..7680806,7725461..7725629, FT 7726859..7726959)) FT /gene="RPA3" FT CDS complement(join(7676631..7676713,7677495..7677603, FT 7678701..7678775,7679951..7680049)) FT /codon_start=1 FT /gene="RPA3" FT /product="unknown" FT /note="Homo sapiens replication protein A3 (14kD) (RPA3), FT mRNA.; H_DJ1007H16.1" FT /protein_id="AAQ96878.1" FT /translation="MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSD FT GEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVK FT IIHDFPQFYPLGIVQHD" FT repeat_region 7678005..7678082 FT /rpt_family="A-rich" FT repeat_region 7678096..7678172 FT /rpt_family="Alu" FT repeat_region 7678173..7678211 FT /rpt_family="(CAAAA)n" FT repeat_region 7678212..7678389 FT /rpt_family="Alu" FT repeat_region 7679220..7679372 FT /rpt_family="MIR" FT misc_feature 7679841..7680679 FT /note="CpG_island (%GC=60.9, o/e=0.87, #CpGs=69)" FT repeat_region 7681026..7681111 FT /rpt_family="MIR" FT repeat_region 7681775..7682076 FT /rpt_family="Alu" FT repeat_region 7682355..7682648 FT /rpt_family="L1" FT repeat_region 7682655..7683059 FT /rpt_family="ERV1" FT repeat_region 7683060..7683374 FT /rpt_family="Alu" FT repeat_region 7683375..7683647 FT /rpt_family="ERV1" FT repeat_region 7683650..7683868 FT /rpt_family="L1" FT repeat_region 7684313..7684749 FT /rpt_family="L1" FT repeat_region 7684770..7684900 FT /rpt_family="L1" FT repeat_region 7684962..7685165 FT /rpt_family="MaLR" FT repeat_region 7685225..7685537 FT /rpt_family="L1" FT repeat_region 7685540..7685920 FT /rpt_family="ERV1" FT repeat_region 7685921..7686300 FT /rpt_family="MaLR" FT repeat_region 7686301..7686629 FT /rpt_family="ERV1" FT repeat_region 7686788..7687104 FT /rpt_family="L1" FT repeat_region 7687248..7687535 FT /rpt_family="Alu" FT repeat_region 7688004..7688130 FT /rpt_family="L1" FT repeat_region 7688131..7688211 FT /rpt_family="MaLR" FT repeat_region 7688212..7688507 FT /rpt_family="Alu" FT repeat_region 7688508..7688819 FT /rpt_family="Alu" FT repeat_region 7688820..7689155 FT /rpt_family="MaLR" FT repeat_region 7689156..7689320 FT /rpt_family="L1" FT repeat_region 7689350..7689698 FT /rpt_family="MaLR" FT repeat_region 7690162..7690274 FT /rpt_family="L1" FT repeat_region 7690559..7690701 FT /rpt_family="ERVL" FT repeat_region 7690782..7690804 FT /rpt_family="AT_rich" FT repeat_region 7690903..7690964 FT /rpt_family="ERV1" FT repeat_region 7690958..7691148 FT /rpt_family="ERV1" FT repeat_region 7692252..7692369 FT /rpt_family="L2" FT repeat_region 7693388..7693596 FT /rpt_family="MER1_type" FT repeat_region 7694060..7694240 FT /rpt_family="MER2_type" FT repeat_region 7694252..7694549 FT /rpt_family="Alu" FT repeat_region 7695029..7695049 FT /rpt_family="AT_rich" FT repeat_region 7695384..7695416 FT /rpt_family="AT_rich" FT repeat_region 7695469..7695765 FT /rpt_family="Alu" FT repeat_region 7695843..7695938 FT /rpt_family="MER1_type" FT repeat_region 7702413..7702631 FT /rpt_family="MER1_type" FT repeat_region 7702783..7702893 FT /rpt_family="MER1_type" FT repeat_region 7703193..7703550 FT /rpt_family="ERV1" FT repeat_region 7703690..7703787 FT /rpt_family="MER1_type" FT repeat_region 7704626..7704681 FT /rpt_family="(CATA)n" FT repeat_region 7705146..7705183 FT /rpt_family="L1" FT repeat_region 7705184..7705810 FT /rpt_family="L1" FT repeat_region 7705811..7705846 FT /rpt_family="(TTTG)n" FT repeat_region 7705851..7706138 FT /rpt_family="Alu" FT repeat_region 7706139..7706421 FT /rpt_family="L1" FT repeat_region 7706432..7706739 FT /rpt_family="Alu" FT repeat_region 7707448..7707559 FT /rpt_family="MIR" FT repeat_region 7707560..7707843 FT /rpt_family="Alu" FT repeat_region 7707844..7707920 FT /rpt_family="MIR" FT repeat_region 7707928..7708168 FT /rpt_family="MER2_type" FT repeat_region 7708169..7708756 FT /rpt_family="MER2_type" FT repeat_region 7708773..7708872 FT /rpt_family="MER2_type" FT repeat_region 7708896..7708935 FT /rpt_family="L2" FT repeat_region 7710028..7710133 FT /rpt_family="MaLR" FT repeat_region 7710315..7710480 FT /rpt_family="MaLR" FT repeat_region 7711978..7712023 FT /rpt_family="(TG)n" FT repeat_region 7712106..7712445 FT /rpt_family="MaLR" FT repeat_region 7712942..7713002 FT /rpt_family="(CAG)n" FT repeat_region 7713130..7713214 FT /rpt_family="AT_rich" FT repeat_region 7713456..7713485 FT /rpt_family="L2" FT repeat_region 7714626..7714672 FT /rpt_family="AT_rich" FT repeat_region 7714678..7714795 FT /rpt_family="Alu" FT repeat_region 7715764..7715956 FT /rpt_family="MIR" FT repeat_region 7715946..7716103 FT /rpt_family="MIR" FT repeat_region 7716312..7716353 FT /rpt_family="AT_rich" FT repeat_region 7716737..7717295 FT /rpt_family="L1" FT repeat_region 7717296..7717603 FT /rpt_family="Alu" FT repeat_region 7717604..7718036 FT /rpt_family="L1" FT repeat_region 7718037..7718081 FT /rpt_family="AT_rich" FT repeat_region 7718082..7718960 FT /rpt_family="(TA)n" FT unsure 7718087..7719349 FT /note="unresolved tandem repeat" FT repeat_region 7718972..7718993 FT /rpt_family="AT_rich" FT repeat_region 7719005..7719172 FT /rpt_family="(TA)n" FT repeat_region 7719189..7719363 FT /rpt_family="(TA)n" FT repeat_region 7719390..7719495 FT /rpt_family="Alu" FT repeat_region 7719496..7720570 FT /rpt_family="L1" FT repeat_region 7722855..7723022 FT /rpt_family="MER1_type" FT repeat_region 7723243..7723553 FT /rpt_family="Alu" FT repeat_region 7723580..7723837 FT /rpt_family="MER2_type" FT repeat_region 7723838..7724138 FT /rpt_family="Alu" FT repeat_region 7724139..7724226 FT /rpt_family="MER2_type" FT repeat_region 7724676..7724711 FT /rpt_family="AT_rich" FT repeat_region 7724946..7725238 FT /rpt_family="Alu" FT repeat_region 7725284..7725401 FT /rpt_family="ERV1" FT repeat_region 7725593..7725684 FT /rpt_family="MER1_type" FT repeat_region 7726398..7726774 FT /rpt_family="MaLR" FT repeat_region 7726784..7726930 FT /rpt_family="MIR" FT repeat_region 7728695..7729166 FT /rpt_family="MaLR" FT repeat_region 7730101..7730152 FT /rpt_family="AT_rich" FT repeat_region 7731185..7731329 FT /rpt_family="MIR" FT repeat_region 7732074..7732216 FT /rpt_family="L1" FT repeat_region 7732241..7732537 FT /rpt_family="Alu" FT repeat_region 7732927..7732968 FT /rpt_family="(TCTA)n" FT repeat_region 7733247..7733274 FT /rpt_family="AT_rich" FT repeat_region 7733806..7733855 FT /rpt_family="L1" FT repeat_region 7733866..7734825 FT /rpt_family="L1" FT repeat_region 7735650..7735851 FT /rpt_family="Alu" FT repeat_region 7736750..7736773 FT /rpt_family="AT_rich" FT repeat_region 7737722..7737777 FT /rpt_family="L2" FT repeat_region 7738502..7738783 FT /rpt_family="Alu" FT repeat_region 7738941..7738963 FT /rpt_family="AT_rich" FT repeat_region 7739376..7739436 FT /rpt_family="L2" FT repeat_region 7739690..7740026 FT /rpt_family="MaLR" FT repeat_region 7740075..7740204 FT /rpt_family="Alu" FT repeat_region 7740205..7740226 FT /rpt_family="(CAAA)n" FT repeat_region 7740237..7740533 FT /rpt_family="Alu" FT repeat_region 7740534..7740696 FT /rpt_family="Alu" FT repeat_region 7742413..7742443 FT /rpt_family="(TTG)n" FT repeat_region 7743068..7743102 FT /rpt_family="AT_rich" FT repeat_region 7743316..7743588 FT /rpt_family="Alu" FT repeat_region 7743589..7743626 FT /rpt_family="(GGAA)n" FT repeat_region 7743697..7744085 FT /rpt_family="MER1_type" FT repeat_region 7744105..7744424 FT /rpt_family="Alu" FT repeat_region 7745300..7745610 FT /rpt_family="L1" FT repeat_region 7746178..7746249 FT /rpt_family="MIR" FT repeat_region 7746264..7746441 FT /rpt_family="MIR" FT repeat_region 7747012..7747078 FT /rpt_family="MIR" FT repeat_region 7748315..7748344 FT /rpt_family="AT_rich" FT repeat_region 7748536..7748570 FT /rpt_family="(TG)n" FT repeat_region 7748571..7748616 FT /rpt_family="GA-rich" FT repeat_region 7749617..7749877 FT /rpt_family="L1" FT repeat_region 7749953..7750909 FT /rpt_family="L1" FT repeat_region 7750919..7751313 FT /rpt_family="L1" FT repeat_region 7751889..7752109 FT /rpt_family="L1" FT repeat_region 7752176..7752398 FT /rpt_family="L1" FT repeat_region 7752688..7753010 FT /rpt_family="Alu" FT repeat_region 7753137..7753424 FT /rpt_family="L1" FT repeat_region 7753471..7753627 FT /rpt_family="Alu" FT repeat_region 7753638..7753814 FT /rpt_family="L1" FT repeat_region 7754479..7754503 FT /rpt_family="(T)n" FT repeat_region 7754575..7754597 FT /rpt_family="(CAA)n" FT repeat_region 7754876..7754962 FT /rpt_family="L2" FT repeat_region 7755127..7755229 FT /rpt_family="L2" FT repeat_region 7755949..7756295 FT /rpt_family="ERV1" FT repeat_region 7756296..7756517 FT /rpt_family="Alu" FT repeat_region 7756518..7756675 FT /rpt_family="ERV1" FT repeat_region 7756676..7756987 FT /rpt_family="Alu" FT repeat_region 7756988..7757111 FT /rpt_family="ERV1" FT repeat_region 7757955..7758018 FT /rpt_family="L2" FT repeat_region 7758475..7758583 FT /rpt_family="MER1_type" FT repeat_region 7759931..7760106 FT /rpt_family="MER1_type" FT repeat_region 7760323..7760350 FT /rpt_family="AT_rich" FT repeat_region 7760445..7760908 FT /rpt_family="MaLR" FT repeat_region 7761390..7761788 FT /rpt_family="ERVL" FT repeat_region 7761789..7761848 FT /rpt_family="(TA)n" FT repeat_region 7761849..7761887 FT /rpt_family="ERVL" FT repeat_region 7765860..7767126 FT /rpt_family="ERVL" FT repeat_region 7767127..7767655 FT /rpt_family="ERVL" FT repeat_region 7767876..7767994 FT /rpt_family="MIR" FT repeat_region 7767995..7768291 FT /rpt_family="Alu" FT repeat_region 7768292..7768364 FT /rpt_family="MIR" FT repeat_region 7768452..7769022 FT /rpt_family="L2" FT repeat_region 7769840..7770010 FT /rpt_family="MER1_type" FT repeat_region 7770475..7770623 FT /rpt_family="L2" FT repeat_region 7770624..7770648 FT /rpt_family="(TTTG)n" FT repeat_region 7770651..7770930 FT /rpt_family="Alu" FT repeat_region 7770931..7771075 FT /rpt_family="L2" FT repeat_region 7771463..7771644 FT /rpt_family="MIR" FT repeat_region 7773989..7774023 FT /rpt_family="AT_rich" FT repeat_region 7774613..7774635 FT /rpt_family="AT_rich" FT repeat_region 7775045..7775340 FT /rpt_family="Alu" FT repeat_region 7776813..7777008 FT /rpt_family="MIR" FT repeat_region 7777479..7777573 FT /rpt_family="MIR" FT repeat_region 7779787..7779824 FT /rpt_family="CT-rich" FT repeat_region 7780341..7780417 FT /rpt_family="CR1" FT repeat_region 7780921..7781261 FT /rpt_family="Alu" FT repeat_region 7781668..7781731 FT /rpt_family="L2" FT repeat_region 7783315..7783376 FT /rpt_family="ERVL" FT repeat_region 7783386..7783528 FT /rpt_family="L1" FT repeat_region 7783539..7784512 FT /rpt_family="L1" FT repeat_region 7784517..7784954 FT /rpt_family="MER2_type" FT repeat_region 7785124..7785231 FT /rpt_family="L2" FT repeat_region 7785567..7785670 FT /rpt_family="Alu" FT repeat_region 7786578..7786636 FT /rpt_family="(TG)n" FT repeat_region 7786951..7787120 FT /rpt_family="MIR" FT repeat_region 7787620..7787874 FT /rpt_family="Alu" FT repeat_region 7787881..7787962 FT /rpt_family="AT_rich" FT repeat_region 7788353..7788404 FT /rpt_family="(TA)n" FT repeat_region 7789781..7789918 FT /rpt_family="MIR" FT repeat_region 7790208..7790442 FT /rpt_family="MIR" FT repeat_region 7791325..7791612 FT /rpt_family="AcHobo" FT repeat_region 7791606..7792582 FT /rpt_family="AcHobo" FT repeat_region 7792766..7793532 FT /rpt_family="L1" FT repeat_region 7793533..7793845 FT /rpt_family="Alu" FT repeat_region 7793846..7794160 FT /rpt_family="L1" FT repeat_region 7794191..7794323 FT /rpt_family="MER1_type" FT repeat_region 7794332..7794419 FT /rpt_family="MER1_type" FT repeat_region 7794601..7794778 FT /rpt_family="L2" FT repeat_region 7795998..7796206 FT /rpt_family="MaLR" FT repeat_region 7796242..7796412 FT /rpt_family="L1" FT repeat_region 7796458..7796510 FT /rpt_family="MER1_type" FT repeat_region 7797285..7797477 FT /rpt_family="MIR" FT repeat_region 7797680..7797711 FT /rpt_family="AT_rich" FT repeat_region 7797712..7797839 FT /rpt_family="Alu" FT repeat_region 7798039..7798072 FT /rpt_family="AT_rich" FT repeat_region 7798204..7798535 FT /rpt_family="L1" FT repeat_region 7798597..7798664 FT /rpt_family="MIR" FT repeat_region 7798944..7798982 FT /rpt_family="AT_rich" FT repeat_region 7799240..7799465 FT /rpt_family="L2" FT repeat_region 7799538..7799985 FT /rpt_family="MaLR" FT repeat_region 7799987..7800037 FT /rpt_family="Alu" FT repeat_region 7800044..7800085 FT /rpt_family="(TAA)n" FT repeat_region 7800659..7800713 FT /rpt_family="MER1_type" FT repeat_region 7800714..7801006 FT /rpt_family="Alu" FT repeat_region 7801007..7801059 FT /rpt_family="MER1_type" FT repeat_region 7801073..7801165 FT /rpt_family="MER1_type" FT repeat_region 7801576..7801613 FT /rpt_family="L2" FT repeat_region 7802858..7802886 FT /rpt_family="AT_rich" FT repeat_region 7802898..7803141 FT /rpt_family="L1" FT repeat_region 7803188..7803213 FT /rpt_family="AT_rich" FT repeat_region 7803226..7803361 FT /rpt_family="Alu" FT repeat_region 7803989..7804027 FT /rpt_family="AT_rich" FT repeat_region 7805062..7805117 FT /rpt_family="AT_rich" FT repeat_region 7805340..7805415 FT /rpt_family="L2" FT repeat_region 7805854..7805874 FT /rpt_family="AT_rich" FT repeat_region 7806439..7806558 FT /rpt_family="L2" FT repeat_region 7806760..7807055 FT /rpt_family="Alu" FT repeat_region 7807297..7807497 FT /rpt_family="MIR" FT repeat_region 7807752..7807787 FT /rpt_family="AT_rich" FT repeat_region 7808272..7808391 FT /rpt_family="L2" FT repeat_region 7810301..7810354 FT /rpt_family="L2" FT repeat_region 7810355..7810394 FT /rpt_family="L1" FT repeat_region 7810395..7810717 FT /rpt_family="L2" FT repeat_region 7811511..7811698 FT /rpt_family="MER1_type" FT repeat_region 7814007..7814094 FT /rpt_family="MIR" FT repeat_region 7814292..7814466 FT /rpt_family="L2" FT repeat_region 7814807..7814884 FT /rpt_family="L1" FT repeat_region 7814885..7815238 FT /rpt_family="MaLR" FT repeat_region 7815239..7815457 FT /rpt_family="L1" FT repeat_region 7815442..7815700 FT /rpt_family="L1" FT repeat_region 7815709..7815787 FT /rpt_family="L1" FT repeat_region 7815812..7815942 FT /rpt_family="Alu" FT repeat_region 7815992..7816207 FT /rpt_family="L1" FT repeat_region 7816569..7816855 FT /rpt_family="L1" FT repeat_region 7816856..7817160 FT /rpt_family="Alu" FT repeat_region 7817161..7817200 FT /rpt_family="L1" FT repeat_region 7817206..7817236 FT /rpt_family="(TA)n" FT repeat_region 7817858..7817907 FT /rpt_family="(TG)n" FT repeat_region 7817907..7817939 FT /rpt_family="(GA)n" FT repeat_region 7817941..7818045 FT /rpt_family="L1" FT repeat_region 7818049..7818346 FT /rpt_family="Alu" FT repeat_region 7818520..7818704 FT /rpt_family="MIR" FT repeat_region 7818915..7819228 FT /rpt_family="Alu" FT repeat_region 7819267..7819574 FT /rpt_family="Alu" FT repeat_region 7820115..7820762 FT /rpt_family="L1" FT repeat_region 7820949..7821402 FT /rpt_family="L1" FT repeat_region 7822135..7822219 FT /rpt_family="T-rich" FT repeat_region 7822366..7822663 FT /rpt_family="Alu" FT repeat_region 7823740..7823880 FT /rpt_family="MIR" FT repeat_region 7823969..7824275 FT /rpt_family="Alu" FT repeat_region 7824385..7824598 FT /rpt_family="Alu" FT repeat_region 7824956..7825410 FT /rpt_family="L2" FT repeat_region 7825520..7825574 FT /rpt_family="(TCTA)n" FT repeat_region 7825606..7825657 FT /rpt_family="L1" FT repeat_region 7825664..7825765 FT /rpt_family="L1" FT repeat_region 7825773..7826110 FT /rpt_family="L1" FT repeat_region 7827666..7827781 FT /rpt_family="L2" FT repeat_region 7829093..7829590 FT /rpt_family="L1" FT repeat_region 7829746..7829908 FT /rpt_family="MER1_type" FT repeat_region 7830515..7830818 FT /rpt_family="Alu" FT repeat_region 7831700..7831738 FT /rpt_family="L2" FT repeat_region 7831747..7831928 FT /rpt_family="L1" FT repeat_region 7832200..7832235 FT /rpt_family="MIR" FT repeat_region 7832324..7832693 FT /rpt_family="MaLR" FT repeat_region 7832797..7832980 FT /rpt_family="MIR" FT repeat_region 7833592..7833695 FT /rpt_family="MER103" FT repeat_region 7834070..7834923 FT /rpt_family="ERV1" FT repeat_region 7835059..7835656 FT /rpt_family="ERV1" FT repeat_region 7835784..7835871 FT /rpt_family="ERV1" FT repeat_region 7835872..7836181 FT /rpt_family="Alu" FT repeat_region 7836182..7836609 FT /rpt_family="ERV1" FT repeat_region 7836610..7837003 FT /rpt_family="MaLR" FT repeat_region 7837004..7837055 FT /rpt_family="ERV1" FT repeat_region 7837323..7837617 FT /rpt_family="Alu" FT repeat_region 7837685..7837871 FT /rpt_family="MER1_type" FT repeat_region 7838355..7838486 FT /rpt_family="MIR" FT repeat_region 7839523..7839813 FT /rpt_family="Alu" FT repeat_region 7839855..7839941 FT /rpt_family="L2" FT repeat_region 7840076..7840268 FT /rpt_family="L1" FT repeat_region 7840172..7840268 FT /rpt_family="L1" FT repeat_region 7841729..7842024 FT /rpt_family="Alu" FT repeat_region 7842362..7842452 FT /rpt_family="L2" FT repeat_region 7842499..7842527 FT /rpt_family="AT_rich" FT repeat_region 7842664..7842761 FT /rpt_family="L2" FT repeat_region 7842825..7843044 FT /rpt_family="Alu" FT repeat_region 7843193..7843523 FT /rpt_family="MaLR" FT repeat_region 7843972..7844019 FT /rpt_family="L2" FT repeat_region 7844024..7844327 FT /rpt_family="Alu" FT repeat_region 7844331..7844648 FT /rpt_family="Alu" FT repeat_region 7844711..7845637 FT /rpt_family="L2" FT repeat_region 7845665..7845795 FT /rpt_family="L2" FT repeat_region 7849042..7849348 FT /rpt_family="L1" FT repeat_region 7849601..7849728 FT /rpt_family="CR1" FT repeat_region 7849877..7850008 FT /rpt_family="L1" FT repeat_region 7850040..7850182 FT /rpt_family="L1" FT repeat_region 7852843..7852862 FT /rpt_family="(TTG)n" FT repeat_region 7852866..7853134 FT /rpt_family="Alu" FT repeat_region 7853612..7853905 FT /rpt_family="Alu" FT repeat_region 7854869..7854979 FT /rpt_family="MIR" FT repeat_region 7855204..7855496 FT /rpt_family="MaLR" FT repeat_region 7855689..7855890 FT /rpt_family="MIR" FT repeat_region 7856300..7856661 FT /rpt_family="L2" FT repeat_region 7857455..7857615 FT /rpt_family="Alu" FT repeat_region 7857626..7857991 FT /rpt_family="L1" FT repeat_region 7857993..7858426 FT /rpt_family="L1" FT repeat_region 7858430..7858477 FT /rpt_family="Alu" FT repeat_region 7858481..7858780 FT /rpt_family="Alu" FT repeat_region 7860838..7861130 FT /rpt_family="MER1_type" FT repeat_region 7862911..7863057 FT /rpt_family="MER53" FT repeat_region 7863786..7863865 FT /rpt_family="L2" FT repeat_region 7863937..7864382 FT /rpt_family="L2" FT repeat_region 7864973..7865299 FT /rpt_family="MaLR" FT repeat_region 7865453..7865762 FT /rpt_family="MER2_type" FT repeat_region 7865995..7866048 FT /rpt_family="L2" FT repeat_region 7866281..7866386 FT /rpt_family="MaLR" FT repeat_region 7866754..7866779 FT /rpt_family="(TA)n" FT repeat_region 7866779..7866809 FT /rpt_family="(TG)n" FT repeat_region 7867077..7867120 FT /rpt_family="AT_rich" FT repeat_region 7867127..7867253 FT /rpt_family="MER1_type" FT repeat_region 7867947..7868094 FT /rpt_family="MIR" FT repeat_region 7869460..7869749 FT /rpt_family="L2" FT repeat_region 7870095..7870158 FT /rpt_family="T-rich" FT repeat_region 7870569..7870594 FT /rpt_family="AT_rich" FT repeat_region 7871282..7871401 FT /rpt_family="MIR" FT repeat_region 7872633..7872813 FT /rpt_family="L2" FT repeat_region 7873643..7873953 FT /rpt_family="Alu" FT repeat_region 7874065..7874405 FT /rpt_family="MaLR" FT repeat_region 7874506..7874750 FT /rpt_family="MaLR" FT repeat_region 7875094..7875131 FT /rpt_family="(T)n" FT repeat_region 7875145..7875289 FT /rpt_family="L2" FT repeat_region 7875885..7876022 FT /rpt_family="L1" FT repeat_region 7876149..7877048 FT /rpt_family="L1" FT repeat_region 7877176..7877432 FT /rpt_family="L1" FT repeat_region 7877526..7877752 FT /rpt_family="L1" FT repeat_region 7877766..7877935 FT /rpt_family="MER1_type" FT repeat_region 7878017..7878121 FT /rpt_family="L1" FT repeat_region 7878147..7878756 FT /rpt_family="L1" FT repeat_region 7878844..7879104 FT /rpt_family="Alu" FT repeat_region 7879145..7879455 FT /rpt_family="L2" FT repeat_region 7879433..7879865 FT /rpt_family="L2" FT repeat_region 7879666..7879941 FT /rpt_family="L2" FT repeat_region 7879945..7880111 FT /rpt_family="MER1_type" FT repeat_region 7880226..7880291 FT /rpt_family="MIR" FT repeat_region 7880946..7881234 FT /rpt_family="Alu" FT repeat_region 7881783..7881874 FT /rpt_family="MIR" FT repeat_region 7882242..7882262 FT /rpt_family="AT_rich" FT repeat_region 7882422..7882553 FT /rpt_family="L2" FT repeat_region 7884661..7884977 FT /rpt_family="MER1_type" FT repeat_region 7884984..7885113 FT /rpt_family="MIR" FT repeat_region 7885735..7885849 FT /rpt_family="MIR" FT repeat_region 7886450..7886700 FT /rpt_family="L1" FT repeat_region 7886736..7886785 FT /rpt_family="(TA)n" FT repeat_region 7886820..7886930 FT /rpt_family="AcHobo" FT repeat_region 7887367..7887471 FT /rpt_family="Alu" FT repeat_region 7888322..7888351 FT /rpt_family="AT_rich" FT repeat_region 7888733..7888851 FT /rpt_family="MIR" FT repeat_region 7888942..7888984 FT /rpt_family="MIR" FT repeat_region 7889204..7889557 FT /rpt_family="L2" FT repeat_region 7889568..7889741 FT /rpt_family="L1" FT repeat_region 7889773..7890411 FT /rpt_family="MER1_type" FT repeat_region 7890444..7890718 FT /rpt_family="MER1_type" FT repeat_region 7890720..7891834 FT /rpt_family="L1" FT repeat_region 7891835..7892788 FT /rpt_family="ERV1" FT repeat_region 7892789..7893633 FT /rpt_family="L1" FT repeat_region 7893634..7893704 FT /rpt_family="MaLR" FT repeat_region 7893705..7894010 FT /rpt_family="Alu" FT repeat_region 7894011..7894313 FT /rpt_family="MaLR" FT repeat_region 7894316..7895850 FT /rpt_family="MaLR" FT repeat_region 7895852..7896216 FT /rpt_family="MaLR" FT repeat_region 7896217..7896358 FT /rpt_family="L1" FT repeat_region 7897665..7897800 FT /rpt_family="MIR" FT repeat_region 7899173..7899324 FT /rpt_family="MIR" FT repeat_region 7899830..7899854 FT /rpt_family="AT_rich" FT repeat_region 7900110..7900447 FT /rpt_family="Alu" FT repeat_region 7900454..7900904 FT /rpt_family="L1" FT repeat_region 7901829..7901873 FT /rpt_family="AT_rich" FT repeat_region 7902803..7903009 FT /rpt_family="MIR" FT repeat_region 7903175..7903217 FT /rpt_family="T-rich" FT repeat_region 7903595..7903742 FT /rpt_family="ERV1" FT repeat_region 7903743..7904233 FT /rpt_family="MER2_type" FT repeat_region 7904234..7904282 FT /rpt_family="(CA)n" FT repeat_region 7904283..7904363 FT /rpt_family="MER2_type" FT repeat_region 7904364..7905043 FT /rpt_family="ERV1" FT repeat_region 7905837..7906142 FT /rpt_family="L2" FT repeat_region 7906282..7907809 FT /rpt_family="L2" FT repeat_region 7908545..7908638 FT /rpt_family="L2" FT repeat_region 7910582..7910686 FT /rpt_family="L1" FT repeat_region 7911028..7911231 FT /rpt_family="MIR" FT repeat_region 7911274..7911396 FT /rpt_family="MIR" FT repeat_region 7911712..7911747 FT /rpt_family="(A)n" FT repeat_region 7911786..7911980 FT /rpt_family="MER2_type" FT repeat_region 7911985..7912360 FT /rpt_family="MER2_type" FT repeat_region 7912655..7912910 FT /rpt_family="MIR" FT repeat_region 7913375..7913558 FT /rpt_family="L2" FT repeat_region 7913566..7914028 FT /rpt_family="L2" FT repeat_region 7914062..7914165 FT /rpt_family="L1" FT repeat_region 7914166..7914310 FT /rpt_family="Alu" FT repeat_region 7914311..7914348 FT /rpt_family="Alu" FT repeat_region 7914355..7914379 FT /rpt_family="AT_rich" FT repeat_region 7914380..7914568 FT /rpt_family="L1" FT repeat_region 7914573..7914704 FT /rpt_family="Alu" FT repeat_region 7914779..7915353 FT /rpt_family="L1" FT repeat_region 7915354..7915412 FT /rpt_family="L2" FT repeat_region 7915432..7915703 FT /rpt_family="Alu" FT repeat_region 7915719..7916055 FT /rpt_family="L2" FT repeat_region 7916097..7916189 FT /rpt_family="L1" FT repeat_region 7916357..7916451 FT /rpt_family="L2" FT repeat_region 7918784..7918840 FT /rpt_family="AT_rich" FT repeat_region 7919147..7919181 FT /rpt_family="AT_rich" FT repeat_region 7919186..7919259 FT /rpt_family="MIR" FT repeat_region 7919329..7919546 FT /rpt_family="MIR" FT repeat_region 7919900..7920191 FT /rpt_family="Alu" FT repeat_region 7921083..7921664 FT /rpt_family="L1" FT repeat_region 7921675..7921753 FT /rpt_family="MaLR" FT repeat_region 7921759..7921889 FT /rpt_family="L1" FT repeat_region 7922393..7922589 FT /rpt_family="Alu" FT repeat_region 7922593..7922769 FT /rpt_family="(GAA)n" FT repeat_region 7923012..7923031 FT /rpt_family="(TAAA)n" FT repeat_region 7924385..7924434 FT /rpt_family="L2" FT repeat_region 7925016..7925212 FT /rpt_family="L2" FT repeat_region 7925213..7925520 FT /rpt_family="Alu" FT repeat_region 7925521..7925841 FT /rpt_family="L2" FT repeat_region 7926113..7926423 FT /rpt_family="L2" FT repeat_region 7926595..7926909 FT /rpt_family="L2" FT repeat_region 7927245..7927534 FT /rpt_family="Alu" FT repeat_region 7927576..7927891 FT /rpt_family="Alu" FT repeat_region 7928487..7928559 FT /rpt_family="(GGA)n" FT repeat_region 7928700..7929000 FT /rpt_family="Alu" FT misc_feature 7928758..7928997 FT /note="CpG_island (%GC=60.8, o/e=0.83, #CpGs=19)" FT repeat_region 7930916..7930996 FT /rpt_family="MIR" FT repeat_region 7931001..7931460 FT /rpt_family="L1" FT repeat_region 7931729..7931847 FT /rpt_family="MER1_type" FT repeat_region 7932028..7932318 FT /rpt_family="Alu" FT repeat_region 7935653..7935774 FT /rpt_family="Alu" FT repeat_region 7935775..7935809 FT /rpt_family="(CA)n" FT repeat_region 7935810..7935982 FT /rpt_family="Alu" FT repeat_region 7935983..7936281 FT /rpt_family="Alu" FT repeat_region 7937368..7937516 FT /rpt_family="L1" FT repeat_region 7938129..7938158 FT /rpt_family="AT_rich" FT repeat_region 7938343..7938464 FT /rpt_family="MIR" FT repeat_region 7938915..7939069 FT /rpt_family="L1" FT repeat_region 7939220..7939540 FT /rpt_family="L1" FT repeat_region 7939588..7939747 FT /rpt_family="L1" FT repeat_region 7939811..7940177 FT /rpt_family="MaLR" FT repeat_region 7940216..7940521 FT /rpt_family="Alu" FT repeat_region 7940525..7941107 FT /rpt_family="L1" FT repeat_region 7941108..7941402 FT /rpt_family="Alu" FT repeat_region 7941403..7942088 FT /rpt_family="L1" FT repeat_region 7942137..7942284 FT /rpt_family="L1" FT repeat_region 7942428..7942498 FT /rpt_family="AcHobo" FT repeat_region 7942483..7942589 FT /rpt_family="AcHobo" FT repeat_region 7942593..7943005 FT /rpt_family="L2" FT repeat_region 7943068..7943365 FT /rpt_family="Alu" FT repeat_region 7943692..7943800 FT /rpt_family="ERV1" FT repeat_region 7943900..7944460 FT /rpt_family="L1" FT repeat_region 7944461..7944798 FT /rpt_family="MER2_type" FT repeat_region 7944799..7945128 FT /rpt_family="L1" FT repeat_region 7945127..7945400 FT /rpt_family="L1" FT repeat_region 7945466..7945501 FT /rpt_family="AT_rich" FT repeat_region 7945572..7946144 FT /rpt_family="L1" FT repeat_region 7946147..7946250 FT /rpt_family="U6" FT ncRNA 7946147..7946240 FT /product="snRNA-U6-related" FT /ncRNA_class="snRNA" FT repeat_region 7946589..7946766 FT /rpt_family="MER1_type" FT repeat_region 7946767..7946933 FT /rpt_family="L1" FT repeat_region 7947029..7947177 FT /rpt_family="L1" FT repeat_region 7947178..7947533 FT /rpt_family="MaLR" FT repeat_region 7947833..7947944 FT /rpt_family="Alu" FT repeat_region 7948066..7948093 FT /rpt_family="AT_rich" FT repeat_region 7948272..7948706 FT /rpt_family="ERVL" FT repeat_region 7950089..7950128 FT /rpt_family="ERVL" FT repeat_region 7950130..7950393 FT /rpt_family="L1" FT repeat_region 7950497..7950581 FT /rpt_family="L1" FT repeat_region 7950841..7951177 FT /rpt_family="MaLR" FT repeat_region 7951520..7951814 FT /rpt_family="Alu" FT repeat_region 7952224..7952411 FT /rpt_family="MER1_type" FT repeat_region 7953096..7953341 FT /rpt_family="MER1_type" FT repeat_region 7954594..7954755 FT /rpt_family="L2" FT repeat_region 7954763..7954875 FT /rpt_family="L2" FT repeat_region 7954877..7954935 FT /rpt_family="(TA)n" FT repeat_region 7954936..7954958 FT /rpt_family="(TTTG)n" FT repeat_region 7954961..7955242 FT /rpt_family="Alu" FT repeat_region 7955258..7955473 FT /rpt_family="MIR" FT repeat_region 7955634..7955775 FT /rpt_family="L2" FT repeat_region 7955778..7956073 FT /rpt_family="Alu" FT repeat_region 7956074..7956586 FT /rpt_family="L2" FT repeat_region 7956900..7957199 FT /rpt_family="Alu" FT repeat_region 7957261..7957508 FT /rpt_family="L2" FT repeat_region 7958586..7958650 FT /rpt_family="MIR" FT repeat_region 7958873..7958927 FT /rpt_family="(CA)n" FT repeat_region 7960492..7960514 FT /rpt_family="AT_rich" FT repeat_region 7962893..7962916 FT /rpt_family="(T)n" FT repeat_region 7963749..7964138 FT /rpt_family="L2" FT repeat_region 7964752..7965029 FT /rpt_family="Alu" FT repeat_region 7965418..7965792 FT /rpt_family="MaLR" FT repeat_region 7966793..7966813 FT /rpt_family="AT_rich" FT repeat_region 7967190..7967594 FT /rpt_family="L2" FT repeat_region 7967615..7968023 FT /rpt_family="L2" FT repeat_region 7968024..7968442 FT /rpt_family="MaLR" FT repeat_region 7968443..7968476 FT /rpt_family="L2" FT repeat_region 7968924..7969457 FT /rpt_family="L2" FT repeat_region 7969572..7969747 FT /rpt_family="MER1_type" FT repeat_region 7969988..7970076 FT /rpt_family="L2" FT repeat_region 7970597..7970915 FT /rpt_family="Alu" FT repeat_region 7972158..7972293 FT /rpt_family="MIR" FT repeat_region 7972357..7972722 FT /rpt_family="MaLR" FT repeat_region 7973038..7973302 FT /rpt_family="L1" FT repeat_region 7973387..7973539 FT /rpt_family="MIR" FT repeat_region 7973538..7973613 FT /rpt_family="L2" FT repeat_region 7973620..7974471 FT /rpt_family="L1" FT repeat_region 7974620..7975175 FT /rpt_family="L2" FT repeat_region 7975176..7975472 FT /rpt_family="Alu" FT repeat_region 7975473..7975710 FT /rpt_family="L2" FT repeat_region 7975711..7976349 FT /rpt_family="L1" FT repeat_region 7976458..7976858 FT /rpt_family="L1" FT repeat_region 7976871..7976894 FT /rpt_family="(TTTTG)n" FT repeat_region 7977016..7978066 FT /rpt_family="L1" FT repeat_region 7978067..7978518 FT /rpt_family="ERVL" FT repeat_region 7978519..7978572 FT /rpt_family="L1" FT repeat_region 7978676..7978724 FT /rpt_family="AT_rich" FT repeat_region 7978754..7978987 FT /rpt_family="L1" FT repeat_region 7979014..7979155 FT /rpt_family="Alu" FT repeat_region 7979425..7979462 FT /rpt_family="(TG)n" FT repeat_region 7979495..7979587 FT /rpt_family="L1" FT repeat_region 7979990..7980262 FT /rpt_family="L2" FT repeat_region 7980272..7980771 FT /rpt_family="ERVL" FT repeat_region 7980778..7980884 FT /rpt_family="L2" FT repeat_region 7980975..7981191 FT /rpt_family="L1" FT repeat_region 7981228..7981430 FT /rpt_family="L2" FT repeat_region 7981251..7981500 FT /rpt_family="L2" FT repeat_region 7981581..7981995 FT /rpt_family="L2" FT repeat_region 7982008..7982035 FT /rpt_family="(CA)n" FT repeat_region 7982534..7982748 FT /rpt_family="Alu" FT repeat_region 7983129..7983198 FT /rpt_family="L1" FT repeat_region 7983214..7983326 FT /rpt_family="L1" FT repeat_region 7986569..7986701 FT /rpt_family="MIR" FT repeat_region 7987520..7987681 FT /rpt_family="L1" FT repeat_region 7988857..7988979 FT /rpt_family="Tc2" FT repeat_region 7988980..7989291 FT /rpt_family="Alu" FT repeat_region 7989292..7989348 FT /rpt_family="Tc2" FT repeat_region 7989842..7989918 FT /rpt_family="MIR" FT repeat_region 7990600..7990836 FT /rpt_family="MaLR" FT repeat_region 7990837..7991129 FT /rpt_family="Alu" FT repeat_region 7991130..7991310 FT /rpt_family="MaLR" FT repeat_region 7991913..7992214 FT /rpt_family="Alu" FT repeat_region 7992231..7992270 FT /rpt_family="(TG)n" FT repeat_region 7992419..7992446 FT /rpt_family="AT_rich" FT repeat_region 7992820..7992946 FT /rpt_family="MIR" FT repeat_region 7993067..7993365 FT /rpt_family="Alu" FT repeat_region 7993556..7993909 FT /rpt_family="L1" FT repeat_region 7994039..7994174 FT /rpt_family="CR1" FT repeat_region 7994741..7994840 FT /rpt_family="(TTTC)n" FT repeat_region 7994844..7995135 FT /rpt_family="Alu" FT repeat_region 7995990..7996165 FT /rpt_family="MIR" FT repeat_region 7997771..7997919 FT /rpt_family="MER1_type" FT repeat_region 7998052..7998437 FT /rpt_family="MaLR" FT repeat_region 7998472..7998513 FT /rpt_family="MaLR" FT repeat_region 7998960..7999242 FT /rpt_family="Alu" FT repeat_region 7999276..7999546 FT /rpt_family="L2" FT repeat_region 7999720..8000207 FT /rpt_family="L2" FT repeat_region 8000208..8000494 FT /rpt_family="Alu" FT repeat_region 8000495..8001784 FT /rpt_family="L2" FT repeat_region 8002320..8002366 FT /rpt_family="(TTTTG)n" FT repeat_region 8002419..8002999 FT /rpt_family="L2" FT repeat_region 8004246..8004380 FT /rpt_family="Alu" FT repeat_region 8004649..8005001 FT /rpt_family="L2" FT repeat_region 8006362..8006657 FT /rpt_family="Alu" FT repeat_region 8006988..8007222 FT /rpt_family="MIR" FT misc_feature 8008098..8009495 FT /note="CpG_island (%GC=73.1, o/e=0.85, #CpGs=164)" FT repeat_region 8008458..8008478 FT /rpt_family="(CGG)n" FT repeat_region 8008859..8008991 FT /rpt_family="L1" FT repeat_region 8008992..8009011 FT /rpt_family="(TCC)n" FT repeat_region 8009012..8009428 FT /rpt_family="L1" FT repeat_region 8009997..8010067 FT /rpt_family="CT-rich" FT repeat_region 8011950..8011974 FT /rpt_family="(TG)n" FT repeat_region 8012380..8012410 FT /rpt_family="AT_rich" FT repeat_region 8013038..8013072 FT /rpt_family="(TG)n" FT repeat_region 8013157..8013235 FT /rpt_family="MER1_type" FT repeat_region 8013631..8013651 FT /rpt_family="AT_rich" FT repeat_region 8015828..8016140 FT /rpt_family="Alu" FT repeat_region 8016141..8016184 FT /rpt_family="GA-rich" FT repeat_region 8016262..8016567 FT /rpt_family="Alu" FT repeat_region 8017170..8017280 FT /rpt_family="MIR" FT repeat_region 8017417..8017496 FT /rpt_family="MIR" FT repeat_region 8019556..8019825 FT /rpt_family="Alu" FT repeat_region 8020870..8021235 FT /rpt_family="Alu" FT repeat_region 8022145..8022271 FT /rpt_family="L1" FT repeat_region 8022315..8022509 FT /rpt_family="L1" FT repeat_region 8022516..8022582 FT /rpt_family="L1" FT repeat_region 8022916..8022965 FT /rpt_family="AT_rich" FT repeat_region 8023693..8023975 FT /rpt_family="Alu" FT repeat_region 8024867..8024919 FT /rpt_family="GA-rich" FT repeat_region 8025098..8025181 FT /rpt_family="L1" FT repeat_region 8025862..8026176 FT /rpt_family="Alu" FT repeat_region 8027060..8027112 FT /rpt_family="L2" FT repeat_region 8027239..8027509 FT /rpt_family="Alu" FT repeat_region 8027910..8027938 FT /rpt_family="(TTTTG)n" FT repeat_region 8028174..8028369 FT /rpt_family="Mariner" FT repeat_region 8028419..8028715 FT /rpt_family="MaLR" FT repeat_region 8028780..8028815 FT /rpt_family="AT_rich" FT repeat_region 8031672..8031759 FT /rpt_family="(TTTC)n" FT repeat_region 8031993..8032569 FT /rpt_family="L1" FT repeat_region 8033386..8033466 FT /rpt_family="MER2_type" FT repeat_region 8033474..8033516 FT /rpt_family="MER2_type" FT repeat_region 8033517..8033594 FT /rpt_family="MER2_type" FT repeat_region 8033564..8033617 FT /rpt_family="MER2_type" FT repeat_region 8033684..8033899 FT /rpt_family="Alu" FT repeat_region 8033948..8033990 FT /rpt_family="AT_rich" FT repeat_region 8034038..8034322 FT /rpt_family="MaLR" FT repeat_region 8034501..8034528 FT /rpt_family="(CA)n" FT repeat_region 8034890..8035129 FT /rpt_family="Alu" FT repeat_region 8035130..8035544 FT /rpt_family="L1" FT repeat_region 8037277..8037608 FT /rpt_family="Alu" FT repeat_region 8037658..8037690 FT /rpt_family="AT_rich" FT repeat_region 8037799..8037822 FT /rpt_family="(T)n" FT repeat_region 8037833..8038140 FT /rpt_family="Alu" FT repeat_region 8038554..8038634 FT /rpt_family="AT_rich" FT repeat_region 8038819..8038855 FT /rpt_family="AT_rich" FT repeat_region 8038957..8039250 FT /rpt_family="Alu" FT repeat_region 8039254..8039554 FT /rpt_family="Alu" FT repeat_region 8040406..8041013 FT /rpt_family="L1" FT repeat_region 8041014..8041742 FT /rpt_family="L1" FT repeat_region 8042565..8042672 FT /rpt_family="MIR" FT repeat_region 8042865..8043090 FT /rpt_family="L2" FT repeat_region 8043197..8043282 FT /rpt_family="L2" FT repeat_region 8044873..8044920 FT /rpt_family="AT_rich" FT repeat_region 8045042..8045220 FT /rpt_family="MIR" FT repeat_region 8045415..8045727 FT /rpt_family="Alu" FT repeat_region 8045765..8046033 FT /rpt_family="L2" FT repeat_region 8046061..8046130 FT /rpt_family="MIR" FT repeat_region 8046190..8046782 FT /rpt_family="AcHobo" FT repeat_region 8046851..8046916 FT /rpt_family="MIR" FT repeat_region 8047481..8047543 FT /rpt_family="MIR" FT repeat_region 8047595..8047906 FT /rpt_family="L1" FT repeat_region 8047918..8048224 FT /rpt_family="Alu" FT repeat_region 8048227..8048332 FT /rpt_family="L1" FT repeat_region 8048347..8048560 FT /rpt_family="L1" FT repeat_region 8048598..8048694 FT /rpt_family="MIR" FT repeat_region 8049089..8049202 FT /rpt_family="MaLR" FT repeat_region 8049259..8049403 FT /rpt_family="MaLR" FT repeat_region 8050607..8050766 FT /rpt_family="Alu" FT repeat_region 8050796..8051438 FT /rpt_family="L1" FT repeat_region 8051439..8051744 FT /rpt_family="Alu" FT repeat_region 8051745..8052062 FT /rpt_family="L1" FT repeat_region 8052063..8052374 FT /rpt_family="Alu" FT repeat_region 8052375..8052741 FT /rpt_family="L1" FT repeat_region 8052753..8053161 FT /rpt_family="L1" FT repeat_region 8053237..8053398 FT /rpt_family="L1" FT repeat_region 8053622..8053926 FT /rpt_family="Alu" FT repeat_region 8054503..8054547 FT /rpt_family="AT_rich" FT repeat_region 8055820..8056116 FT /rpt_family="Alu" FT repeat_region 8056208..8056238 FT /rpt_family="(TGAA)n" FT repeat_region 8056350..8056433 FT /rpt_family="MIR" FT repeat_region 8057042..8057221 FT /rpt_family="MER1_type" FT repeat_region 8057853..8057881 FT /rpt_family="AT_rich" FT repeat_region 8058803..8058842 FT /rpt_family="MER1_type" FT repeat_region 8058843..8059009 FT /rpt_family="MER1_type" FT repeat_region 8059180..8059773 FT /rpt_family="MER2_type" FT repeat_region 8059778..8059804 FT /rpt_family="(TTTA)n" FT repeat_region 8059806..8059888 FT /rpt_family="MER2_type" FT repeat_region 8059880..8059986 FT /rpt_family="MER2_type" FT repeat_region 8061025..8061049 FT /rpt_family="AT_rich" FT repeat_region 8061050..8061332 FT /rpt_family="Alu" FT repeat_region 8061333..8061352 FT /rpt_family="AT_rich" FT repeat_region 8062073..8062111 FT /rpt_family="AT_rich" FT repeat_region 8062654..8062928 FT /rpt_family="Alu" FT repeat_region 8063129..8063218 FT /rpt_family="CR1" FT repeat_region 8063219..8063528 FT /rpt_family="Alu" FT repeat_region 8063529..8063847 FT /rpt_family="CR1" FT repeat_region 8064128..8064230 FT /rpt_family="L1" FT repeat_region 8064890..8064995 FT /rpt_family="Alu" FT repeat_region 8065003..8065209 FT /rpt_family="L1" FT repeat_region 8065202..8065690 FT /rpt_family="L1" FT repeat_region 8065730..8065985 FT /rpt_family="L1" FT repeat_region 8066000..8066423 FT /rpt_family="L1" FT repeat_region 8066444..8066850 FT /rpt_family="L1" FT repeat_region 8066851..8067134 FT /rpt_family="Alu" FT repeat_region 8071342..8074224 FT /rpt_family="L1" FT repeat_region 8074223..8074879 FT /rpt_family="L1" FT repeat_region 8074858..8075123 FT /rpt_family="L1" FT repeat_region 8075392..8077725 FT /rpt_family="L1" FT repeat_region 8077760..8079344 FT /rpt_family="L1" FT repeat_region 8079345..8079649 FT /rpt_family="Alu" FT repeat_region 8079650..8079722 FT /rpt_family="L1" FT repeat_region 8079735..8079838 FT /rpt_family="L1" FT repeat_region 8079839..8080128 FT /rpt_family="Alu" FT repeat_region 8080129..8080155 FT /rpt_family="L1" FT repeat_region 8080156..8080191 FT /rpt_family="(CA)n" FT repeat_region 8080192..8080439 FT /rpt_family="L1" FT repeat_region 8081227..8081521 FT /rpt_family="Alu" FT repeat_region 8082161..8082263 FT /rpt_family="Alu" FT repeat_region 8082972..8083084 FT /rpt_family="MER1_type" FT repeat_region 8083105..8083381 FT /rpt_family="L1" FT repeat_region 8083576..8083874 FT /rpt_family="Alu" FT repeat_region 8083989..8084299 FT /rpt_family="Alu" FT repeat_region 8084550..8085088 FT /rpt_family="MER2_type" FT repeat_region 8085452..8085892 FT /rpt_family="L1" FT repeat_region 8085893..8086489 FT /rpt_family="ERV1" FT repeat_region 8088276..8088573 FT /rpt_family="ERVL" FT repeat_region 8089458..8089526 FT /rpt_family="MIR" FT repeat_region 8090041..8090062 FT /rpt_family="AT_rich" FT repeat_region 8090368..8090611 FT /rpt_family="MIR" FT repeat_region 8091237..8091566 FT /rpt_family="L1" FT repeat_region 8091654..8091727 FT /rpt_family="MER1_type" FT repeat_region 8091757..8091917 FT /rpt_family="MER1_type" FT repeat_region 8092636..8092671 FT /rpt_family="(TTTA)n" FT repeat_region 8092919..8092943 FT /rpt_family="(TTTTG)n" FT repeat_region 8092946..8093254 FT /rpt_family="Alu" FT repeat_region 8093646..8093692 FT /rpt_family="AT_rich" FT repeat_region 8094536..8094568 FT /rpt_family="AT_rich" FT misc_feature 8095333..8095618 FT /note="CpG_island (%GC=61.5, o/e=0.77, #CpGs=23)" FT repeat_region 8095338..8095643 FT /rpt_family="Alu" FT repeat_region 8095646..8095929 FT /rpt_family="Alu" FT repeat_region 8096100..8096131 FT /rpt_family="MIR" FT repeat_region 8096181..8096418 FT /rpt_family="L1" FT repeat_region 8096645..8097305 FT /rpt_family="L1" FT repeat_region 8097499..8097719 FT /rpt_family="L1" FT repeat_region 8097800..8098089 FT /rpt_family="L1" FT repeat_region 8098363..8098801 FT /rpt_family="MER2_type" FT repeat_region 8099951..8100731 FT /rpt_family="L1" FT repeat_region 8100732..8101029 FT /rpt_family="Alu" FT repeat_region 8101030..8101099 FT /rpt_family="L1" FT repeat_region 8101101..8101186 FT /rpt_family="L1" FT repeat_region 8101214..8101234 FT /rpt_family="AT_rich" FT repeat_region 8101288..8101596 FT /rpt_family="Alu" FT repeat_region 8102758..8103075 FT /rpt_family="Alu" FT repeat_region 8103237..8103556 FT /rpt_family="Alu" FT repeat_region 8104329..8104646 FT /rpt_family="Alu" FT repeat_region 8107700..8107996 FT /rpt_family="Alu" FT repeat_region 8109504..8109526 FT /rpt_family="AT_rich" FT repeat_region 8109750..8109839 FT /rpt_family="MIR" FT repeat_region 8110203..8110266 FT /rpt_family="L2" FT repeat_region 8111623..8111908 FT /rpt_family="L1" FT repeat_region 8112740..8112805 FT /rpt_family="MIR" FT repeat_region 8113139..8113185 FT /rpt_family="MIR" FT repeat_region 8113217..8113342 FT /rpt_family="MIR" FT repeat_region 8113716..8113859 FT /rpt_family="L2" FT repeat_region 8114054..8114322 FT /rpt_family="Alu" FT repeat_region 8116317..8116470 FT /rpt_family="L2" FT repeat_region 8116994..8117077 FT /rpt_family="MIR" FT repeat_region 8117094..8117261 FT /rpt_family="MIR" FT repeat_region 8117286..8117370 FT /rpt_family="MIR" FT repeat_region 8117583..8117860 FT /rpt_family="Alu" FT repeat_region 8118334..8118547 FT /rpt_family="L2" FT repeat_region 8119391..8119412 FT /rpt_family="AT_rich" FT repeat_region 8120395..8120447 FT /rpt_family="MIR" FT repeat_region 8120474..8120603 FT /rpt_family="Alu" FT repeat_region 8120623..8120766 FT /rpt_family="MIR" FT repeat_region 8120774..8120963 FT /rpt_family="MER1_type" FT repeat_region 8121126..8121178 FT /rpt_family="Alu" FT repeat_region 8122213..8122247 FT /rpt_family="AT_rich" FT repeat_region 8122741..8122763 FT /rpt_family="AT_rich" FT repeat_region 8122764..8122873 FT /rpt_family="L1" FT repeat_region 8122997..8123025 FT /rpt_family="(TTTG)n" FT repeat_region 8127861..8127901 FT /rpt_family="(TG)n" FT repeat_region 8129089..8129118 FT /rpt_family="AT_rich" FT repeat_region 8129828..8130007 FT /rpt_family="L2" FT repeat_region 8130295..8130481 FT /rpt_family="MER1_type" FT repeat_region 8130550..8130574 FT /rpt_family="(TTTTG)n" FT repeat_region 8130578..8130854 FT /rpt_family="Alu" FT repeat_region 8130857..8131340 FT /rpt_family="MaLR" FT repeat_region 8132779..8132867 FT /rpt_family="L1" FT repeat_region 8132868..8133166 FT /rpt_family="Alu" FT repeat_region 8133167..8133289 FT /rpt_family="L1" FT repeat_region 8133432..8133568 FT /rpt_family="Alu" FT repeat_region 8134735..8134879 FT /rpt_family="MaLR" FT repeat_region 8134907..8134971 FT /rpt_family="MaLR" FT repeat_region 8134984..8135239 FT /rpt_family="L1" FT repeat_region 8135660..8135954 FT /rpt_family="Alu" FT repeat_region 8141924..8142202 FT /rpt_family="Alu" FT repeat_region 8142206..8142272 FT /rpt_family="ERVL" FT repeat_region 8142273..8142301 FT /rpt_family="(A)n" FT repeat_region 8142303..8142808 FT /rpt_family="L1" FT repeat_region 8142829..8142930 FT /rpt_family="MIR" FT repeat_region 8144323..8144683 FT /rpt_family="MaLR" FT repeat_region 8145914..8146253 FT /rpt_family="MaLR" FT repeat_region 8146456..8146473 FT /rpt_family="L1" FT repeat_region 8146474..8146733 FT /rpt_family="L1" FT repeat_region 8146737..8147047 FT /rpt_family="Alu" FT repeat_region 8147056..8147594 FT /rpt_family="L1" FT repeat_region 8147584..8147905 FT /rpt_family="L1" FT repeat_region 8148208..8148512 FT /rpt_family="Alu" FT repeat_region 8148543..8148813 FT /rpt_family="L1" FT repeat_region 8148860..8149044 FT /rpt_family="MIR" FT repeat_region 8149612..8149726 FT /rpt_family="MaLR" FT repeat_region 8149772..8149885 FT /rpt_family="MaLR" FT repeat_region 8149885..8150024 FT /rpt_family="ERV1" FT repeat_region 8150025..8150325 FT /rpt_family="Alu" FT repeat_region 8150326..8150448 FT /rpt_family="ERV1" FT repeat_region 8152303..8152325 FT /rpt_family="(TG)n" FT repeat_region 8152838..8152860 FT /rpt_family="AT_rich" FT gene complement(8152939..8153674) FT /gene="ICA1" FT mRNA complement(8152939..8153674) FT /gene="ICA1" FT mRNA complement(8153402..8153674) FT /gene="ICA1" FT mRNA complement(8153403..8153674) FT /gene="ICA1" FT mRNA complement(8153411..8153674) FT /gene="ICA1" FT CDS complement(8153553..>8153674) FT /codon_start=3 FT /gene="ICA1" FT /product="unknown" FT /note="Homo sapiens islet cell autoantigen 1, 69kDa (ICA1), FT transcript variant 1, mRNA.; H_NH0505D17.3 This gene was FT based on gi(12545394 14250410) Continues from FT H_NH0560C01.1.2" FT /protein_id="AAD50515.1" FT /translation="PAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA" FT repeat_region 8156544..8156923 FT /rpt_family="MaLR" FT repeat_region 8157553..8157684 FT /rpt_family="L2" FT repeat_region 8158001..8158139 FT /rpt_family="L1" FT repeat_region 8158465..8158640 FT /rpt_family="MER1_type" FT repeat_region 8159194..8159491 FT /rpt_family="Alu" FT repeat_region 8159395..8159491 FT /rpt_family="Alu" FT misc_feature 8159427..8159625 FT /note="match to EST AI143508 (NID:g3665317) qa51g02.s1" FT repeat_region 8160901..8160930 FT /rpt_family="(CAGC)n" FT repeat_region 8160940..8161054 FT /rpt_family="L2" FT repeat_region 8161055..8161538 FT /rpt_family="L1" FT repeat_region 8161539..8161838 FT /rpt_family="L2" FT repeat_region 8163462..8163703 FT /rpt_family="MIR" FT repeat_region 8163742..8164048 FT /rpt_family="Alu" FT misc_feature 8163761..8164221 FT /note="similar to EST N25042 (NID:g1139192) yw40b05.s1" FT repeat_region 8164418..8164716 FT /rpt_family="Alu" FT repeat_region 8164775..8165386 FT /rpt_family="L2" FT repeat_region 8166608..8166921 FT /rpt_family="Alu" FT misc_feature 8166608..8166622 FT /note="match to EST AA491302 (NID:g2220475) aa53d10.s1" FT misc_feature 8167503..8167784 FT /note="match to EST AA482169 (NID:g2209847) aa53d10.r1" FT misc_feature 8167503..8167775 FT /note="match to EST AI742795 (NID:g5111083) wg46c11.x1" FT /note="match to EST T28118 (NID:g610216)" FT /note="match to EST AW005764 (NID:g5854542) wz89c09.x1" FT /note="match to EST AA878231 (NID:g2987196) oe61c10.s1" FT /note="match to EST W81146 (NID:g1391360) zd81c12.r1" FT misc_feature 8167503..8167772 FT /note="match to EST AI720028 (NID:g5037284) as55d07.x1" FT misc_feature 8167503..8167767 FT /note="match to EST AI033931 (NID:g3254884) ow16h04.x1" FT misc_feature 8167503..8167728 FT /note="match to EST AA491302 (NID:g2220475) aa53d10.s1" FT misc_feature 8167503..8167572 FT /note="match to EST AA329686 (NID:g1981928)" FT misc_feature 8167579..8167772 FT /note="similar to Mus musculus EST AA939933 (NID:g3099477) FT vq64d04.s1" FT misc_feature 8167597..8167775 FT /note="match to EST AA329686 (NID:g1981928)" FT misc_feature 8167609..8167772 FT /note="match to EST H15227 (NID:g880047) ym30g02.r1" FT misc_feature 8167845..8168336 FT /note="match to EST AA516541 (NID:g2256065) nh52h11.r1" FT repeat_region 8168490..8168626 FT /rpt_family="MIR" FT repeat_region 8168998..8169018 FT /rpt_family="AT_rich" FT repeat_region 8169342..8169875 FT /rpt_family="L1" FT repeat_region 8170593..8171000 FT /rpt_family="MaLR" FT repeat_region 8172574..8172909 FT /rpt_family="MaLR" FT repeat_region 8172916..8173165 FT /rpt_family="Alu" FT repeat_region 8173166..8173232 FT /rpt_family="MaLR" FT repeat_region 8173247..8173299 FT /rpt_family="L2" FT repeat_region 8173477..8173496 FT /rpt_family="(T)n" FT misc_feature 8173494..8174064 FT /note="match to EST AA868298 (NID:g2963743) ak40d11.s1" FT repeat_region 8173533..8173635 FT /rpt_family="MIR" FT repeat_region 8174657..8174956 FT /rpt_family="Alu" FT repeat_region 8178039..8178205 FT /rpt_family="MIR" FT misc_feature 8178470..8178511 FT /note="match to EST AI720028 (NID:g5037284) as55d07.x1" FT /note="match to EST H15227 (NID:g880047) ym30g02.r1" FT misc_feature 8178473..8178511 FT /note="match to EST AA329686 (NID:g1981928)" FT /note="match to EST AW005764 (NID:g5854542) wz89c09.x1" FT /note="match to EST W81146 (NID:g1391360) zd81c12.r1" FT /note="similar to Mus musculus EST AA939933 (NID:g3099477) FT vq64d04.s1" FT /note="match to EST AA878231 (NID:g2987196) oe61c10.s1" FT misc_feature 8178473..8178500 FT /note="match to EST T28118 (NID:g610216)" FT /note="match to EST AI742795 (NID:g5111083) wg46c11.x1" FT misc_feature 8178615..8178711 FT /note="similar to Mus musculus EST AA939933 (NID:g3099477) FT vq64d04.s1" FT misc_feature 8178615..8178687 FT /note="match to EST W81146 (NID:g1391360) zd81c12.r1" FT misc_feature 8178615..8178683 FT /note="match to EST AA878231 (NID:g2987196) oe61c10.s1" FT /note="match to EST AW005764 (NID:g5854542) wz89c09.x1" FT misc_feature 8178615..8178677 FT /note="match to EST AI720028 (NID:g5037284) as55d07.x1" FT /note="match to EST H15227 (NID:g880047) ym30g02.r1" FT misc_feature 8178615..8178667 FT /note="match to EST AA329686 (NID:g1981928)" FT repeat_region 8179017..8179474 FT /rpt_family="L1" FT repeat_region 8179906..8180323 FT /rpt_family="L2" FT misc_feature 8181395..8181447 FT /note="match to EST AI720028 (NID:g5037284) as55d07.x1" FT /note="match to EST H15227 (NID:g880047) ym30g02.r1" FT repeat_region 8182256..8182418 FT /rpt_family="MIR" FT misc_feature 8183494..8183602 FT /note="similar to Mus musculus EST AA939933 (NID:g3099477) FT vq64d04.s1" FT misc_feature 8183503..8183602 FT /note="similar to Mus musculus EST AA647830 (NID:g2574259) FT vq80b11.s1" FT misc_feature 8183505..8183542 FT /note="match to EST AI720028 (NID:g5037284) as55d07.x1" FT misc_feature 8183505..8183534 FT /note="match to EST H15227 (NID:g880047) ym30g02.r1" FT repeat_region 8183621..8183676 FT /rpt_family="A-rich" FT repeat_region 8184553..8184687 FT /rpt_family="MER1_type" FT repeat_region 8184910..8185142 FT /rpt_family="L2" FT repeat_region 8185379..8185413 FT /rpt_family="(TA)n" FT repeat_region 8185703..8186083 FT /rpt_family="L2" FT repeat_region 8186349..8186394 FT /rpt_family="(TG)n" FT repeat_region 8186488..8186537 FT /rpt_family="(CA)n" FT repeat_region 8187030..8187053 FT /rpt_family="AT_rich" FT repeat_region 8187318..8187360 FT /rpt_family="(CA)n" FT repeat_region 8187361..8187430 FT /rpt_family="L1" FT repeat_region 8187431..8188273 FT /rpt_family="MER2_type" FT repeat_region 8188274..8188351 FT /rpt_family="L1" FT repeat_region 8189850..8189965 FT /rpt_family="MIR" FT repeat_region 8190017..8190200 FT /rpt_family="MIR" FT repeat_region 8190577..8190678 FT /rpt_family="MIR" FT repeat_region 8192087..8192620 FT /rpt_family="(CCA)n" FT repeat_region 8192662..8192747 FT /rpt_family="(CCA)n" FT repeat_region 8192749..8192814 FT /rpt_family="MIR" FT repeat_region 8193430..8193453 FT /rpt_family="AT_rich" FT repeat_region 8193467..8193491 FT /rpt_family="(TA)n" FT repeat_region 8193619..8193644 FT /rpt_family="AT_rich" FT repeat_region 8193682..8193705 FT /rpt_family="AT_rich" FT misc_feature 8193962..8194448 FT /note="similar to Mus musculus EST AA763339 (NID:g2813086) FT vw53b10.r1" FT repeat_region 8194306..8194327 FT /rpt_family="AT_rich" FT repeat_region 8194571..8194648 FT /rpt_family="Mariner" FT repeat_region 8196560..8196606 FT /rpt_family="(A)n" FT misc_feature 8196746..8196844 FT /note="match to EST AI654123 (NID:g4738102) ty62a05.x1" FT /note="similar to Mus musculus EST AA647830 (NID:g2574259) FT vq80b11.s1" FT misc_feature 8196746..8196805 FT /note="similar to Mus musculus EST AA939933 (NID:g3099477) FT vq64d04.s1" FT misc_feature 8196781..8196844 FT /note="similar to Bos taurus EST AW487395 (NID:g7057501)" FT repeat_region 8197326..8197619 FT /rpt_family="Alu" FT misc_feature 8197534..8197936 FT /note="match to EST R80469 (NID:g856750) yi93f08.r1" FT repeat_region 8197716..8197955 FT /rpt_family="L2" FT misc_feature 8198050..8198290 FT /note="similar to EST AW373851 (NID:g6878518)" FT misc_feature 8198157..8198282 FT /note="similar to Bos taurus EST AW487395 (NID:g7057501)" FT /note="similar to Mus musculus EST AA647830 (NID:g2574259) FT vq80b11.s1" FT /note="match to EST AI654123 (NID:g4738102) ty62a05.x1" FT misc_feature 8198190..8198282 FT /note="similar to Mus musculus EST AA042025 (NID:g1520197) FT mj08g01.r1" FT /note="similar to Mus musculus EST AI323025 (NID:g4057454) FT mj22c04.y1" FT misc_feature 8198191..8198282 FT /note="similar to Mus musculus EST AA042021 (NID:g1520193) FT mj08f01.r1" FT repeat_region 8198646..8198830 FT /rpt_family="L1" FT repeat_region 8199060..8199347 FT /rpt_family="Alu" FT repeat_region 8199463..8199534 FT /rpt_family="L1" FT repeat_region 8199640..8199737 FT /rpt_family="L2" FT repeat_region 8199820..8199868 FT /rpt_family="AT_rich" FT repeat_region 8200727..8200811 FT /rpt_family="L2" FT repeat_region 8201055..8201550 FT /rpt_family="MaLR" FT repeat_region 8202400..8202693 FT /rpt_family="Alu" FT repeat_region 8203064..8203109 FT /rpt_family="L2" FT repeat_region 8203246..8203655 FT /rpt_family="L2" FT repeat_region 8203656..8203962 FT /rpt_family="Alu" FT repeat_region 8203963..8204107 FT /rpt_family="L2" FT repeat_region 8204426..8204727 FT /rpt_family="Alu" FT repeat_region 8205070..8207269 FT /rpt_family="L1" FT repeat_region 8207376..8207529 FT /rpt_family="MaLR" FT repeat_region 8207637..8207695 FT /rpt_family="(GA)n" FT repeat_region 8207857..8207935 FT /rpt_family="MER103" FT repeat_region 8208003..8208038 FT /rpt_family="MIR" FT repeat_region 8208463..8208494 FT /rpt_family="(CAT)n" FT repeat_region 8208497..8210539 FT /rpt_family="L1" FT repeat_region 8210543..8210663 FT /rpt_family="L1" FT repeat_region 8210668..8212144 FT /rpt_family="L1" FT repeat_region 8212701..8213095 FT /rpt_family="L1" FT repeat_region 8213092..8213273 FT /rpt_family="L1" FT repeat_region 8213465..8213813 FT /rpt_family="L2" FT repeat_region 8214143..8214405 FT /rpt_family="Alu" FT repeat_region 8215664..8215744 FT /rpt_family="MIR" FT repeat_region 8215823..8216048 FT /rpt_family="L2" FT repeat_region 8216421..8216555 FT /rpt_family="MIR" FT repeat_region 8217179..8217209 FT /rpt_family="AT_rich" FT repeat_region 8217579..8217744 FT /rpt_family="L2" FT repeat_region 8218205..8218226 FT /rpt_family="AT_rich" FT misc_feature 8218219..8218600 FT /note="match to EST AA677614 (NID:g2658136) zj70f06.s1" FT repeat_region 8218568..8218919 FT /rpt_family="MaLR" FT repeat_region 8219664..8221341 FT /rpt_family="L1" FT repeat_region 8221646..8222075 FT /rpt_family="L2" FT repeat_region 8222242..8222283 FT /rpt_family="AT_rich" FT repeat_region 8223173..8223300 FT /rpt_family="MIR" FT repeat_region 8224423..8224729 FT /rpt_family="Alu" FT repeat_region 8224960..8225052 FT /rpt_family="(TCCA)n" FT repeat_region 8225080..8225250 FT /rpt_family="MER1_type" FT repeat_region 8225264..8225518 FT /rpt_family="MIR" FT repeat_region 8225503..8225801 FT /rpt_family="L2" FT repeat_region 8225855..8225980 FT /rpt_family="MER94" FT repeat_region 8226600..8226688 FT /rpt_family="MIR" FT repeat_region 8226702..8227471 FT /rpt_family="MER2_type" FT repeat_region 8227463..8227548 FT /rpt_family="MER2_type" FT repeat_region 8227549..8227683 FT /rpt_family="MIR" FT repeat_region 8228763..8228891 FT /rpt_family="L2" FT repeat_region 8228961..8229054 FT /rpt_family="MIR" FT misc_feature 8230545..8230775 FT /note="match to EST AA324563 (NID:g1976829)" FT repeat_region 8230952..8231302 FT /rpt_family="MER2_type" FT STS complement(8231153..8231533) FT repeat_region 8231303..8231384 FT /rpt_family="(TTATA)n" FT repeat_region 8231337..8231385 FT /rpt_family="(TATAA)n" FT repeat_region 8231505..8232888 FT /rpt_family="L1" FT repeat_region 8232889..8232922 FT /rpt_family="(TATG)n" FT repeat_region 8232923..8233141 FT /rpt_family="L1" FT repeat_region 8233866..8233904 FT /rpt_family="MER1_type" FT repeat_region 8234578..8234880 FT /rpt_family="L1" FT repeat_region 8234881..8235200 FT /rpt_family="Alu" FT repeat_region 8235201..8235327 FT /rpt_family="L1" FT repeat_region 8235328..8235607 FT /rpt_family="Alu" FT repeat_region 8235608..8235662 FT /rpt_family="(CAA)n" FT repeat_region 8235667..8236339 FT /rpt_family="L1" FT repeat_region 8236366..8236692 FT /rpt_family="MaLR" FT repeat_region 8236701..8236723 FT /rpt_family="AT_rich" FT repeat_region 8236903..8237202 FT /rpt_family="Alu" FT repeat_region 8237205..8237246 FT /rpt_family="(TAA)n" FT repeat_region 8237960..8238402 FT /rpt_family="L2" FT repeat_region 8238407..8239058 FT /rpt_family="L1" FT repeat_region 8239059..8239367 FT /rpt_family="Alu" FT repeat_region 8239368..8239842 FT /rpt_family="L1" FT repeat_region 8239969..8239993 FT /rpt_family="(A)n" FT repeat_region 8241906..8242083 FT /rpt_family="MIR" FT misc_feature 8242425..8242431 FT /note="match to EST AI720028 (NID:g5037284) as55d07.x1" FT repeat_region 8243113..8243278 FT /rpt_family="MER1_type" FT repeat_region 8243920..8244093 FT /rpt_family="MIR" FT repeat_region 8246364..8246394 FT /rpt_family="(A)n" FT repeat_region 8248040..8248061 FT /rpt_family="(TAAAAA)n" FT repeat_region 8249252..8249299 FT /rpt_family="L2" FT repeat_region 8249335..8249732 FT /rpt_family="L2" FT repeat_region 8250340..8250500 FT /rpt_family="Alu" FT repeat_region 8251214..8251344 FT /rpt_family="L1" FT repeat_region 8251399..8251621 FT /rpt_family="MER1_type" FT repeat_region 8251913..8252226 FT /rpt_family="Alu" FT repeat_region 8254821..8255267 FT /rpt_family="L2" FT repeat_region 8256276..8256324 FT /rpt_family="L2" FT repeat_region 8256408..8256554 FT /rpt_family="MIR" FT misc_feature 8257935..8258135 FT /note="similar to Bos taurus EST AW487395 (NID:g7057501)" FT misc_feature 8257935..8258133 FT /note="similar to Mus musculus EST AA042025 (NID:g1520197) FT mj08g01.r1" FT /note="similar to Mus musculus EST AI323025 (NID:g4057454) FT mj22c04.y1" FT /note="similar to Mus musculus EST AA042021 (NID:g1520193) FT mj08f01.r1" FT /note="match to EST AI654123 (NID:g4738102) ty62a05.x1" FT misc_feature 8257935..8257981 FT /note="similar to Mus musculus EST AA647830 (NID:g2574259) FT vq80b11.s1" FT misc_feature 8257945..8258102 FT /note="similar to EST AW373851 (NID:g6878518)" FT misc_feature 8257950..8258133 FT /note="match to EST AL120828 (NID:g5926829)" FT misc_feature 8258008..8258133 FT /note="similar to Mus musculus EST AI385559 (NID:g4199022) FT mj22c04.x1" FT misc_feature 8258071..8258133 FT /note="match to EST AI003209 (NID:g3203623) an12c06.s1" FT repeat_region 8258220..8258273 FT /rpt_family="L2" FT misc_feature 8258234..8258580 FT /note="match to EST AI003209 (NID:g3203623) an12c06.s1" FT misc_feature 8259159..8259160 FT /note="match to EST AI003209 (NID:g3203623) an12c06.s1" FT repeat_region 8260323..8260444 FT /rpt_family="MER1_type" FT repeat_region 8260684..8260707 FT /rpt_family="AT_rich" FT misc_feature 8260905..8261028 FT /note="similar to Mus musculus EST AI385559 (NID:g4199022) FT mj22c04.x1" FT /note="match to EST AL120828 (NID:g5926829)" FT /note="similar to Mus musculus EST AA042025 (NID:g1520197) FT mj08g01.r1" FT /note="similar to Mus musculus EST AI323025 (NID:g4057454) FT mj22c04.y1" FT /note="similar to Mus musculus EST AA042021 (NID:g1520193) FT mj08f01.r1" FT /note="match to EST AI654123 (NID:g4738102) ty62a05.x1" FT misc_feature 8260930..8261028 FT /note="match to EST AW140078 (NID:g6144796)" FT misc_feature 8261175..8261483 FT /note="similar to Bos taurus EST AW352807 (NID:g6851797)" FT repeat_region 8261652..8261903 FT /rpt_family="L1" FT repeat_region 8262386..8262617 FT /rpt_family="L2" FT repeat_region 8263061..8263155 FT /rpt_family="MER1_type" FT repeat_region 8263275..8263422 FT /rpt_family="Alu" FT repeat_region 8263579..8263989 FT /rpt_family="L2" FT repeat_region 8264090..8264181 FT /rpt_family="L1" FT repeat_region 8264218..8265740 FT /rpt_family="L1" FT misc_feature 8265639..8266042 FT /note="match to EST AI394554 (NID:g4224101) tg08a07.x1" FT misc_feature 8265656..8266143 FT /note="match to EST AI380061 (NID:g4189914) tg19h09.x1" FT repeat_region 8266820..8267081 FT /rpt_family="L2" FT repeat_region 8267236..8267515 FT /rpt_family="Alu" FT repeat_region 8267640..8267667 FT /rpt_family="AT_rich" FT misc_feature 8268231..8268305 FT /note="similar to Mus musculus EST AA042021 (NID:g1520193) FT mj08f01.r1" FT misc_feature 8268231..8268303 FT /note="match to EST AW140078 (NID:g6144796)" FT /note="similar to Mus musculus EST AI385559 (NID:g4199022) FT mj22c04.x1" FT /note="match to EST AL120828 (NID:g5926829)" FT /note="similar to Mus musculus EST AA042025 (NID:g1520197) FT mj08g01.r1" FT /note="similar to Mus musculus EST AI323025 (NID:g4057454) FT mj22c04.y1" FT /note="match to EST AI654123 (NID:g4738102) ty62a05.x1" FT misc_feature 8268253..8268303 FT /note="similar to Bos taurus EST AW357551 (NID:g6861557)" FT repeat_region 8269607..8269738 FT /rpt_family="L1" FT repeat_region 8270223..8270265 FT /rpt_family="AT_rich" FT repeat_region 8270519..8270960 FT /rpt_family="L2" FT repeat_region 8271129..8271303 FT /rpt_family="MIR" FT misc_feature 8272220..8272385 FT /note="match to EST AW140078 (NID:g6144796)" FT misc_feature 8272220..8272383 FT /note="similar to Mus musculus EST AI323025 (NID:g4057454) FT mj22c04.y1" FT misc_feature 8272220..8272382 FT /note="similar to Mus musculus EST AI385559 (NID:g4199022) FT mj22c04.x1" FT /note="similar to Bos taurus EST AW357551 (NID:g6861557)" FT misc_feature 8272220..8272368 FT /note="match to EST AI654123 (NID:g4738102) ty62a05.x1" FT misc_feature 8272220..8272354 FT /note="match to EST AL120828 (NID:g5926829)" FT misc_feature 8272220..8272312 FT /note="similar to Mus musculus EST AA042025 (NID:g1520197) FT mj08g01.r1" FT misc_feature 8272279..8272385 FT /note="match to EST AW206957 (NID:g6506453)" FT repeat_region 8272854..8273024 FT /rpt_family="L1" FT repeat_region 8273025..8273325 FT /rpt_family="Alu" FT repeat_region 8273326..8273413 FT /rpt_family="L1" FT repeat_region 8273571..8273877 FT /rpt_family="Alu" FT repeat_region 8274514..8274805 FT /rpt_family="Alu" FT misc_feature 8275540..8275635 FT /note="match to EST AW206957 (NID:g6506453)" FT /note="similar to Mus musculus EST AI385559 (NID:g4199022) FT mj22c04.x1" FT /note="similar to Bos taurus EST AW357551 (NID:g6861557)" FT misc_feature 8275540..8275570 FT /note="match to EST AW140078 (NID:g6144796)" FT repeat_region 8275851..8275935 FT /rpt_family="L1" FT repeat_region 8277096..8277445 FT /rpt_family="L1" FT repeat_region 8277446..8277483 FT /rpt_family="(CA)n" FT repeat_region 8277484..8277566 FT /rpt_family="L1" FT repeat_region 8277585..8277749 FT /rpt_family="MER2_type" FT repeat_region 8277750..8278274 FT /rpt_family="L1" FT repeat_region 8278431..8278614 FT /rpt_family="MER1_type" FT repeat_region 8279061..8285190 FT /rpt_family="L1" FT repeat_region 8285220..8285474 FT /rpt_family="MER1_type" FT repeat_region 8286377..8286675 FT /rpt_family="Alu" FT repeat_region 8286800..8287116 FT /rpt_family="Alu" FT STS complement(8287892..8288098) FT repeat_region 8288074..8288336 FT /rpt_family="Alu" FT repeat_region 8289960..8289982 FT /rpt_family="AT_rich" FT repeat_region 8290211..8290267 FT /rpt_family="Alu" FT repeat_region 8290539..8290817 FT /rpt_family="Alu" FT repeat_region 8291422..8291455 FT /rpt_family="AT_rich" FT STS complement(8291881..8292189) FT repeat_region 8292125..8292271 FT /rpt_family="MER1_type" FT repeat_region 8292310..8292381 FT /rpt_family="(TA)n" FT repeat_region 8292387..8292408 FT /rpt_family="AT_rich" FT repeat_region 8292423..8292510 FT /rpt_family="MER1_type" FT repeat_region 8292511..8292641 FT /rpt_family="Alu" FT repeat_region 8292642..8292736 FT /rpt_family="MER1_type" FT repeat_region 8293144..8293229 FT /rpt_family="MER2_type" FT repeat_region 8293235..8293295 FT /rpt_family="AT_rich" FT repeat_region 8293307..8293452 FT /rpt_family="MER2_type" FT repeat_region 8294928..8295400 FT /rpt_family="L2" FT repeat_region 8295401..8295704 FT /rpt_family="Alu" FT repeat_region 8295705..8296456 FT /rpt_family="L2" FT repeat_region 8296463..8296681 FT /rpt_family="MIR" FT repeat_region 8297447..8297498 FT /rpt_family="MIR" FT repeat_region 8297597..8297938 FT /rpt_family="L2" FT repeat_region 8298170..8298267 FT /rpt_family="MIR" FT repeat_region 8298731..8298779 FT /rpt_family="MER1_type" FT repeat_region 8298794..8298952 FT /rpt_family="MER1_type" FT repeat_region 8299190..8299389 FT /rpt_family="MIR" FT misc_feature 8301032..8302252 FT /note="CpG_island (%GC=71.5, o/e=0.90, #CpGs=126)" FT repeat_region 8301681..8301705 FT /rpt_family="GC_rich" FT misc_feature 8301724..8301861 FT /note="match to EST AW140078 (NID:g6144796)" FT /note="match to EST AW206957 (NID:g6506453)" FT misc_feature 8301724..8301838 FT /note="similar to Mus musculus EST AI385559 (NID:g4199022) FT mj22c04.x1" FT misc_feature 8301724..8301775 FT /note="similar to Bos taurus EST AW357551 (NID:g6861557)" FT misc_feature 8301855..8302049 FT /note="match to EST AI681926 (NID:g4892108) tx50f12.x1" FT /note="match to EST AI291524 (NID:g3934298) qm84f08.x1" FT misc_feature 8301863..8302049 FT /note="match to EST AI792670 (NID:g5340386) qm34a10.y5" FT misc_feature 8301868..8302136 FT /note="match to EST AI962260 (NID:g5754973) wq46b06.x1" FT misc_feature 8301894..8302049 FT /note="match to EST AI305282 (NID:g3988923) qm08g10.x1" FT repeat_region 8301915..8301949 FT /rpt_family="GC_rich" FT misc_feature 8302210..8302460 FT /note="match to EST AI792670 (NID:g5340386) qm34a10.y5" FT misc_feature 8302210..8302453 FT /note="match to EST AI305282 (NID:g3988923) qm08g10.x1" FT misc_feature 8302210..8302450 FT /note="match to EST AI291524 (NID:g3934298) qm84f08.x1" FT misc_feature 8302210..8302445 FT /note="match to EST AI681926 (NID:g4892108) tx50f12.x1" FT repeat_region 8302801..8302944 FT /rpt_family="MIR" FT misc_feature 8303305..8303315 FT /note="match to EST AI792670 (NID:g5340386) qm34a10.y5" FT misc_feature 8303708..8304172 FT /note="match to EST AA904659 (NID:g3039782) oj73d01.s1" FT repeat_region 8304431..8304603 FT /rpt_family="MaLR" FT repeat_region 8304631..8305139 FT /rpt_family="L1" FT repeat_region 8305147..8305338 FT /rpt_family="Alu" FT repeat_region 8305350..8305625 FT /rpt_family="Alu" FT repeat_region 8305627..8305769 FT /rpt_family="L1" FT misc_feature 8305780..8305790 FT /note="match to EST AI291524 (NID:g3934298) qm84f08.x1" FT repeat_region 8307299..8307575 FT /rpt_family="Alu" FT repeat_region 8307635..8307656 FT /rpt_family="AT_rich" FT repeat_region 8308082..8308103 FT /rpt_family="AT_rich" FT repeat_region 8308524..8308767 FT /rpt_family="MaLR" FT repeat_region 8309196..8309572 FT /rpt_family="L1" FT repeat_region 8309581..8310209 FT /rpt_family="L1" FT repeat_region 8310210..8310508 FT /rpt_family="Alu" FT repeat_region 8310509..8310889 FT /rpt_family="L1" FT repeat_region 8310906..8310972 FT /rpt_family="L1" FT repeat_region 8310986..8311907 FT /rpt_family="L1" FT repeat_region 8311721..8312228 FT /rpt_family="L1" FT repeat_region 8312241..8312321 FT /rpt_family="(TATATG)n" FT repeat_region 8312379..8312685 FT /rpt_family="Alu" FT repeat_region 8312815..8313106 FT /rpt_family="L1" FT repeat_region 8313107..8313411 FT /rpt_family="Alu" FT repeat_region 8313412..8313485 FT /rpt_family="L1" FT repeat_region 8315266..8315378 FT /rpt_family="L2" FT repeat_region 8315628..8315861 FT /rpt_family="L1" FT repeat_region 8315868..8315956 FT /rpt_family="MER1_type" FT repeat_region 8315888..8315936 FT /rpt_family="MER1_type" FT repeat_region 8316115..8316281 FT /rpt_family="MER1_type" FT repeat_region 8316282..8316386 FT /rpt_family="MIR" FT repeat_region 8316444..8316477 FT /rpt_family="AT_rich" FT repeat_region 8316478..8316707 FT /rpt_family="Alu" FT repeat_region 8316732..8317029 FT /rpt_family="Alu" FT repeat_region 8317281..8317385 FT /rpt_family="MER1_type" FT repeat_region 8317713..8317878 FT /rpt_family="MER1_type" FT repeat_region 8319354..8319490 FT /rpt_family="L1" FT repeat_region 8319500..8319750 FT /rpt_family="(TA)n" FT repeat_region 8319751..8320031 FT /rpt_family="Alu" FT repeat_region 8320289..8320685 FT /rpt_family="MaLR" FT repeat_region 8320728..8320790 FT /rpt_family="MaLR" FT repeat_region 8320809..8321193 FT /rpt_family="L2" FT repeat_region 8321832..8322682 FT /rpt_family="ERVL" FT repeat_region 8323142..8323515 FT /rpt_family="MaLR" FT repeat_region 8323893..8324283 FT /rpt_family="ERVL" FT repeat_region 8324284..8324306 FT /rpt_family="(TTTG)n" FT repeat_region 8324307..8324412 FT /rpt_family="ERVL" FT repeat_region 8325878..8325957 FT /rpt_family="ERVL" FT repeat_region 8325980..8325998 FT /rpt_family="Alu" FT repeat_region 8325999..8326069 FT /rpt_family="(TCCCC)n" FT repeat_region 8326070..8326354 FT /rpt_family="Alu" FT repeat_region 8326720..8326760 FT /rpt_family="MER1_type" FT repeat_region 8326761..8326793 FT /rpt_family="(CAAA)n" FT repeat_region 8326794..8326846 FT /rpt_family="MER1_type" FT repeat_region 8326881..8327005 FT /rpt_family="AcHobo" FT repeat_region 8327269..8327339 FT /rpt_family="CT-rich" FT repeat_region 8328966..8329024 FT /rpt_family="L2" FT repeat_region 8329616..8329679 FT /rpt_family="L2" FT repeat_region 8330075..8330160 FT /rpt_family="MIR" FT repeat_region 8331105..8331263 FT /rpt_family="MER1_type" FT repeat_region 8332403..8332482 FT /rpt_family="MIR" FT repeat_region 8333199..8333306 FT /rpt_family="MER1_type" FT repeat_region 8333500..8333845 FT /rpt_family="Alu" FT repeat_region 8334544..8334851 FT /rpt_family="Alu" FT repeat_region 8336242..8336268 FT /rpt_family="AT_rich" FT repeat_region 8336806..8336926 FT /rpt_family="Alu" FT repeat_region 8336927..8336949 FT /rpt_family="(TAAA)n" FT repeat_region 8336950..8337122 FT /rpt_family="Alu" FT repeat_region 8337701..8337742 FT /rpt_family="T-rich" FT misc_feature 8343325..8343711 FT /note="CpG_island (%GC=60.5, o/e=0.89, #CpGs=32)" FT repeat_region 8343885..8344014 FT /rpt_family="L2" FT repeat_region 8344009..8344335 FT /rpt_family="L2" FT repeat_region 8344719..8344816 FT /rpt_family="L2" FT repeat_region 8344820..8345179 FT /rpt_family="MaLR" FT repeat_region 8345746..8345894 FT /rpt_family="L2" FT repeat_region 8345895..8346198 FT /rpt_family="Alu" FT repeat_region 8346199..8347254 FT /rpt_family="L2" FT repeat_region 8347310..8347605 FT /rpt_family="Alu" FT repeat_region 8348620..8348929 FT /rpt_family="Alu" FT repeat_region 8351924..8352512 FT /rpt_family="L1" FT repeat_region 8353893..8354021 FT /rpt_family="L1" FT repeat_region 8354033..8354802 FT /rpt_family="L1" FT repeat_region 8354773..8356383 FT /rpt_family="L1" FT repeat_region 8356391..8357458 FT /rpt_family="L2" FT repeat_region 8357503..8357523 FT /rpt_family="AT_rich" FT repeat_region 8357524..8357731 FT /rpt_family="MIR" FT repeat_region 8357739..8358159 FT /rpt_family="ERV1" FT repeat_region 8358187..8358341 FT /rpt_family="L2" FT repeat_region 8358370..8358685 FT /rpt_family="Alu" FT repeat_region 8358761..8359096 FT /rpt_family="ERV1" FT repeat_region 8359097..8359860 FT /rpt_family="ERV1" FT repeat_region 8359861..8360282 FT /rpt_family="ERV1" FT repeat_region 8360286..8360578 FT /rpt_family="L2" FT repeat_region 8361564..8362127 FT /rpt_family="MaLR" FT repeat_region 8362397..8362832 FT /rpt_family="ERV1" FT repeat_region 8363658..8363909 FT /rpt_family="Alu" FT repeat_region 8363916..8364029 FT /rpt_family="(GAAA)n" FT repeat_region 8364700..8364762 FT /rpt_family="L2" FT repeat_region 8365020..8365196 FT /rpt_family="L2" FT repeat_region 8365193..8365635 FT /rpt_family="L2" FT repeat_region 8365645..8365666 FT /rpt_family="AT_rich" FT repeat_region 8366628..8366825 FT /rpt_family="MaLR" FT repeat_region 8367253..8367327 FT /rpt_family="MIR" FT repeat_region 8367568..8367602 FT /rpt_family="AT_rich" FT repeat_region 8367622..8368010 FT /rpt_family="ERVL" FT repeat_region 8369438..8369605 FT /rpt_family="MIR" FT repeat_region 8369793..8369984 FT /rpt_family="L1" FT repeat_region 8370555..8370594 FT /rpt_family="AT_rich" FT repeat_region 8370749..8371359 FT /rpt_family="L1" FT repeat_region 8371360..8371657 FT /rpt_family="Alu" FT repeat_region 8371658..8372178 FT /rpt_family="L1" FT repeat_region 8372179..8372217 FT /rpt_family="(CA)n" FT repeat_region 8372218..8372266 FT /rpt_family="L1" FT repeat_region 8372311..8372590 FT /rpt_family="Alu" FT repeat_region 8372687..8372723 FT /rpt_family="AT_rich" FT repeat_region 8374419..8374762 FT /rpt_family="L2" FT repeat_region 8374897..8375029 FT /rpt_family="L2" FT repeat_region 8375045..8375166 FT /rpt_family="L2" FT repeat_region 8375807..8375870 FT /rpt_family="MIR" FT repeat_region 8376309..8376476 FT /rpt_family="MIR" FT repeat_region 8378821..8378986 FT /rpt_family="MIR" FT repeat_region 8379043..8379543 FT /rpt_family="MaLR" FT repeat_region 8379590..8379635 FT /rpt_family="(TC)n" FT repeat_region 8381036..8381445 FT /rpt_family="MaLR" FT repeat_region 8382203..8382302 FT /rpt_family="MaLR" FT repeat_region 8382824..8382884 FT /rpt_family="L2" FT repeat_region 8384652..8384955 FT /rpt_family="Alu" FT repeat_region 8385067..8385125 FT /rpt_family="MaLR" FT repeat_region 8385126..8385499 FT /rpt_family="MaLR" FT repeat_region 8387024..8387401 FT /rpt_family="MaLR" FT repeat_region 8387402..8387697 FT /rpt_family="MaLR" FT repeat_region 8387721..8387758 FT /rpt_family="AT_rich" FT repeat_region 8387823..8388012 FT /rpt_family="MER1_type" FT repeat_region 8388013..8388300 FT /rpt_family="Alu" FT repeat_region 8388301..8388410 FT /rpt_family="MER1_type" FT repeat_region 8388458..8388519 FT /rpt_family="MIR" FT repeat_region 8388520..8388813 FT /rpt_family="Alu" FT repeat_region 8388814..8388969 FT /rpt_family="MIR" FT repeat_region 8389960..8390256 FT /rpt_family="MER1_type" FT repeat_region 8390343..8390617 FT /rpt_family="Alu" FT repeat_region 8390666..8390910 FT /rpt_family="MER1_type" FT repeat_region 8391161..8391278 FT /rpt_family="MIR" FT repeat_region 8393606..8393944 FT /rpt_family="ERV1" FT repeat_region 8395154..8395294 FT /rpt_family="MIR" FT repeat_region 8395300..8395477 FT /rpt_family="MIR" FT repeat_region 8395632..8395736 FT /rpt_family="MIR" FT repeat_region 8397065..8397141 FT /rpt_family="CT-rich" FT repeat_region 8398025..8398317 FT /rpt_family="L2" FT repeat_region 8398692..8398796 FT /rpt_family="MIR" FT repeat_region 8398854..8398946 FT /rpt_family="ERVL" FT repeat_region 8398920..8399514 FT /rpt_family="ERV1" FT repeat_region 8399515..8399617 FT /rpt_family="MIR" FT repeat_region 8399622..8400146 FT /rpt_family="ERV1" FT repeat_region 8400262..8400379 FT /rpt_family="MaLR" FT repeat_region 8400380..8400712 FT /rpt_family="L2" FT repeat_region 8400764..8401174 FT /rpt_family="L2" FT repeat_region 8401862..8402193 FT /rpt_family="MER1_type" FT repeat_region 8403644..8403836 FT /rpt_family="L1" FT repeat_region 8404094..8404882 FT /rpt_family="L1" FT repeat_region 8405516..8405702 FT /rpt_family="MIR" FT repeat_region 8405824..8405865 FT /rpt_family="AT_rich" FT repeat_region 8405877..8405994 FT /rpt_family="Alu" FT repeat_region 8406821..8406866 FT /rpt_family="L2" FT repeat_region 8406915..8406988 FT /rpt_family="L2" FT repeat_region 8407002..8407117 FT /rpt_family="MIR" FT repeat_region 8407125..8407427 FT /rpt_family="L1" FT repeat_region 8407782..8407852 FT /rpt_family="(TCTA)n" FT repeat_region 8411236..8412280 FT /rpt_family="L1" FT repeat_region 8412273..8412693 FT /rpt_family="L1" FT repeat_region 8412694..8413068 FT /rpt_family="MaLR" FT repeat_region 8414642..8415016 FT /rpt_family="MaLR" FT repeat_region 8415017..8415637 FT /rpt_family="L1" FT repeat_region 8415718..8416121 FT /rpt_family="MaLR" FT repeat_region 8417085..8417502 FT /rpt_family="L2" FT repeat_region 8422966..8423230 FT /rpt_family="MIR" FT repeat_region 8423848..8424164 FT /rpt_family="Alu" FT repeat_region 8424243..8424366 FT /rpt_family="U1" FT repeat_region 8425829..8425881 FT /rpt_family="GA-rich" FT repeat_region 8429514..8429597 FT /rpt_family="ERVL" FT repeat_region 8429995..8430197 FT /rpt_family="MER1_type" FT repeat_region 8431004..8431436 FT /rpt_family="MaLR" FT repeat_region 8431636..8431670 FT /rpt_family="(T)n" FT repeat_region 8431785..8432001 FT /rpt_family="L1" FT repeat_region 8432077..8432166 FT /rpt_family="ERVL" FT repeat_region 8432277..8432912 FT /rpt_family="ERVL" FT repeat_region 8432915..8433027 FT /rpt_family="L2" FT repeat_region 8433165..8433837 FT /rpt_family="MER1_type" FT repeat_region 8433838..8434093 FT /rpt_family="Alu" FT repeat_region 8434094..8434131 FT /rpt_family="MER1_type" FT repeat_region 8435011..8435032 FT /rpt_family="AT_rich" FT repeat_region 8435033..8435143 FT /rpt_family="Alu" FT repeat_region 8435144..8435280 FT /rpt_family="Alu" FT repeat_region 8435807..8435970 FT /rpt_family="MaLR" FT repeat_region 8435971..8436380 FT /rpt_family="MaLR" FT repeat_region 8436381..8436432 FT /rpt_family="MaLR" FT repeat_region 8436434..8436488 FT /rpt_family="(GA)n" FT repeat_region 8436496..8436670 FT /rpt_family="MaLR" FT repeat_region 8436992..8437019 FT /rpt_family="(TAAAA)n" FT repeat_region 8437118..8437314 FT /rpt_family="L1" FT repeat_region 8437425..8437875 FT /rpt_family="L1" FT repeat_region 8438412..8438713 FT /rpt_family="Alu" FT repeat_region 8440904..8441143 FT /rpt_family="L2" FT repeat_region 8442490..8442638 FT /rpt_family="ERVL" FT repeat_region 8442796..8443186 FT /rpt_family="L2" FT repeat_region 8443609..8444340 FT /rpt_family="L1" FT repeat_region 8444640..8444983 FT /rpt_family="L1" FT repeat_region 8444991..8445461 FT /rpt_family="L1" FT repeat_region 8445462..8445776 FT /rpt_family="L1" FT repeat_region 8445785..8446090 FT /rpt_family="Alu" FT misc_feature 8445814..8446091 FT /note="CpG_island (%GC=63.3, o/e=0.93, #CpGs=27)" FT repeat_region 8446091..8446255 FT /rpt_family="L1" FT repeat_region 8446256..8446378 FT /rpt_family="MaLR" FT repeat_region 8446380..8446971 FT /rpt_family="L1" FT repeat_region 8446976..8447067 FT /rpt_family="MER1_type" FT repeat_region 8447977..8448304 FT /rpt_family="Alu" FT repeat_region 8449140..8449252 FT /rpt_family="L1" FT repeat_region 8449278..8449402 FT /rpt_family="L1" FT repeat_region 8449619..8449715 FT /rpt_family="MIR" FT repeat_region 8449777..8450024 FT /rpt_family="L1" FT repeat_region 8450025..8450072 FT /rpt_family="(TA)n" FT repeat_region 8450073..8450577 FT /rpt_family="L1" FT repeat_region 8450578..8450664 FT /rpt_family="MaLR" FT repeat_region 8450665..8451146 FT /rpt_family="L1" FT repeat_region 8451265..8451366 FT /rpt_family="L2" FT repeat_region 8451381..8451602 FT /rpt_family="L1" FT repeat_region 8451603..8451750 FT /rpt_family="L1" FT repeat_region 8451734..8451809 FT /rpt_family="L1" FT repeat_region 8451818..8451987 FT /rpt_family="MER1_type" FT repeat_region 8452028..8452444 FT /rpt_family="L2" FT repeat_region 8452445..8452765 FT /rpt_family="Alu" FT repeat_region 8452766..8452922 FT /rpt_family="L2" FT repeat_region 8452920..8452994 FT /rpt_family="MIR" FT repeat_region 8456786..8457095 FT /rpt_family="Alu" FT repeat_region 8457096..8457167 FT /rpt_family="MER1_type" FT repeat_region 8457361..8457834 FT /rpt_family="ERV1" FT repeat_region 8458881..8458905 FT /rpt_family="AT_rich" FT repeat_region 8459543..8459568 FT /rpt_family="AT_rich" FT repeat_region 8460614..8460714 FT /rpt_family="MIR" FT repeat_region 8460749..8460814 FT /rpt_family="(TCCA)n" FT repeat_region 8461452..8461836 FT /rpt_family="MaLR" FT repeat_region 8462062..8463434 FT /rpt_family="L2" FT repeat_region 8463460..8463485 FT /rpt_family="(TGGA)n" FT repeat_region 8463619..8463922 FT /rpt_family="Alu" FT repeat_region 8464032..8464096 FT /rpt_family="L1" FT repeat_region 8464097..8464402 FT /rpt_family="MER2_type" FT repeat_region 8464403..8464452 FT /rpt_family="L1" FT repeat_region 8464583..8464760 FT /rpt_family="MER1_type" FT repeat_region 8465092..8465217 FT /rpt_family="L2" FT repeat_region 8466616..8467118 FT /rpt_family="L2" FT repeat_region 8467187..8467428 FT /rpt_family="MaLR" FT repeat_region 8467462..8467569 FT /rpt_family="GA-rich" FT repeat_region 8467718..8468053 FT /rpt_family="L2" FT repeat_region 8468997..8469020 FT /rpt_family="AT_rich" FT repeat_region 8469537..8469846 FT /rpt_family="Alu" FT repeat_region 8470230..8470365 FT /rpt_family="MIR" FT repeat_region 8472919..8473084 FT /rpt_family="GA-rich" FT misc_feature 8473140..8475199 FT /note="CpG_island (%GC=64.1, o/e=0.79, #CpGs=157)" FT repeat_region 8474048..8474123 FT /rpt_family="CT-rich" FT repeat_region 8474748..8474818 FT /rpt_family="CT-rich" FT misc_feature 8481975..8482762 FT /note="CpG_island (%GC=62.3, o/e=0.82, #CpGs=71)" FT misc_feature 8483133..8483711 FT /note="CpG_island (%GC=55.8, o/e=0.76, #CpGs=39)" FT repeat_region 8487753..8487904 FT /rpt_family="MIR" FT repeat_region 8488165..8488471 FT /rpt_family="Alu" FT repeat_region 8489046..8489140 FT /rpt_family="MIR" FT repeat_region 8489202..8489313 FT /rpt_family="MIR" FT repeat_region 8492768..8492817 FT /rpt_family="GA-rich" FT repeat_region 8493322..8493601 FT /rpt_family="L1" FT repeat_region 8493570..8493877 FT /rpt_family="L1" FT repeat_region 8497173..8497203 FT /rpt_family="AT_rich" FT repeat_region 8498075..8498267 FT /rpt_family="MIR" FT repeat_region 8499461..8499487 FT /rpt_family="L2" FT repeat_region 8500362..8500552 FT /rpt_family="MIR" FT misc_feature 8501178..8501462 FT /note="CpG_island (%GC=63.2, o/e=0.86, #CpGs=25)" FT repeat_region 8501179..8501488 FT /rpt_family="Alu" FT repeat_region 8501583..8501605 FT /rpt_family="AT_rich" FT repeat_region 8501692..8501976 FT /rpt_family="Alu" FT repeat_region 8501980..8502012 FT /rpt_family="AT_rich" FT repeat_region 8502022..8502236 FT /rpt_family="MIR" FT repeat_region 8502241..8502306 FT /rpt_family="L1" FT repeat_region 8502307..8502385 FT /rpt_family="L1" FT repeat_region 8502386..8502424 FT /rpt_family="L1" FT repeat_region 8502480..8502528 FT /rpt_family="L1" FT repeat_region 8502833..8503375 FT /rpt_family="L1" FT repeat_region 8503381..8503516 FT /rpt_family="MIR" FT repeat_region 8506479..8506722 FT /rpt_family="MIR" FT repeat_region 8509413..8509627 FT /rpt_family="MIR" FT repeat_region 8511622..8511670 FT /rpt_family="AT_rich" FT repeat_region 8511823..8511991 FT /rpt_family="MIR" FT repeat_region 8511972..8512180 FT /rpt_family="MIR" FT repeat_region 8517650..8517687 FT /rpt_family="L2" FT repeat_region 8517954..8517977 FT /rpt_family="AT_rich" FT repeat_region 8518147..8518691 FT /rpt_family="L1" FT repeat_region 8519012..8519603 FT /rpt_family="L1" FT repeat_region 8519606..8519632 FT /rpt_family="AT_rich" FT repeat_region 8519637..8519890 FT /rpt_family="L1" FT repeat_region 8521302..8521498 FT /rpt_family="L1" FT repeat_region 8522223..8522340 FT /rpt_family="MER1_type" FT repeat_region 8522954..8523238 FT /rpt_family="Alu" FT repeat_region 8523413..8523464 FT /rpt_family="MIR" FT repeat_region 8523731..8523831 FT /rpt_family="L2" FT repeat_region 8524591..8524658 FT /rpt_family="MaLR" FT repeat_region 8524726..8525028 FT /rpt_family="MaLR" FT repeat_region 8526137..8526262 FT /rpt_family="MIR" FT repeat_region 8526271..8526737 FT /rpt_family="L2" FT repeat_region 8526841..8527175 FT /rpt_family="MaLR" FT repeat_region 8528309..8528479 FT /rpt_family="MIR" FT repeat_region 8529038..8529132 FT /rpt_family="MIR" FT repeat_region 8531942..8532118 FT /rpt_family="MIR" FT repeat_region 8532118..8532221 FT /rpt_family="L2" FT repeat_region 8534066..8534207 FT /rpt_family="MIR" FT repeat_region 8534471..8534637 FT /rpt_family="MIR" FT repeat_region 8534674..8535095 FT /rpt_family="ERVL" FT repeat_region 8536207..8536364 FT /rpt_family="MER1_type" FT repeat_region 8536512..8537610 FT /rpt_family="L1" FT repeat_region 8537662..8537750 FT /rpt_family="MIR" FT repeat_region 8539991..8540189 FT /rpt_family="MIR" FT repeat_region 8541014..8541078 FT /rpt_family="MER1_type" FT repeat_region 8541653..8541841 FT /rpt_family="MIR" FT repeat_region 8542027..8542093 FT /rpt_family="L2" FT repeat_region 8542119..8542821 FT /rpt_family="ERVL" FT repeat_region 8542828..8543014 FT /rpt_family="MIR" FT repeat_region 8543939..8543973 FT /rpt_family="CT-rich" FT repeat_region 8544271..8544619 FT /rpt_family="MaLR" FT repeat_region 8545467..8545635 FT /rpt_family="MER1_type" FT repeat_region 8545732..8545851 FT /rpt_family="L1" FT repeat_region 8545909..8546083 FT /rpt_family="MIR" FT repeat_region 8546094..8546952 FT /rpt_family="L2" FT repeat_region 8547964..8548111 FT /rpt_family="MIR" FT repeat_region 8548287..8548402 FT /rpt_family="L2" FT repeat_region 8549951..8550055 FT /rpt_family="MIR" FT repeat_region 8552742..8552888 FT /rpt_family="L2" FT repeat_region 8552932..8553238 FT /rpt_family="MER2_type" FT repeat_region 8553430..8553777 FT /rpt_family="MaLR" FT repeat_region 8553588..8553839 FT /rpt_family="MaLR" FT repeat_region 8554011..8554093 FT /rpt_family="MIR" FT repeat_region 8556667..8557032 FT /rpt_family="L2" FT repeat_region 8558141..8558411 FT /rpt_family="Alu" FT repeat_region 8559438..8559496 FT /rpt_family="(TA)n" FT repeat_region 8559638..8559661 FT /rpt_family="AT_rich" FT repeat_region 8560283..8560353 FT /rpt_family="MIR" FT repeat_region 8560928..8561345 FT /rpt_family="MaLR" FT repeat_region 8562546..8562669 FT /rpt_family="MIR" FT repeat_region 8563306..8563352 FT /rpt_family="L2" FT repeat_region 8563593..8563899 FT /rpt_family="Alu" FT repeat_region 8564206..8564561 FT /rpt_family="MaLR" FT repeat_region 8566141..8566495 FT /rpt_family="MaLR" FT repeat_region 8568447..8568977 FT /rpt_family="MaLR" FT repeat_region 8569167..8569409 FT /rpt_family="MIR" FT repeat_region 8570047..8570116 FT /rpt_family="MIR" FT repeat_region 8570789..8570856 FT /rpt_family="MIR" FT repeat_region 8570849..8570922 FT /rpt_family="L2" FT repeat_region 8571084..8571372 FT /rpt_family="L2" FT repeat_region 8572267..8572342 FT /rpt_family="MER1_type" FT repeat_region 8572362..8572576 FT /rpt_family="MIR" FT repeat_region 8572605..8572828 FT /rpt_family="MIR" FT repeat_region 8573202..8573321 FT /rpt_family="L1" FT repeat_region 8574361..8574481 FT /rpt_family="MIR" FT repeat_region 8575192..8575396 FT /rpt_family="L2" FT repeat_region 8576226..8576632 FT /rpt_family="L2" FT repeat_region 8576924..8577290 FT /rpt_family="MaLR" FT repeat_region 8577322..8577443 FT /rpt_family="MIR" FT repeat_region 8577526..8577590 FT /rpt_family="MIR" FT repeat_region 8577664..8577700 FT /rpt_family="U2" FT repeat_region 8577709..8577809 FT /rpt_family="MIR" FT repeat_region 8577831..8577936 FT /rpt_family="MIR" FT repeat_region 8577994..8578237 FT /rpt_family="MIR" FT repeat_region 8578656..8579065 FT /rpt_family="L1" FT repeat_region 8579381..8579401 FT /rpt_family="AT_rich" FT repeat_region 8579905..8581194 FT /rpt_family="L1" FT repeat_region 8581192..8582292 FT /rpt_family="L1" FT repeat_region 8583077..8583254 FT /rpt_family="MER1_type" FT repeat_region 8583472..8583492 FT /rpt_family="AT_rich" FT repeat_region 8583520..8583706 FT /rpt_family="MIR" FT repeat_region 8583882..8584061 FT /rpt_family="MER1_type" FT repeat_region 8584840..8584945 FT /rpt_family="MIR" FT repeat_region 8586084..8586252 FT /rpt_family="MER1_type" FT repeat_region 8586456..8586499 FT /rpt_family="(CAA)n" FT repeat_region 8586500..8587019 FT /rpt_family="AcHobo" FT repeat_region 8587108..8587751 FT /rpt_family="L1" FT repeat_region 8588265..8588433 FT /rpt_family="MIR" FT repeat_region 8588458..8588618 FT /rpt_family="MIR" FT repeat_region 8589390..8589518 FT /rpt_family="MIR" FT repeat_region 8590265..8590764 FT /rpt_family="L1" FT repeat_region 8591735..8591772 FT /rpt_family="(A)n" FT repeat_region 8592624..8592713 FT /rpt_family="CR1" FT repeat_region 8595631..8595749 FT /rpt_family="L2" FT repeat_region 8595856..8596248 FT /rpt_family="MaLR" FT repeat_region 8596439..8596673 FT /rpt_family="MIR" FT repeat_region 8596908..8596936 FT /rpt_family="(CAA)n" FT repeat_region 8597071..8597243 FT /rpt_family="MIR" FT repeat_region 8598595..8598883 FT /rpt_family="Alu" FT repeat_region 8599095..8599116 FT /rpt_family="AT_rich" FT repeat_region 8599483..8599643 FT /rpt_family="MER1_type" FT repeat_region 8600982..8601013 FT /rpt_family="(CA)n" FT repeat_region 8601014..8601058 FT /rpt_family="CT-rich" FT repeat_region 8601538..8601621 FT /rpt_family="L1" FT repeat_region 8601647..8601815 FT /rpt_family="MIR" FT repeat_region 8602416..8602563 FT /rpt_family="L1" FT repeat_region 8603890..8603911 FT /rpt_family="AT_rich" FT repeat_region 8605293..8605320 FT /rpt_family="AT_rich" FT repeat_region 8605970..8606548 FT /rpt_family="ERVL" FT repeat_region 8607513..8607593 FT /rpt_family="MIR" FT repeat_region 8608597..8608617 FT /rpt_family="AT_rich" FT repeat_region 8608784..8609304 FT /rpt_family="L1" FT repeat_region 8609497..8609663 FT /rpt_family="MIR" FT repeat_region 8609687..8609773 FT /rpt_family="L2" FT repeat_region 8609910..8610074 FT /rpt_family="MIR" FT repeat_region 8610216..8610396 FT /rpt_family="L2" FT repeat_region 8610649..8610709 FT /rpt_family="(CTAAT)n" FT repeat_region 8610712..8610826 FT /rpt_family="MER1_type" FT repeat_region 8611670..8611837 FT /rpt_family="MER53" FT repeat_region 8612576..8612840 FT /rpt_family="L1" FT repeat_region 8613096..8613332 FT /rpt_family="L2" FT repeat_region 8613919..8614017 FT /rpt_family="Alu" FT repeat_region 8614268..8614537 FT /rpt_family="MER121" FT repeat_region 8615855..8615947 FT /rpt_family="L2" FT repeat_region 8617272..8617762 FT /rpt_family="MaLR" FT repeat_region 8617828..8617897 FT /rpt_family="MER2_type" FT repeat_region 8617893..8618006 FT /rpt_family="MER2_type" FT repeat_region 8618225..8618692 FT /rpt_family="L2" FT repeat_region 8618723..8618808 FT /rpt_family="MIR" FT repeat_region 8618989..8619301 FT /rpt_family="Alu" FT repeat_region 8620876..8621258 FT /rpt_family="MaLR" FT repeat_region 8621480..8622725 FT /rpt_family="ERV1" FT repeat_region 8622925..8623145 FT /rpt_family="MIR" FT repeat_region 8623161..8623264 FT /rpt_family="MIR" FT repeat_region 8623655..8623900 FT /rpt_family="MIR" FT repeat_region 8626257..8626277 FT /rpt_family="(TA)n" FT repeat_region 8626484..8626658 FT /rpt_family="L1" FT repeat_region 8626925..8627106 FT /rpt_family="Alu" FT repeat_region 8627121..8627569 FT /rpt_family="L1" FT repeat_region 8627570..8627921 FT /rpt_family="L1" FT repeat_region 8629485..8629671 FT /rpt_family="MER1_type" FT repeat_region 8630771..8631016 FT /rpt_family="MIR" FT repeat_region 8631573..8631897 FT /rpt_family="L2" FT repeat_region 8632244..8632577 FT /rpt_family="MER1_type" FT repeat_region 8633400..8633521 FT /rpt_family="MER1_type" FT repeat_region 8633540..8633673 FT /rpt_family="MER1_type" FT repeat_region 8634823..8634853 FT /rpt_family="(TAAA)n" FT repeat_region 8635340..8635377 FT /rpt_family="(TG)n" FT repeat_region 8636217..8636443 FT /rpt_family="MIR" FT repeat_region 8638588..8638935 FT /rpt_family="L2" FT repeat_region 8640454..8640784 FT /rpt_family="MER2_type" FT repeat_region 8642472..8642736 FT /rpt_family="Alu" FT repeat_region 8642737..8642817 FT /rpt_family="L2" FT repeat_region 8647367..8647818 FT /rpt_family="MaLR" FT repeat_region 8647960..8648130 FT /rpt_family="Alu" FT repeat_region 8648430..8648453 FT /rpt_family="AT_rich" FT repeat_region 8648564..8648738 FT /rpt_family="MER2_type" FT repeat_region 8650253..8650370 FT /rpt_family="L1" FT repeat_region 8650730..8650838 FT /rpt_family="L1" FT repeat_region 8651776..8651894 FT /rpt_family="L1" FT repeat_region 8652997..8653168 FT /rpt_family="CR1" FT repeat_region 8653294..8653314 FT /rpt_family="AT_rich" FT repeat_region 8653639..8654021 FT /rpt_family="L1" FT repeat_region 8654027..8654147 FT /rpt_family="(TA)n" FT repeat_region 8654131..8654240 FT /rpt_family="(CATATA)n" FT repeat_region 8654923..8655099 FT /rpt_family="MIR" FT repeat_region 8655254..8655297 FT /rpt_family="CT-rich" FT repeat_region 8655300..8655459 FT /rpt_family="L2" FT repeat_region 8655561..8656205 FT /rpt_family="L2" FT repeat_region 8656223..8656652 FT /rpt_family="L2" FT repeat_region 8656653..8656847 FT /rpt_family="MER1_type" FT repeat_region 8656848..8656865 FT /rpt_family="L2" FT repeat_region 8656930..8657575 FT /rpt_family="L1" FT repeat_region 8657597..8657651 FT /rpt_family="L1" FT repeat_region 8659416..8659602 FT /rpt_family="MIR" FT repeat_region 8659935..8660393 FT /rpt_family="MaLR" FT repeat_region 8661121..8661389 FT /rpt_family="Alu" FT repeat_region 8661396..8661559 FT /rpt_family="MIR" FT repeat_region 8661820..8662048 FT /rpt_family="MIR" FT repeat_region 8663205..8663333 FT /rpt_family="L1" FT repeat_region 8663377..8663438 FT /rpt_family="(TATATG)n" FT repeat_region 8663874..8664227 FT /rpt_family="L2" FT repeat_region 8664468..8664635 FT /rpt_family="MIR" FT repeat_region 8666712..8666769 FT /rpt_family="L2" FT repeat_region 8669878..8669909 FT /rpt_family="AT_rich" FT repeat_region 8670402..8670897 FT /rpt_family="L1" FT repeat_region 8670898..8671185 FT /rpt_family="L1" FT repeat_region 8671826..8671852 FT /rpt_family="AT_rich" FT repeat_region 8672781..8673057 FT /rpt_family="Alu" FT repeat_region 8673579..8673721 FT /rpt_family="CR1" FT repeat_region 8673736..8674127 FT /rpt_family="MaLR" FT repeat_region 8674296..8674325 FT /rpt_family="(T)n" FT repeat_region 8676173..8676324 FT /rpt_family="MER1_type" FT repeat_region 8676856..8677154 FT /rpt_family="Alu" FT repeat_region 8678474..8678717 FT /rpt_family="MIR" FT repeat_region 8679005..8679238 FT /rpt_family="L1" FT repeat_region 8679239..8679592 FT /rpt_family="MaLR" FT repeat_region 8679593..8679693 FT /rpt_family="L1" FT repeat_region 8680042..8680086 FT /rpt_family="AT_rich" FT repeat_region 8680305..8680610 FT /rpt_family="Alu" FT repeat_region 8680904..8680925 FT /rpt_family="AT_rich" FT repeat_region 8680949..8681130 FT /rpt_family="MER1_type" FT repeat_region 8681152..8681328 FT /rpt_family="L1" FT repeat_region 8681371..8681718 FT /rpt_family="L1" FT repeat_region 8681599..8682097 FT /rpt_family="L1" FT repeat_region 8682145..8682464 FT /rpt_family="L1" FT repeat_region 8682483..8682792 FT /rpt_family="Alu" FT repeat_region 8682945..8683127 FT /rpt_family="L1" FT repeat_region 8684341..8685180 FT /rpt_family="L1" FT repeat_region 8685665..8686366 FT /rpt_family="L1" FT repeat_region 8686405..8686448 FT /rpt_family="AT_rich" FT repeat_region 8687113..8687465 FT /rpt_family="L1" FT repeat_region 8687650..8688263 FT /rpt_family="L1" FT repeat_region 8688284..8688725 FT /rpt_family="L1" FT repeat_region 8688818..8688983 FT /rpt_family="L1" FT repeat_region 8689111..8689302 FT /rpt_family="L1" FT repeat_region 8689435..8689510 FT /rpt_family="L1" FT repeat_region 8690411..8690571 FT /rpt_family="MER2_type" FT repeat_region 8690592..8690611 FT /rpt_family="(TTTA)n" FT repeat_region 8690612..8691238 FT /rpt_family="L1" FT repeat_region 8691833..8692181 FT /rpt_family="L1" FT repeat_region 8692192..8692305 FT /rpt_family="L2" FT repeat_region 8694733..8695012 FT /rpt_family="Alu" FT repeat_region 8695027..8695079 FT /rpt_family="(TC)n" FT repeat_region 8695082..8695152 FT /rpt_family="(CA)n" FT repeat_region 8695199..8695240 FT /rpt_family="(TG)n" FT repeat_region 8695394..8695719 FT /rpt_family="L2" FT repeat_region 8695964..8696131 FT /rpt_family="MIR" FT repeat_region 8696173..8696488 FT /rpt_family="L1" FT repeat_region 8696724..8696787 FT /rpt_family="L2" FT repeat_region 8697378..8697682 FT /rpt_family="Alu" FT repeat_region 8698620..8698650 FT /rpt_family="AT_rich" FT repeat_region 8698977..8699076 FT /rpt_family="L1" FT repeat_region 8699077..8699370 FT /rpt_family="L1" FT repeat_region 8699751..8699952 FT /rpt_family="MIR" FT repeat_region 8701051..8701243 FT /rpt_family="MER1_type" FT repeat_region 8701801..8701849 FT /rpt_family="(TA)n" FT repeat_region 8704089..8704187 FT /rpt_family="L1" FT repeat_region 8706569..8707001 FT /rpt_family="L1" FT repeat_region 8707002..8707021 FT /rpt_family="(TTTTG)n" FT repeat_region 8707022..8707617 FT /rpt_family="L1" FT repeat_region 8707618..8707640 FT /rpt_family="(TTG)n" FT repeat_region 8707641..8709618 FT /rpt_family="L1" FT repeat_region 8711112..8711287 FT /rpt_family="CR1" FT repeat_region 8711454..8711738 FT /rpt_family="L1" FT repeat_region 8711739..8712110 FT /rpt_family="L1" FT repeat_region 8712529..8712633 FT /rpt_family="MIR" FT repeat_region 8713129..8713383 FT /rpt_family="MIR" FT repeat_region 8713793..8713834 FT /rpt_family="(CA)n" FT repeat_region 8713842..8713962 FT /rpt_family="MIR" FT repeat_region 8714735..8714874 FT /rpt_family="MIR" FT repeat_region 8714920..8714979 FT /rpt_family="AT_rich" FT repeat_region 8715120..8715215 FT /rpt_family="L2" FT repeat_region 8717552..8717601 FT /rpt_family="(TA)n" FT repeat_region 8718567..8718876 FT /rpt_family="Alu" FT repeat_region 8719371..8719654 FT /rpt_family="Alu" FT repeat_region 8719798..8719874 FT /rpt_family="L2" FT repeat_region 8719886..8719993 FT /rpt_family="L2" FT repeat_region 8720609..8720744 FT /rpt_family="MIR" FT repeat_region 8721877..8722026 FT /rpt_family="MER1_type" FT repeat_region 8722067..8722097 FT /rpt_family="AT_rich" FT repeat_region 8722541..8722613 FT /rpt_family="MIR" FT repeat_region 8722621..8722989 FT /rpt_family="MaLR" FT repeat_region 8723295..8723360 FT /rpt_family="Mariner" FT repeat_region 8723385..8723498 FT /rpt_family="L2" FT repeat_region 8724945..8725355 FT /rpt_family="L1" FT repeat_region 8725356..8725699 FT /rpt_family="L1" FT repeat_region 8727223..8727399 FT /rpt_family="MIR" FT repeat_region 8727505..8727526 FT /rpt_family="AT_rich" FT repeat_region 8728971..8729399 FT /rpt_family="ERVL" FT repeat_region 8729471..8729606 FT /rpt_family="AcHobo" FT repeat_region 8730768..8731078 FT /rpt_family="Alu" FT repeat_region 8731174..8731194 FT /rpt_family="AT_rich" FT repeat_region 8731307..8732037 FT /rpt_family="L2" FT repeat_region 8732807..8732828 FT /rpt_family="(CAAAAA)n" FT repeat_region 8732869..8732944 FT /rpt_family="MIR" FT repeat_region 8733094..8733217 FT /rpt_family="MIR" FT repeat_region 8733483..8733558 FT /rpt_family="AcHobo" FT repeat_region 8733594..8733625 FT /rpt_family="AT_rich" FT repeat_region 8734875..8734995 FT /rpt_family="MIR" FT repeat_region 8735906..8736343 FT /rpt_family="L2" FT repeat_region 8736344..8736487 FT /rpt_family="Alu" FT repeat_region 8736492..8736810 FT /rpt_family="Alu" FT repeat_region 8736820..8737195 FT /rpt_family="L2" FT repeat_region 8737270..8737368 FT /rpt_family="L2" FT repeat_region 8737376..8737756 FT /rpt_family="L2" FT repeat_region 8737760..8738343 FT /rpt_family="MER1_type" FT repeat_region 8738440..8738538 FT /rpt_family="MIR" FT repeat_region 8740331..8740420 FT /rpt_family="L2" FT repeat_region 8740448..8740647 FT /rpt_family="MER1_type" FT repeat_region 8740783..8741401 FT /rpt_family="L2" FT repeat_region 8741875..8741980 FT /rpt_family="L1" FT repeat_region 8742378..8742474 FT /rpt_family="MIR" FT repeat_region 8742510..8743069 FT /rpt_family="ERVL" FT repeat_region 8744495..8744717 FT /rpt_family="ERVL" FT repeat_region 8744736..8744823 FT /rpt_family="MER1_type" FT repeat_region 8744852..8745484 FT /rpt_family="ERVL" FT repeat_region 8745586..8746079 FT /rpt_family="ERVL" FT repeat_region 8746102..8746486 FT /rpt_family="ERVL" FT repeat_region 8746519..8746687 FT /rpt_family="L1" FT repeat_region 8747334..8747422 FT /rpt_family="MIR" FT repeat_region 8747973..8748288 FT /rpt_family="Alu" FT repeat_region 8748465..8748622 FT /rpt_family="MER1_type" FT repeat_region 8750274..8750591 FT /rpt_family="Alu" FT misc_feature 8750308..8750597 FT /note="CpG_island (%GC=63.1, o/e=0.87, #CpGs=26)" FT repeat_region 8752273..8752440 FT /rpt_family="MIR" FT repeat_region 8755530..8755640 FT /rpt_family="(TATATG)n" FT repeat_region 8757463..8757490 FT /rpt_family="AT_rich" FT repeat_region 8757525..8757581 FT /rpt_family="(TA)n" FT repeat_region 8759311..8759354 FT /rpt_family="MIR" FT repeat_region 8759463..8759494 FT /rpt_family="AT_rich" FT repeat_region 8760493..8761017 FT /rpt_family="L1" FT repeat_region 8761135..8761412 FT /rpt_family="Alu" FT repeat_region 8761796..8761833 FT /rpt_family="AT_rich" FT repeat_region 8762371..8762537 FT /rpt_family="MIR" FT repeat_region 8763598..8763650 FT /rpt_family="(TAAA)n" FT repeat_region 8764841..8765137 FT /rpt_family="Alu" FT repeat_region 8765896..8765965 FT /rpt_family="T-rich" FT repeat_region 8772335..8772362 FT /rpt_family="AT_rich" FT repeat_region 8772398..8772498 FT /rpt_family="MER2_type" FT repeat_region 8772499..8772520 FT /rpt_family="AT_rich" FT repeat_region 8772521..8774194 FT /rpt_family="L1" FT repeat_region 8774195..8774470 FT /rpt_family="L1" FT repeat_region 8779252..8779523 FT /rpt_family="MER2_type" FT repeat_region 8779524..8779630 FT /rpt_family="MER2_type" FT repeat_region 8780127..8780198 FT /rpt_family="MIR" FT repeat_region 8780374..8781268 FT /rpt_family="L1" FT repeat_region 8781479..8781510 FT /rpt_family="MIR" FT repeat_region 8781511..8781543 FT /rpt_family="L2" FT repeat_region 8782494..8782580 FT /rpt_family="MIR" FT repeat_region 8782581..8782609 FT /rpt_family="(TG)n" FT repeat_region 8782610..8782695 FT /rpt_family="MIR" FT repeat_region 8783305..8783613 FT /rpt_family="Alu" FT repeat_region 8784189..8784646 FT /rpt_family="L2" FT repeat_region 8784831..8784997 FT /rpt_family="L1" FT repeat_region 8784998..8785138 FT /rpt_family="L1" FT repeat_region 8785202..8785496 FT /rpt_family="Alu" FT repeat_region 8785685..8785725 FT /rpt_family="L2" FT repeat_region 8786282..8786303 FT /rpt_family="AT_rich" FT repeat_region 8786304..8786475 FT /rpt_family="L1" FT repeat_region 8786579..8786610 FT /rpt_family="AT_rich" FT repeat_region 8786673..8786893 FT /rpt_family="MIR" FT repeat_region 8788803..8789040 FT /rpt_family="MIR" FT mobile_element 8789080..8789081 FT /mobile_element_type="transposon:bacterial transposon FT insertion in clone excised here" FT repeat_region 8789961..8790130 FT /rpt_family="L1" FT repeat_region 8793089..8793126 FT /rpt_family="(GA)n" FT repeat_region 8793544..8793578 FT /rpt_family="AT_rich" FT repeat_region 8795952..8796223 FT /rpt_family="Alu" FT repeat_region 8796487..8796722 FT /rpt_family="MIR" FT repeat_region 8799906..8800683 FT /rpt_family="L2" FT repeat_region 8802529..8802711 FT /rpt_family="ERVL" FT repeat_region 8802570..8802988 FT /rpt_family="ERVL" FT repeat_region 8803071..8803087 FT /rpt_family="L1" FT repeat_region 8803088..8804365 FT /rpt_family="L1" FT repeat_region 8804369..8805119 FT /rpt_family="L1" FT repeat_region 8805127..8805255 FT /rpt_family="ERVL" FT repeat_region 8805803..8805951 FT /rpt_family="MIR" FT repeat_region 8807006..8807064 FT /rpt_family="L2" FT repeat_region 8807506..8807806 FT /rpt_family="Alu" FT repeat_region 8809094..8809287 FT /rpt_family="MIR" FT repeat_region 8810519..8810692 FT /rpt_family="MIR" FT repeat_region 8810984..8811067 FT /rpt_family="MER1_type" FT repeat_region 8811990..8812011 FT /rpt_family="AT_rich" FT repeat_region 8816747..8817032 FT /rpt_family="Alu" FT repeat_region 8817058..8817080 FT /rpt_family="AT_rich" FT repeat_region 8817367..8817410 FT /rpt_family="AT_rich" FT repeat_region 8817602..8817896 FT /rpt_family="L1" FT repeat_region 8818002..8818121 FT /rpt_family="L1" FT repeat_region 8818465..8818631 FT /rpt_family="L1" FT repeat_region 8818692..8818727 FT /rpt_family="AT_rich" FT repeat_region 8818802..8818912 FT /rpt_family="L1" FT repeat_region 8820000..8820115 FT /rpt_family="L2" FT repeat_region 8820509..8820862 FT /rpt_family="MaLR" FT repeat_region 8821197..8821336 FT /rpt_family="MER103" FT repeat_region 8822376..8822723 FT /rpt_family="ERV1" FT repeat_region 8822906..8823228 FT /rpt_family="L2" FT repeat_region 8823989..8824029 FT /rpt_family="(TA)n" FT repeat_region 8824507..8825031 FT /rpt_family="L1" FT repeat_region 8826310..8827317 FT /rpt_family="L2" FT repeat_region 8827500..8827594 FT /rpt_family="L2" FT repeat_region 8827754..8830378 FT /rpt_family="L1" FT repeat_region 8830466..8830511 FT /rpt_family="AT_rich" FT repeat_region 8830825..8830852 FT /rpt_family="AT_rich" FT repeat_region 8830897..8830916 FT /rpt_family="(TG)n" FT repeat_region 8830919..8831263 FT /rpt_family="L1" FT repeat_region 8831264..8831720 FT /rpt_family="MaLR" FT repeat_region 8831721..8831930 FT /rpt_family="L1" FT repeat_region 8831975..8833035 FT /rpt_family="L1" FT repeat_region 8833059..8833161 FT /rpt_family="L1" FT repeat_region 8833185..8834080 FT /rpt_family="L1" FT repeat_region 8834185..8834280 FT /rpt_family="MIR" FT repeat_region 8835496..8835643 FT /rpt_family="L1" FT repeat_region 8835930..8836008 FT /rpt_family="Mariner" FT repeat_region 8836040..8836230 FT /rpt_family="L1" FT repeat_region 8836460..8836489 FT /rpt_family="AT_rich" FT repeat_region 8836769..8836796 FT /rpt_family="AT_rich" FT repeat_region 8839100..8839241 FT /rpt_family="MaLR" FT repeat_region 8839323..8839574 FT /rpt_family="L1" FT repeat_region 8839687..8839975 FT /rpt_family="L1" FT repeat_region 8839976..8840526 FT /rpt_family="L1" FT repeat_region 8840527..8840747 FT /rpt_family="L1" FT repeat_region 8840766..8841085 FT /rpt_family="MER2_type" FT repeat_region 8841112..8841470 FT /rpt_family="L1" FT repeat_region 8841471..8841628 FT /rpt_family="ERVL" FT repeat_region 8841629..8841929 FT /rpt_family="Alu" FT repeat_region 8841930..8842223 FT /rpt_family="ERVL" FT repeat_region 8842224..8842549 FT /rpt_family="L1" FT repeat_region 8842551..8842805 FT /rpt_family="MaLR" FT repeat_region 8842807..8843469 FT /rpt_family="L1" FT repeat_region 8843484..8843562 FT /rpt_family="MaLR" FT repeat_region 8843565..8844932 FT /rpt_family="L1" FT repeat_region 8846331..8846601 FT /rpt_family="ERVL" FT repeat_region 8847033..8847061 FT /rpt_family="AT_rich" FT repeat_region 8847586..8847802 FT /rpt_family="L2" FT repeat_region 8847959..8847986 FT /rpt_family="AT_rich" FT repeat_region 8848079..8848299 FT /rpt_family="MER1_type" FT repeat_region 8848426..8848811 FT /rpt_family="L1" FT repeat_region 8849843..8850068 FT /rpt_family="L1" FT repeat_region 8850099..8850221 FT /rpt_family="L1" FT repeat_region 8850324..8850385 FT /rpt_family="MaLR" FT repeat_region 8850786..8851187 FT /rpt_family="ERVL" FT repeat_region 8851747..8851960 FT /rpt_family="L1" FT repeat_region 8853041..8853196 FT /rpt_family="MIR" FT repeat_region 8853578..8853673 FT /rpt_family="MER1_type" FT repeat_region 8854183..8854248 FT /rpt_family="MER1_type" FT repeat_region 8854274..8854742 FT /rpt_family="MER1_type" FT repeat_region 8854924..8855226 FT /rpt_family="Alu" FT repeat_region 8855275..8855419 FT /rpt_family="MIR" FT repeat_region 8857006..8857274 FT /rpt_family="MER1_type" FT repeat_region 8857578..8857734 FT /rpt_family="MIR" FT repeat_region 8859625..8859875 FT /rpt_family="MIR" FT repeat_region 8860012..8860149 FT /rpt_family="MER103" FT repeat_region 8860171..8860230 FT /rpt_family="MER1_type" FT repeat_region 8860854..8861213 FT /rpt_family="MaLR" FT repeat_region 8861217..8862702 FT /rpt_family="MaLR" FT repeat_region 8862704..8863077 FT /rpt_family="MaLR" FT repeat_region 8863751..8864664 FT /rpt_family="L1" FT repeat_region 8864678..8866327 FT /rpt_family="L1" FT repeat_region 8866398..8866724 FT /rpt_family="L1" FT repeat_region 8867905..8868076 FT /rpt_family="L1" FT repeat_region 8868079..8869327 FT /rpt_family="L1" FT repeat_region 8869374..8871639 FT /rpt_family="L1" FT repeat_region 8871634..8871791 FT /rpt_family="L1" FT repeat_region 8871892..8871975 FT /rpt_family="L2" FT repeat_region 8871994..8872049 FT /rpt_family="AT_rich" FT repeat_region 8872685..8872771 FT /rpt_family="MIR" FT repeat_region 8872851..8873270 FT /rpt_family="L2" FT repeat_region 8873268..8873419 FT /rpt_family="L2" FT repeat_region 8873483..8873932 FT /rpt_family="ERVL" FT repeat_region 8873948..8874117 FT /rpt_family="L2" FT repeat_region 8874261..8874296 FT /rpt_family="AT_rich" FT repeat_region 8875018..8875305 FT /rpt_family="Alu" FT repeat_region 8875390..8875789 FT /rpt_family="ERVL" FT repeat_region 8877918..8877944 FT /rpt_family="(CA)n" FT repeat_region 8878070..8879696 FT /rpt_family="L1" FT repeat_region 8882304..8882699 FT /rpt_family="ERVL" FT repeat_region 8882720..8882819 FT /rpt_family="MIR" FT repeat_region 8883100..8883250 FT /rpt_family="MIR" FT repeat_region 8883633..8883663 FT /rpt_family="AT_rich" FT repeat_region 8883827..8884329 FT /rpt_family="MaLR" FT repeat_region 8884344..8884493 FT /rpt_family="L1" FT repeat_region 8884541..8884785 FT /rpt_family="L1" FT repeat_region 8884786..8884819 FT /rpt_family="(CA)n" FT repeat_region 8884820..8884908 FT /rpt_family="L1" FT repeat_region 8884909..8885194 FT /rpt_family="MaLR" FT repeat_region 8885205..8885251 FT /rpt_family="MaLR" FT repeat_region 8885252..8885336 FT /rpt_family="MaLR" FT repeat_region 8885334..8885673 FT /rpt_family="MaLR" FT repeat_region 8885674..8886012 FT /rpt_family="MaLR" FT repeat_region 8886014..8886596 FT /rpt_family="L1" FT repeat_region 8886654..8886881 FT /rpt_family="L1" FT repeat_region 8887503..8887537 FT /rpt_family="AT_rich" FT repeat_region 8889573..8889690 FT /rpt_family="MIR" FT repeat_region 8890114..8890271 FT /rpt_family="MIR" FT repeat_region 8890447..8890574 FT /rpt_family="MIR" FT repeat_region 8891111..8891176 FT /rpt_family="L2" FT repeat_region 8891663..8891963 FT /rpt_family="Alu" FT repeat_region 8892457..8892761 FT /rpt_family="Alu" FT repeat_region 8892844..8893097 FT /rpt_family="L2" FT repeat_region 8893140..8893409 FT /rpt_family="Alu" FT repeat_region 8893595..8893625 FT /rpt_family="AT_rich" FT repeat_region 8894385..8895086 FT /rpt_family="L2" FT repeat_region 8895553..8895628 FT /rpt_family="MIR" FT repeat_region 8900823..8901114 FT /rpt_family="Alu" FT repeat_region 8903922..8904467 FT /rpt_family="L2" FT repeat_region 8904480..8904828 FT /rpt_family="ERVL" FT repeat_region 8904888..8905052 FT /rpt_family="ERVL" FT repeat_region 8905168..8905712 FT /rpt_family="L2" FT repeat_region 8906823..8906851 FT /rpt_family="AT_rich" FT repeat_region 8907351..8907711 FT /rpt_family="L1" FT repeat_region 8908075..8908696 FT /rpt_family="L1" FT repeat_region 8908704..8909355 FT /rpt_family="L1" FT repeat_region 8909383..8909517 FT /rpt_family="MER1_type" FT repeat_region 8909519..8909661 FT /rpt_family="L1" FT repeat_region 8911112..8911135 FT /rpt_family="AT_rich" FT repeat_region 8911273..8911390 FT /rpt_family="MER53" FT repeat_region 8913891..8914905 FT /rpt_family="L1" FT repeat_region 8915140..8915399 FT /rpt_family="ERVL" FT repeat_region 8915404..8915867 FT /rpt_family="ERVL" FT repeat_region 8915966..8916035 FT /rpt_family="ERVL" FT repeat_region 8918297..8919435 FT /rpt_family="L1" FT repeat_region 8919586..8919613 FT /rpt_family="AT_rich" FT repeat_region 8920283..8920444 FT /rpt_family="MIR" FT repeat_region 8921416..8921984 FT /rpt_family="MaLR" FT repeat_region 8921986..8922014 FT /rpt_family="AT_rich" FT repeat_region 8922377..8923612 FT /rpt_family="L1" FT repeat_region 8923713..8924005 FT /rpt_family="Alu" FT repeat_region 8924536..8924591 FT /rpt_family="AT_rich" FT repeat_region 8926661..8926861 FT /rpt_family="MIR" FT repeat_region 8926957..8927282 FT /rpt_family="CR1" FT repeat_region 8928292..8928322 FT /rpt_family="AT_rich" FT repeat_region 8928505..8928822 FT /rpt_family="L1" FT repeat_region 8928823..8929191 FT /rpt_family="MaLR" FT repeat_region 8929192..8929419 FT /rpt_family="L1" FT repeat_region 8929420..8929454 FT /rpt_family="(TG)n" FT repeat_region 8929454..8929489 FT /rpt_family="(GA)n" FT repeat_region 8929455..8929566 FT /rpt_family="L1" FT repeat_region 8929574..8929832 FT /rpt_family="SVA" FT misc_feature 8929724..8930358 FT /note="CpG_island (%GC=67.1, o/e=0.69, #CpGs=48)" FT repeat_region 8930938..8930984 FT /rpt_family="L1" FT repeat_region 8930985..8931413 FT /rpt_family="L1" FT repeat_region 8931576..8931891 FT /rpt_family="Alu" FT repeat_region 8935494..8935815 FT /rpt_family="L2" FT repeat_region 8936697..8936731 FT /rpt_family="(TG)n" FT repeat_region 8937748..8937985 FT /rpt_family="MaLR" FT repeat_region 8938008..8939572 FT /rpt_family="L1" FT repeat_region 8940371..8940436 FT /rpt_family="MIR" FT repeat_region 8940446..8940565 FT /rpt_family="(TA)n" FT repeat_region 8940585..8940757 FT /rpt_family="MIR" FT repeat_region 8941659..8942071 FT /rpt_family="L1" FT repeat_region 8942905..8943135 FT /rpt_family="L2" FT repeat_region 8943324..8943672 FT /rpt_family="MaLR" FT repeat_region 8943673..8943695 FT /rpt_family="(GGGA)n" FT repeat_region 8943696..8943890 FT /rpt_family="MaLR" FT repeat_region 8944063..8944476 FT /rpt_family="ERVL" FT repeat_region 8945674..8945812 FT /rpt_family="L1" FT repeat_region 8947968..8948295 FT /rpt_family="MaLR" FT repeat_region 8948938..8949000 FT /rpt_family="(CA)n" FT repeat_region 8949132..8949184 FT /rpt_family="AT_rich" FT repeat_region 8949495..8949723 FT /rpt_family="MIR" FT repeat_region 8949933..8949954 FT /rpt_family="AT_rich" FT repeat_region 8950154..8950549 FT /rpt_family="MaLR" FT repeat_region 8951359..8951394 FT /rpt_family="AT_rich" FT repeat_region 8951721..8951888 FT /rpt_family="MIR" FT repeat_region 8952032..8952179 FT /rpt_family="MIR" FT repeat_region 8954088..8954343 FT /rpt_family="L1" FT repeat_region 8954438..8954814 FT /rpt_family="L1" FT repeat_region 8954815..8955127 FT /rpt_family="Alu" FT misc_feature 8954817..8955091 FT /note="CpG_island (%GC=60.7, o/e=0.96, #CpGs=22)" FT repeat_region 8955128..8956727 FT /rpt_family="L1" FT repeat_region 8956806..8956923 FT /rpt_family="L1" FT repeat_region 8956966..8957000 FT /rpt_family="AT_rich" FT repeat_region 8957096..8957440 FT /rpt_family="MaLR" FT repeat_region 8957588..8957676 FT /rpt_family="L2" FT repeat_region 8957713..8958179 FT /rpt_family="L2" FT repeat_region 8959794..8959918 FT /rpt_family="ERVL" FT repeat_region 8959919..8960465 FT /rpt_family="ERVL" FT repeat_region 8960596..8961024 FT /rpt_family="ERVL" FT repeat_region 8961086..8961425 FT /rpt_family="L1" FT repeat_region 8961443..8961526 FT /rpt_family="MaLR" FT repeat_region 8961542..8961614 FT /rpt_family="MaLR" FT repeat_region 8962073..8962682 FT /rpt_family="MER2_type" FT repeat_region 8963102..8963124 FT /rpt_family="AT_rich" FT repeat_region 8963754..8964024 FT /rpt_family="L2" FT repeat_region 8964184..8964204 FT /rpt_family="AT_rich" FT repeat_region 8964632..8964696 FT /rpt_family="(TA)n" FT repeat_region 8964697..8965043 FT /rpt_family="MaLR" FT repeat_region 8965044..8965117 FT /rpt_family="(TA)n" FT repeat_region 8966513..8966707 FT /rpt_family="Alu" FT repeat_region 8967006..8967052 FT /rpt_family="L2" FT repeat_region 8967310..8967409 FT /rpt_family="MIR" FT repeat_region 8967464..8967600 FT /rpt_family="L1" FT repeat_region 8967889..8968260 FT /rpt_family="L1" FT repeat_region 8968445..8968467 FT /rpt_family="AT_rich" FT repeat_region 8969273..8969293 FT /rpt_family="AT_rich" FT repeat_region 8969419..8969453 FT /rpt_family="AT_rich" FT repeat_region 8970401..8970520 FT /rpt_family="MaLR" FT repeat_region 8970513..8970826 FT /rpt_family="MaLR" FT repeat_region 8971751..8971873 FT /rpt_family="MIR" FT repeat_region 8973147..8973316 FT /rpt_family="MIR" FT repeat_region 8973467..8973612 FT /rpt_family="MER1_type" FT repeat_region 8973976..8974339 FT /rpt_family="L1" FT repeat_region 8974356..8974818 FT /rpt_family="L2" FT repeat_region 8974829..8975042 FT /rpt_family="MER1_type" FT repeat_region 8975043..8976239 FT /rpt_family="L2" FT repeat_region 8976594..8977103 FT /rpt_family="ERV1" FT repeat_region 8977595..8978045 FT /rpt_family="ERV1" FT repeat_region 8978220..8978394 FT /rpt_family="L2" FT repeat_region 8979176..8979898 FT /rpt_family="L2" FT repeat_region 8979960..8979993 FT /rpt_family="(TGAA)n" FT repeat_region 8980538..8980776 FT /rpt_family="Alu" FT repeat_region 8982401..8982716 FT /rpt_family="Alu" FT repeat_region 8982800..8983039 FT /rpt_family="L2" FT repeat_region 8983178..8983231 FT /rpt_family="MIR" FT repeat_region 8983512..8983741 FT /rpt_family="Alu" FT repeat_region 8984326..8984443 FT /rpt_family="MIR" FT repeat_region 8984429..8984498 FT /rpt_family="MIR" FT repeat_region 8984499..8984907 FT /rpt_family="MaLR" FT repeat_region 8984908..8985017 FT /rpt_family="MIR" FT repeat_region 8986346..8986820 FT /rpt_family="ERVL" FT repeat_region 8986875..8987558 FT /rpt_family="L2" FT repeat_region 8987794..8987951 FT /rpt_family="MIR" FT repeat_region 8989953..8990028 FT /rpt_family="MIR" FT repeat_region 8990516..8990976 FT /rpt_family="L1" FT repeat_region 8990971..8991172 FT /rpt_family="L1" FT repeat_region 8991226..8991304 FT /rpt_family="(TA)n" FT repeat_region 8991305..8991377 FT /rpt_family="Alu" FT repeat_region 8991378..8991721 FT /rpt_family="L1" FT repeat_region 8991736..8991931 FT /rpt_family="L1" FT repeat_region 8991942..8992071 FT /rpt_family="MIR" FT repeat_region 8992072..8992213 FT /rpt_family="ERV1" FT repeat_region 8993417..8993517 FT /rpt_family="MIR" FT repeat_region 8993749..8993873 FT /rpt_family="MIR" FT repeat_region 8994872..8994893 FT /rpt_family="AT_rich" FT repeat_region 8995430..8995535 FT /rpt_family="Alu" FT repeat_region 8996495..8996525 FT /rpt_family="(TTTA)n" FT repeat_region 8996531..8997469 FT /rpt_family="L1" FT repeat_region 8998129..8998624 FT /rpt_family="L1" FT repeat_region 8998697..8998868 FT /rpt_family="MIR" FT repeat_region 8999974..9000186 FT /rpt_family="MIR" FT repeat_region 9000311..9000613 FT /rpt_family="Alu" FT repeat_region 9002014..9002067 FT /rpt_family="(TG)n" FT repeat_region 9002121..9002370 FT /rpt_family="MIR" FT repeat_region 9003012..9003264 FT /rpt_family="MIR" FT repeat_region 9003707..9003786 FT /rpt_family="CT-rich" FT repeat_region 9003811..9004121 FT /rpt_family="L2" FT repeat_region 9005937..9006020 FT /rpt_family="L2" FT repeat_region 9006057..9006350 FT /rpt_family="Alu" FT repeat_region 9007116..9007237 FT /rpt_family="L2" FT repeat_region 9007290..9007372 FT /rpt_family="CR1" FT repeat_region 9008301..9008505 FT /rpt_family="MIR" FT repeat_region 9009389..9009415 FT /rpt_family="AT_rich" FT repeat_region 9011179..9011220 FT /rpt_family="AT_rich" FT repeat_region 9011386..9013354 FT /rpt_family="L1" FT repeat_region 9013362..9013521 FT /rpt_family="Alu" FT repeat_region 9013522..9013612 FT /rpt_family="(TA)n" FT repeat_region 9013617..9013739 FT /rpt_family="L1" FT repeat_region 9013923..9014288 FT /rpt_family="L1" FT repeat_region 9014292..9014371 FT /rpt_family="Alu" FT repeat_region 9017378..9017403 FT /rpt_family="AT_rich" FT repeat_region 9017421..9017459 FT /rpt_family="L2" FT repeat_region 9017467..9017641 FT /rpt_family="MER1_type" FT misc_feature 9017675..9017902 FT /note="CpG_island (%GC=61.8, o/e=0.78, #CpGs=18)" FT repeat_region 9017676..9017974 FT /rpt_family="Alu" FT repeat_region 9018065..9018388 FT /rpt_family="L1" FT repeat_region 9018402..9018571 FT /rpt_family="(TA)n" FT repeat_region 9018600..9018656 FT /rpt_family="(TA)n" FT repeat_region 9018942..9019466 FT /rpt_family="L2" FT repeat_region 9019542..9019673 FT /rpt_family="MER1_type" FT repeat_region 9019728..9019859 FT /rpt_family="ERV1" FT repeat_region 9020318..9020389 FT /rpt_family="L2" FT repeat_region 9024613..9024643 FT /rpt_family="AT_rich" FT repeat_region 9024800..9024827 FT /rpt_family="AT_rich" FT repeat_region 9025316..9026491 FT /rpt_family="MER2_type" FT repeat_region 9026520..9026783 FT /rpt_family="MER1_type" FT repeat_region 9026784..9027090 FT /rpt_family="Alu" FT repeat_region 9027091..9027128 FT /rpt_family="MER1_type" FT repeat_region 9027179..9027248 FT /rpt_family="(TCTA)n" FT repeat_region 9027363..9027515 FT /rpt_family="MER1_type" FT repeat_region 9027545..9027662 FT /rpt_family="MER1_type" FT repeat_region 9027940..9028248 FT /rpt_family="ERVL" FT repeat_region 9028464..9028574 FT /rpt_family="(TA)n" FT repeat_region 9028579..9031101 FT /rpt_family="L1" FT repeat_region 9031356..9031662 FT /rpt_family="Alu" FT repeat_region 9032605..9032829 FT /rpt_family="MER1_type" FT repeat_region 9033006..9033805 FT /rpt_family="L2" FT repeat_region 9033973..9034081 FT /rpt_family="L2" FT repeat_region 9034534..9034561 FT /rpt_family="(CA)n" FT repeat_region 9035134..9035278 FT /rpt_family="MER1_type" FT repeat_region 9035354..9035374 FT /rpt_family="(A)n" FT repeat_region 9036007..9036188 FT /rpt_family="MER1_type" FT repeat_region 9038201..9038343 FT /rpt_family="CR1" FT repeat_region 9039272..9039295 FT /rpt_family="AT_rich" FT repeat_region 9040176..9040198 FT /rpt_family="AT_rich" FT repeat_region 9040778..9040869 FT /rpt_family="MIR" FT repeat_region 9041125..9041269 FT /rpt_family="L2" FT repeat_region 9041780..9041821 FT /rpt_family="AT_rich" FT repeat_region 9041887..9042054 FT /rpt_family="L1" FT repeat_region 9042167..9042446 FT /rpt_family="Alu" FT repeat_region 9043050..9043070 FT /rpt_family="AT_rich" FT repeat_region 9043968..9044090 FT /rpt_family="MIR" FT repeat_region 9044304..9044326 FT /rpt_family="AT_rich" FT repeat_region 9044333..9044715 FT /rpt_family="L2" FT repeat_region 9045652..9045681 FT /rpt_family="(CA)n" FT repeat_region 9045742..9045778 FT /rpt_family="(TG)n" FT repeat_region 9045952..9046293 FT /rpt_family="L2" FT repeat_region 9046633..9046707 FT /rpt_family="AT_rich" FT repeat_region 9046830..9047116 FT /rpt_family="Alu" FT repeat_region 9047121..9047147 FT /rpt_family="(TAA)n" FT repeat_region 9047810..9049676 FT /rpt_family="L1" FT repeat_region 9049677..9049924 FT /rpt_family="MaLR" FT repeat_region 9049925..9050333 FT /rpt_family="MaLR" FT repeat_region 9050337..9053338 FT /rpt_family="L1" FT repeat_region 9053728..9054126 FT /rpt_family="L1" FT repeat_region 9054125..9054996 FT /rpt_family="L1" FT repeat_region 9055086..9055166 FT /rpt_family="AT_rich" FT repeat_region 9055167..9055399 FT /rpt_family="L1" FT repeat_region 9055421..9055588 FT /rpt_family="(TA)n" FT repeat_region 9055623..9055680 FT /rpt_family="(TA)n" FT repeat_region 9055693..9056333 FT /rpt_family="L1" FT repeat_region 9056334..9056380 FT /rpt_family="ERVK" FT repeat_region 9056369..9056735 FT /rpt_family="ERVK" FT repeat_region 9056736..9057075 FT /rpt_family="ERVK" FT repeat_region 9057074..9058094 FT /rpt_family="ERV1" FT repeat_region 9058079..9059298 FT /rpt_family="ERV1" FT repeat_region 9059278..9059424 FT /rpt_family="ERV1" FT repeat_region 9059424..9059465 FT /rpt_family="ERV1" FT repeat_region 9059466..9060102 FT /rpt_family="ERVK" FT repeat_region 9060107..9060163 FT /rpt_family="ERV1" FT repeat_region 9060168..9060289 FT /rpt_family="ERVK" FT repeat_region 9060295..9060381 FT /rpt_family="ERVK" FT repeat_region 9060430..9060776 FT /rpt_family="ERVK" FT repeat_region 9060780..9061457 FT /rpt_family="L1" FT repeat_region 9061467..9061636 FT /rpt_family="MaLR" FT repeat_region 9061637..9061926 FT /rpt_family="Alu" FT repeat_region 9061927..9062083 FT /rpt_family="MaLR" FT repeat_region 9062199..9062983 FT /rpt_family="L1" FT repeat_region 9064397..9064657 FT /rpt_family="L1" FT repeat_region 9064658..9065015 FT /rpt_family="MaLR" FT repeat_region 9065016..9065060 FT /rpt_family="L1" FT repeat_region 9065587..9065752 FT /rpt_family="MIR" FT repeat_region 9066323..9066415 FT /rpt_family="(TA)n" FT repeat_region 9067010..9067987 FT /rpt_family="L2" FT repeat_region 9068639..9068802 FT /rpt_family="MIR" FT repeat_region 9068853..9068928 FT /rpt_family="MIR" FT repeat_region 9070801..9070825 FT /rpt_family="AT_rich" FT repeat_region 9071507..9071528 FT /rpt_family="(TG)n" FT repeat_region 9071913..9072082 FT /rpt_family="MIR" FT repeat_region 9072964..9072992 FT /rpt_family="AT_rich" FT repeat_region 9073187..9073346 FT /rpt_family="(TA)n" FT repeat_region 9073857..9073879 FT /rpt_family="(A)n" FT repeat_region 9075034..9075135 FT /rpt_family="MER1_type" FT repeat_region 9075165..9075272 FT /rpt_family="MER1_type" FT repeat_region 9077177..9077337 FT /rpt_family="MIR" FT repeat_region 9077501..9077729 FT /rpt_family="MaLR" FT repeat_region 9078802..9078830 FT /rpt_family="AT_rich" FT repeat_region 9079443..9079500 FT /rpt_family="MIR" FT repeat_region 9081179..9081823 FT /rpt_family="L1" FT repeat_region 9081882..9082111 FT /rpt_family="L1" FT repeat_region 9082192..9082573 FT /rpt_family="L1" FT repeat_region 9082583..9083815 FT /rpt_family="L1" FT repeat_region 9083812..9083913 FT /rpt_family="L1" FT repeat_region 9083914..9083983 FT /rpt_family="Mariner" FT repeat_region 9083984..9084557 FT /rpt_family="L1" FT repeat_region 9084546..9085075 FT /rpt_family="L1" FT repeat_region 9085147..9085565 FT /rpt_family="L1" FT repeat_region 9085566..9085888 FT /rpt_family="Alu" FT repeat_region 9085889..9086296 FT /rpt_family="L1" FT repeat_region 9086468..9086594 FT /rpt_family="L1" FT repeat_region 9086595..9086885 FT /rpt_family="Alu" FT repeat_region 9086892..9087196 FT /rpt_family="Alu" FT repeat_region 9087197..9087510 FT /rpt_family="L1" FT repeat_region 9087577..9087675 FT /rpt_family="L2" FT repeat_region 9088941..9090796 FT /rpt_family="L1" FT repeat_region 9090797..9090890 FT /rpt_family="L1" FT repeat_region 9090889..9090951 FT /rpt_family="L1" FT repeat_region 9091250..9091385 FT /rpt_family="MaLR" FT repeat_region 9091886..9092816 FT /rpt_family="L1" FT repeat_region 9092826..9092913 FT /rpt_family="L1" FT repeat_region 9092917..9093006 FT /rpt_family="L1" FT repeat_region 9093007..9093401 FT /rpt_family="ERV1" FT repeat_region 9093432..9093517 FT /rpt_family="L1" FT repeat_region 9093518..9094442 FT /rpt_family="L1" FT repeat_region 9094445..9094615 FT /rpt_family="ERV1" FT repeat_region 9094616..9095266 FT /rpt_family="L1" FT repeat_region 9095267..9095572 FT /rpt_family="Alu" FT repeat_region 9095573..9096098 FT /rpt_family="L1" FT repeat_region 9096099..9096386 FT /rpt_family="Alu" FT repeat_region 9096387..9096613 FT /rpt_family="L1" FT repeat_region 9096614..9096904 FT /rpt_family="Alu" FT repeat_region 9096905..9097616 FT /rpt_family="L1" FT repeat_region 9097636..9098127 FT /rpt_family="L1" FT repeat_region 9098128..9098423 FT /rpt_family="Alu" FT repeat_region 9098426..9099580 FT /rpt_family="L1" FT repeat_region 9099594..9099710 FT /rpt_family="Alu" FT repeat_region 9099714..9100203 FT /rpt_family="L1" FT repeat_region 9100293..9101224 FT /rpt_family="L1" FT repeat_region 9101225..9101244 FT /rpt_family="(TTG)n" FT repeat_region 9101247..9101526 FT /rpt_family="Alu" FT repeat_region 9101527..9101695 FT /rpt_family="L1" FT repeat_region 9102358..9102485 FT /rpt_family="L2" FT repeat_region 9102701..9102746 FT /rpt_family="ERVL" FT repeat_region 9102758..9102792 FT /rpt_family="(GA)n" FT repeat_region 9102793..9102838 FT /rpt_family="L1" FT repeat_region 9103910..9104121 FT /rpt_family="MER1_type" FT repeat_region 9104192..9104472 FT /rpt_family="MaLR" FT repeat_region 9104560..9104677 FT /rpt_family="MER1_type" FT repeat_region 9105048..9105496 FT /rpt_family="ERV1" FT repeat_region 9105508..9105608 FT /rpt_family="L1" FT repeat_region 9105609..9106345 FT /rpt_family="L1" FT repeat_region 9108440..9108585 FT /rpt_family="MIR" FT repeat_region 9108735..9108921 FT /rpt_family="MIR" FT repeat_region 9109088..9109399 FT /rpt_family="Alu" FT repeat_region 9109691..9109714 FT /rpt_family="AT_rich" FT repeat_region 9109868..9109903 FT /rpt_family="AT_rich" FT repeat_region 9111838..9111865 FT /rpt_family="AT_rich" FT repeat_region 9112605..9112763 FT /rpt_family="Alu" FT repeat_region 9112856..9112948 FT /rpt_family="(TC)n" FT repeat_region 9112949..9113239 FT /rpt_family="Alu" FT repeat_region 9113616..9115691 FT /rpt_family="L1" FT repeat_region 9115815..9115981 FT /rpt_family="L1" FT repeat_region 9116004..9116400 FT /rpt_family="L1" FT repeat_region 9117207..9117229 FT /rpt_family="(TTTG)n" FT repeat_region 9117692..9117730 FT /rpt_family="AT_rich" FT repeat_region 9118618..9118683 FT /rpt_family="MER1_type" FT repeat_region 9119025..9120126 FT /rpt_family="L1" FT repeat_region 9120249..9120454 FT /rpt_family="L1" FT repeat_region 9120635..9121355 FT /rpt_family="L1" FT repeat_region 9121505..9121786 FT /rpt_family="Alu" FT repeat_region 9121869..9122400 FT /rpt_family="MaLR" FT repeat_region 9122702..9123370 FT /rpt_family="L1" FT repeat_region 9123414..9123617 FT /rpt_family="CR1" FT repeat_region 9124994..9125642 FT /rpt_family="L1" FT repeat_region 9125676..9126543 FT /rpt_family="L1" FT repeat_region 9126544..9126948 FT /rpt_family="MaLR" FT repeat_region 9126949..9127197 FT /rpt_family="L1" FT repeat_region 9127177..9127453 FT /rpt_family="L1" FT repeat_region 9127444..9127814 FT /rpt_family="L1" FT repeat_region 9127965..9128301 FT /rpt_family="MaLR" FT repeat_region 9128339..9128619 FT /rpt_family="L1" FT repeat_region 9129156..9133423 FT /rpt_family="L1" FT repeat_region 9133424..9133540 FT /rpt_family="Alu" FT repeat_region 9133541..9133743 FT /rpt_family="L1" FT repeat_region 9133744..9133822 FT /rpt_family="Mariner" FT repeat_region 9133823..9134044 FT /rpt_family="L1" FT repeat_region 9134045..9134576 FT /rpt_family="L1" FT repeat_region 9134887..9135037 FT /rpt_family="MIR" FT repeat_region 9135234..9135401 FT /rpt_family="L1" FT repeat_region 9135402..9136022 FT /rpt_family="L1" FT repeat_region 9136058..9136082 FT /rpt_family="(TG)n" FT repeat_region 9137726..9138030 FT /rpt_family="Alu" FT repeat_region 9138147..9139073 FT /rpt_family="L1" FT repeat_region 9139088..9139650 FT /rpt_family="L1" FT repeat_region 9139651..9139687 FT /rpt_family="(TA)n" FT repeat_region 9139689..9140417 FT /rpt_family="L1" FT repeat_region 9140424..9140981 FT /rpt_family="L1" FT repeat_region 9140982..9141260 FT /rpt_family="Alu" FT repeat_region 9141261..9143953 FT /rpt_family="L1" FT repeat_region 9143983..9144330 FT /rpt_family="MaLR" FT repeat_region 9144851..9144985 FT /rpt_family="ERVL" FT repeat_region 9145274..9145300 FT /rpt_family="(T)n" FT repeat_region 9145373..9145549 FT /rpt_family="MIR" FT repeat_region 9148454..9148521 FT /rpt_family="Mariner" FT repeat_region 9150542..9150835 FT /rpt_family="Alu" FT repeat_region 9150840..9151151 FT /rpt_family="Alu" FT repeat_region 9152821..9152965 FT /rpt_family="Alu" FT repeat_region 9152977..9153092 FT /rpt_family="L1" FT repeat_region 9153093..9153481 FT /rpt_family="L1" FT repeat_region 9153700..9154005 FT /rpt_family="Alu" FT repeat_region 9154641..9154670 FT /rpt_family="(CTATA)n" FT repeat_region 9155135..9155269 FT /rpt_family="MIR" FT repeat_region 9155287..9155331 FT /rpt_family="(CA)n" FT repeat_region 9158225..9158245 FT /rpt_family="AT_rich" FT repeat_region 9158346..9158452 FT /rpt_family="L2" FT repeat_region 9158474..9159057 FT /rpt_family="ERV1" FT repeat_region 9163111..9163131 FT /rpt_family="AT_rich" FT repeat_region 9163241..9163278 FT /rpt_family="MIR" FT repeat_region 9164564..9164596 FT /rpt_family="AT_rich" FT repeat_region 9165630..9165960 FT /rpt_family="Alu" FT repeat_region 9166069..9166175 FT /rpt_family="CT-rich" FT repeat_region 9166212..9166830 FT /rpt_family="MER2_type" FT repeat_region 9166833..9167520 FT /rpt_family="L1" FT repeat_region 9167521..9167556 FT /rpt_family="(CA)n" FT repeat_region 9167557..9167993 FT /rpt_family="L1" FT repeat_region 9167994..9168387 FT /rpt_family="MaLR" FT repeat_region 9168388..9168422 FT /rpt_family="L1" FT repeat_region 9168443..9168976 FT /rpt_family="MER2_type" FT repeat_region 9169020..9169623 FT /rpt_family="L1" FT repeat_region 9169729..9170253 FT /rpt_family="MaLR" FT repeat_region 9170367..9170461 FT /rpt_family="L1" FT repeat_region 9170486..9170598 FT /rpt_family="L1" FT repeat_region 9170658..9171450 FT /rpt_family="L1" FT repeat_region 9171462..9172642 FT /rpt_family="L1" FT repeat_region 9172684..9172823 FT /rpt_family="L1" FT repeat_region 9172824..9173130 FT /rpt_family="Alu" FT repeat_region 9173131..9173512 FT /rpt_family="L1" FT repeat_region 9173509..9173763 FT /rpt_family="L1" FT repeat_region 9173769..9173843 FT /rpt_family="L1" FT repeat_region 9175904..9176098 FT /rpt_family="MER1_type" FT repeat_region 9176183..9176271 FT /rpt_family="AT_rich" FT repeat_region 9176423..9176463 FT /rpt_family="MER1_type" FT repeat_region 9176882..9177177 FT /rpt_family="MER1_type" FT repeat_region 9177178..9177447 FT /rpt_family="Alu" FT repeat_region 9177448..9177555 FT /rpt_family="MER1_type" FT repeat_region 9177796..9177868 FT /rpt_family="(ATG)n" FT repeat_region 9177906..9178047 FT /rpt_family="MIR" FT repeat_region 9178283..9178343 FT /rpt_family="(TG)n" FT repeat_region 9178661..9178981 FT /rpt_family="Alu" FT repeat_region 9179374..9179673 FT /rpt_family="Alu" FT repeat_region 9179794..9179845 FT /rpt_family="L2" FT repeat_region 9180222..9181433 FT /rpt_family="L1" FT repeat_region 9181851..9181940 FT /rpt_family="(CA)n" FT repeat_region 9181949..9181978 FT /rpt_family="AT_rich" FT repeat_region 9181986..9182459 FT /rpt_family="MER2_type" FT repeat_region 9182466..9182654 FT /rpt_family="MER2_type" FT repeat_region 9182662..9183571 FT /rpt_family="MER2_type" FT repeat_region 9183572..9183641 FT /rpt_family="(TA)n" FT repeat_region 9183642..9183961 FT /rpt_family="MER2_type" FT repeat_region 9184622..9184678 FT /rpt_family="L2" FT repeat_region 9184867..9184909 FT /rpt_family="AT_rich" FT repeat_region 9185111..9185172 FT /rpt_family="AcHobo" FT repeat_region 9185721..9185815 FT /rpt_family="MER1_type" FT repeat_region 9185927..9185947 FT /rpt_family="AT_rich" FT repeat_region 9186820..9186934 FT /rpt_family="Alu" FT repeat_region 9187635..9187662 FT /rpt_family="AT_rich" FT repeat_region 9188098..9188144 FT /rpt_family="(CATG)n" FT repeat_region 9188224..9188693 FT /rpt_family="ERV1" FT repeat_region 9189118..9189217 FT /rpt_family="MER2_type" FT repeat_region 9189239..9189502 FT /rpt_family="MER2_type" FT repeat_region 9190168..9190296 FT /rpt_family="AcHobo" FT repeat_region 9190311..9190751 FT /rpt_family="ERVL" FT repeat_region 9191150..9191863 FT /rpt_family="ERV1" FT repeat_region 9191914..9192268 FT /rpt_family="MaLR" FT repeat_region 9192542..9192565 FT /rpt_family="(A)n" FT repeat_region 9192632..9192738 FT /rpt_family="MIR" FT repeat_region 9193102..9193203 FT /rpt_family="L1" FT repeat_region 9193743..9193891 FT /rpt_family="MaLR" FT repeat_region 9194659..9195132 FT /rpt_family="L1" FT repeat_region 9195579..9195702 FT /rpt_family="MIR" FT repeat_region 9196063..9196347 FT /rpt_family="Alu" FT repeat_region 9197237..9197518 FT /rpt_family="Alu" FT repeat_region 9197920..9198395 FT /rpt_family="L1" FT repeat_region 9198685..9198763 FT /rpt_family="A-rich" FT repeat_region 9202996..9203025 FT /rpt_family="(TTA)n" FT repeat_region 9209495..9210264 FT /rpt_family="L1" FT repeat_region 9210270..9210394 FT /rpt_family="L1" FT repeat_region 9214285..9214470 FT /rpt_family="MER1_type" FT repeat_region 9214559..9214761 FT /rpt_family="MER1_type" FT repeat_region 9214765..9215082 FT /rpt_family="L1" FT repeat_region 9216102..9216136 FT /rpt_family="AT_rich" FT repeat_region 9216474..9216527 FT /rpt_family="(TA)n" FT repeat_region 9217375..9217775 FT /rpt_family="MaLR" FT repeat_region 9217780..9218125 FT /rpt_family="MaLR" FT repeat_region 9218310..9218702 FT /rpt_family="MER2_type" FT repeat_region 9218796..9218873 FT /rpt_family="L2" FT repeat_region 9219143..9219399 FT /rpt_family="L2" FT repeat_region 9219803..9219878 FT /rpt_family="L2" FT repeat_region 9219924..9220400 FT /rpt_family="ERV1" FT repeat_region 9220440..9220523 FT /rpt_family="ERV1" FT repeat_region 9220568..9220693 FT /rpt_family="L2" FT repeat_region 9221219..9221412 FT /rpt_family="L1" FT repeat_region 9221627..9221740 FT /rpt_family="MIR" FT repeat_region 9221916..9222096 FT /rpt_family="MIR" FT repeat_region 9222726..9222748 FT /rpt_family="AT_rich" FT repeat_region 9223171..9223252 FT /rpt_family="MIR" FT repeat_region 9224485..9224709 FT /rpt_family="MaLR" FT repeat_region 9224860..9225085 FT /rpt_family="L1" FT repeat_region 9225099..9225323 FT /rpt_family="L1" FT repeat_region 9225744..9226039 FT /rpt_family="L1" FT repeat_region 9226755..9226945 FT /rpt_family="L1" FT repeat_region 9226973..9227094 FT /rpt_family="ERVL" FT repeat_region 9227240..9227274 FT /rpt_family="AT_rich" FT repeat_region 9227563..9227600 FT /rpt_family="AT_rich" FT repeat_region 9227914..9228227 FT /rpt_family="Alu" FT repeat_region 9228653..9228689 FT /rpt_family="AT_rich" FT repeat_region 9229149..9229220 FT /rpt_family="ERV1" FT repeat_region 9229235..9229872 FT /rpt_family="ERV1" FT repeat_region 9229944..9229996 FT /rpt_family="(TTCA)n" FT repeat_region 9230011..9230370 FT /rpt_family="L1" FT repeat_region 9230738..9230889 FT /rpt_family="L1" FT repeat_region 9232024..9232058 FT /rpt_family="AT_rich" FT repeat_region 9232144..9232164 FT /rpt_family="AT_rich" FT repeat_region 9232165..9232488 FT /rpt_family="L1" FT repeat_region 9232489..9232516 FT /rpt_family="(T)n" FT repeat_region 9233240..9233364 FT /rpt_family="Alu" FT repeat_region 9234784..9234985 FT /rpt_family="MIR" FT repeat_region 9236354..9236488 FT /rpt_family="L1" FT repeat_region 9236888..9237016 FT /rpt_family="L1" FT repeat_region 9237009..9237263 FT /rpt_family="L1" FT repeat_region 9237270..9237999 FT /rpt_family="L1" FT repeat_region 9238079..9238121 FT /rpt_family="AT_rich" FT repeat_region 9238267..9238504 FT /rpt_family="L1" FT repeat_region 9238498..9239218 FT /rpt_family="L1" FT repeat_region 9239664..9239701 FT /rpt_family="AT_rich" FT repeat_region 9240981..9241031 FT /rpt_family="(TAGA)n" FT repeat_region 9241162..9241182 FT /rpt_family="AT_rich" FT repeat_region 9242151..9242178 FT /rpt_family="AT_rich" FT repeat_region 9242829..9243156 FT /rpt_family="Alu" FT repeat_region 9243652..9243842 FT /rpt_family="L1" FT repeat_region 9244023..9244202 FT /rpt_family="MIR" FT repeat_region 9244570..9245215 FT /rpt_family="ERV1" FT repeat_region 9245629..9246079 FT /rpt_family="ERV1" FT repeat_region 9246344..9246366 FT /rpt_family="(TG)n" FT repeat_region 9246991..9247023 FT /rpt_family="AT_rich" FT repeat_region 9247515..9247935 FT /rpt_family="MER2_type" FT repeat_region 9248300..9248373 FT /rpt_family="(TA)n" FT repeat_region 9248963..9249041 FT /rpt_family="MIR" FT repeat_region 9250633..9251198 FT /rpt_family="L1" FT repeat_region 9251199..9251273 FT /rpt_family="MaLR" FT repeat_region 9251274..9252035 FT /rpt_family="L1" FT repeat_region 9252045..9252140 FT /rpt_family="L2" FT repeat_region 9252783..9252803 FT /rpt_family="AT_rich" FT repeat_region 9253424..9253585 FT /rpt_family="MIR" FT repeat_region 9253718..9253741 FT /rpt_family="(TAGA)n" FT repeat_region 9253932..9254583 FT /rpt_family="L1" FT repeat_region 9254682..9254702 FT /rpt_family="AT_rich" FT repeat_region 9254717..9255183 FT /rpt_family="L1" FT repeat_region 9255397..9255417 FT /rpt_family="AT_rich" FT repeat_region 9256453..9256488 FT /rpt_family="AT_rich" FT repeat_region 9256968..9257032 FT /rpt_family="L2" FT repeat_region 9258091..9258176 FT /rpt_family="MER2_type" FT repeat_region 9258234..9258305 FT /rpt_family="MER2_type" FT repeat_region 9258276..9258329 FT /rpt_family="MER2_type" FT repeat_region 9258730..9259338 FT /rpt_family="L1" FT repeat_region 9259460..9259484 FT /rpt_family="AT_rich" FT repeat_region 9259739..9260043 FT /rpt_family="L1" FT repeat_region 9260044..9260357 FT /rpt_family="Alu" FT repeat_region 9260358..9260377 FT /rpt_family="L1" FT repeat_region 9261104..9261244 FT /rpt_family="ERVL" FT repeat_region 9261352..9261636 FT /rpt_family="ERVL" FT repeat_region 9261905..9261925 FT /rpt_family="AT_rich" FT repeat_region 9262062..9262856 FT /rpt_family="MER2_type" FT repeat_region 9262886..9262954 FT /rpt_family="L1" FT repeat_region 9262973..9263054 FT /rpt_family="L1" FT repeat_region 9262990..9263787 FT /rpt_family="L1" FT repeat_region 9263788..9264928 FT /rpt_family="MER2_type" FT repeat_region 9265537..9265559 FT /rpt_family="AT_rich" FT repeat_region 9266098..9266153 FT /rpt_family="L2" FT repeat_region 9266980..9267014 FT /rpt_family="AT_rich" FT repeat_region 9267074..9267808 FT /rpt_family="L1" FT repeat_region 9267813..9267967 FT /rpt_family="L1" FT repeat_region 9268156..9268308 FT /rpt_family="L1" FT repeat_region 9268319..9268721 FT /rpt_family="L1" FT repeat_region 9268800..9269131 FT /rpt_family="L1" FT repeat_region 9269180..9269337 FT /rpt_family="ERVL" FT repeat_region 9270236..9270322 FT /rpt_family="AT_rich" FT repeat_region 9270391..9270441 FT /rpt_family="AT_rich" FT repeat_region 9270753..9270777 FT /rpt_family="AT_rich" FT repeat_region 9271132..9271162 FT /rpt_family="(TAAA)n" FT repeat_region 9273016..9273090 FT /rpt_family="GA-rich" FT repeat_region 9273838..9273864 FT /rpt_family="AT_rich" FT repeat_region 9274239..9274326 FT /rpt_family="MIR" FT repeat_region 9274527..9274550 FT /rpt_family="AT_rich" FT repeat_region 9274999..9275105 FT /rpt_family="L2" FT repeat_region 9275391..9275874 FT /rpt_family="L2" FT repeat_region 9275973..9276119 FT /rpt_family="L2" FT repeat_region 9276255..9276279 FT /rpt_family="(CA)n" FT repeat_region 9276666..9277504 FT /rpt_family="L1" FT repeat_region 9277508..9277800 FT /rpt_family="Alu" FT repeat_region 9277845..9277893 FT /rpt_family="(CATATA)n" FT repeat_region 9277951..9278260 FT /rpt_family="Alu" FT repeat_region 9278373..9278511 FT /rpt_family="L1" FT repeat_region 9278843..9279217 FT /rpt_family="MaLR" FT repeat_region 9279580..9280126 FT /rpt_family="MER99" FT repeat_region 9280271..9280593 FT /rpt_family="Alu" FT repeat_region 9280658..9280967 FT /rpt_family="Alu" FT repeat_region 9281117..9281147 FT /rpt_family="AT_rich" FT repeat_region 9282891..9283026 FT /rpt_family="MIR" FT repeat_region 9283088..9283279 FT /rpt_family="MIR" FT repeat_region 9283766..9284157 FT /rpt_family="L2" FT repeat_region 9284598..9284658 FT /rpt_family="AcHobo" FT repeat_region 9284659..9285734 FT /rpt_family="L1" FT repeat_region 9285735..9285851 FT /rpt_family="AcHobo" FT repeat_region 9285856..9286691 FT /rpt_family="L2" FT repeat_region 9286751..9286794 FT /rpt_family="L2" FT repeat_region 9286797..9286824 FT /rpt_family="AT_rich" FT repeat_region 9287096..9288621 FT /rpt_family="L1" FT repeat_region 9288633..9289516 FT /rpt_family="L1" FT repeat_region 9289515..9289680 FT /rpt_family="L1" FT repeat_region 9289700..9289868 FT /rpt_family="L1" FT repeat_region 9289871..9290087 FT /rpt_family="L1" FT repeat_region 9295647..9295670 FT /rpt_family="(CAAAA)n" FT repeat_region 9296650..9297302 FT /rpt_family="L1" FT repeat_region 9297303..9297623 FT /rpt_family="Alu" FT misc_feature 9297306..9297589 FT /note="CpG_island (%GC=62.0, o/e=0.83, #CpGs=24)" FT repeat_region 9297624..9298673 FT /rpt_family="L1" FT repeat_region 9298932..9299132 FT /rpt_family="MER1_type" FT repeat_region 9299145..9299271 FT /rpt_family="L1" FT repeat_region 9299469..9299504 FT /rpt_family="(GA)n" FT repeat_region 9299562..9300894 FT /rpt_family="L1" FT repeat_region 9301126..9301444 FT /rpt_family="Alu" FT repeat_region 9302328..9302693 FT /rpt_family="MaLR" FT repeat_region 9302780..9302905 FT /rpt_family="MIR" FT repeat_region 9304454..9304475 FT /rpt_family="AT_rich" FT repeat_region 9306363..9306393 FT /rpt_family="MIR" FT repeat_region 9306394..9306458 FT /rpt_family="(TA)n" FT repeat_region 9306459..9306642 FT /rpt_family="MIR" FT repeat_region 9306943..9306990 FT /rpt_family="AT_rich" FT repeat_region 9307077..9307110 FT /rpt_family="(TA)n" FT repeat_region 9307553..9307579 FT /rpt_family="(TG)n" FT repeat_region 9307947..9307988 FT /rpt_family="AT_rich" FT repeat_region 9307989..9308302 FT /rpt_family="L1" FT repeat_region 9308328..9308350 FT /rpt_family="AT_rich" FT repeat_region 9308708..9308779 FT /rpt_family="L2" FT repeat_region 9309226..9309254 FT /rpt_family="AT_rich" FT repeat_region 9309313..9310423 FT /rpt_family="L2" FT repeat_region 9310549..9310791 FT /rpt_family="L2" FT repeat_region 9310793..9310940 FT /rpt_family="L2" FT repeat_region 9313393..9313688 FT /rpt_family="MER1_type" FT repeat_region 9314536..9314839 FT /rpt_family="Alu" FT misc_feature 9314562..9314836 FT /note="CpG_island (%GC=59.6, o/e=0.80, #CpGs=20)" FT repeat_region 9315089..9315117 FT /rpt_family="(TTTTG)n" FT repeat_region 9315175..9315476 FT /rpt_family="Alu" FT repeat_region 9315504..9315876 FT /rpt_family="L1" FT repeat_region 9315877..9315903 FT /rpt_family="(TTG)n" FT repeat_region 9315904..9316188 FT /rpt_family="Alu" FT repeat_region 9316189..9316900 FT /rpt_family="L1" FT repeat_region 9317741..9318145 FT /rpt_family="ERVL" FT repeat_region 9318179..9318356 FT /rpt_family="MIR" FT repeat_region 9318425..9318523 FT /rpt_family="MIR" FT repeat_region 9318609..9318907 FT /rpt_family="L2" FT repeat_region 9319031..9319239 FT /rpt_family="MIR" FT repeat_region 9319513..9320433 FT /rpt_family="AcHobo" FT repeat_region 9320451..9320530 FT /rpt_family="L2" FT repeat_region 9320763..9321039 FT /rpt_family="MaLR" FT repeat_region 9321179..9321551 FT /rpt_family="MaLR" FT repeat_region 9321625..9322045 FT /rpt_family="MaLR" FT repeat_region 9322332..9322360 FT /rpt_family="AT_rich" FT repeat_region 9322414..9322512 FT /rpt_family="(TA)n" FT repeat_region 9324031..9324067 FT /rpt_family="AT_rich" FT repeat_region 9324831..9324910 FT /rpt_family="(TATAG)n" FT repeat_region 9325295..9325352 FT /rpt_family="(TA)n" FT repeat_region 9325648..9325753 FT /rpt_family="MER1_type" FT repeat_region 9326255..9326326 FT /rpt_family="L2" FT repeat_region 9326292..9326413 FT /rpt_family="L2" FT repeat_region 9326589..9326783 FT /rpt_family="MER1_type" FT repeat_region 9326985..9329712 FT /rpt_family="L1" FT repeat_region 9329713..9329732 FT /rpt_family="(TA)n" FT repeat_region 9329733..9330288 FT /rpt_family="L1" FT repeat_region 9330493..9330515 FT /rpt_family="(CCA)n" FT repeat_region 9330821..9330864 FT /rpt_family="AT_rich" FT repeat_region 9332657..9332735 FT /rpt_family="AT_rich" FT repeat_region 9333025..9333167 FT /rpt_family="Alu" FT repeat_region 9334000..9334149 FT /rpt_family="MIR" FT repeat_region 9334171..9334530 FT /rpt_family="MaLR" FT repeat_region 9334570..9334703 FT /rpt_family="ERVL" FT repeat_region 9335284..9335419 FT /rpt_family="Alu" FT repeat_region 9335532..9335763 FT /rpt_family="ERV1" FT repeat_region 9335882..9336067 FT /rpt_family="ERV1" FT repeat_region 9336425..9336453 FT /rpt_family="AT_rich" FT repeat_region 9337056..9337349 FT /rpt_family="Alu" FT repeat_region 9338145..9338165 FT /rpt_family="AT_rich" FT repeat_region 9338496..9338533 FT /rpt_family="AT_rich" FT repeat_region 9338685..9338734 FT /rpt_family="AT_rich" FT repeat_region 9338921..9339182 FT /rpt_family="L1" FT repeat_region 9339183..9339487 FT /rpt_family="Alu" FT repeat_region 9339488..9339714 FT /rpt_family="L1" FT repeat_region 9339739..9339763 FT /rpt_family="AT_rich" FT repeat_region 9339955..9339980 FT /rpt_family="(CA)n" FT repeat_region 9340903..9340923 FT /rpt_family="AT_rich" FT repeat_region 9341211..9341312 FT /rpt_family="MER1_type" FT repeat_region 9341451..9342280 FT /rpt_family="MER2_type" FT repeat_region 9343535..9343577 FT /rpt_family="AT_rich" FT repeat_region 9343901..9343929 FT /rpt_family="AT_rich" FT repeat_region 9345275..9345297 FT /rpt_family="AT_rich" FT repeat_region 9346468..9346761 FT /rpt_family="Alu" FT repeat_region 9346813..9346846 FT /rpt_family="(CA)n" FT repeat_region 9347537..9347580 FT /rpt_family="AT_rich" FT repeat_region 9347670..9347725 FT /rpt_family="AT_rich" FT repeat_region 9348690..9348738 FT /rpt_family="AT_rich" FT repeat_region 9348739..9349421 FT /rpt_family="MER2_type" FT repeat_region 9349422..9350817 FT /rpt_family="L1" FT repeat_region 9350827..9354042 FT /rpt_family="L1" FT repeat_region 9354977..9355004 FT /rpt_family="AT_rich" FT repeat_region 9355807..9356045 FT /rpt_family="MIR" FT repeat_region 9356051..9356156 FT /rpt_family="CR1" FT repeat_region 9357073..9357148 FT /rpt_family="L2" FT repeat_region 9357551..9357973 FT /rpt_family="MaLR" FT repeat_region 9358243..9358427 FT /rpt_family="L2" FT repeat_region 9358903..9359025 FT /rpt_family="L2" FT repeat_region 9359457..9359901 FT /rpt_family="L2" FT repeat_region 9361622..9361927 FT /rpt_family="Alu" FT misc_feature 9361644..9361924 FT /note="CpG_island (%GC=61.9, o/e=0.82, #CpGs=23)" FT repeat_region 9361974..9362359 FT /rpt_family="ERVL" FT repeat_region 9362360..9362695 FT /rpt_family="L1" FT repeat_region 9362696..9363201 FT /rpt_family="ERVL" FT repeat_region 9365119..9365363 FT /rpt_family="L1" FT repeat_region 9365362..9365773 FT /rpt_family="L1" FT repeat_region 9365783..9366087 FT /rpt_family="L2" FT repeat_region 9366218..9366279 FT /rpt_family="L2" FT repeat_region 9366819..9366925 FT /rpt_family="MIR" FT repeat_region 9368541..9368648 FT /rpt_family="ERV1" FT repeat_region 9369349..9369664 FT /rpt_family="MaLR" FT repeat_region 9369756..9369980 FT /rpt_family="L1" FT repeat_region 9370404..9370431 FT /rpt_family="(TC)n" FT repeat_region 9370693..9371040 FT /rpt_family="L2" FT repeat_region 9371350..9371749 FT /rpt_family="ERVL" FT repeat_region 9371808..9371880 FT /rpt_family="(TA)n" FT repeat_region 9371950..9372030 FT /rpt_family="(TTATA)n" FT repeat_region 9372035..9372143 FT /rpt_family="(TA)n" FT repeat_region 9372148..9372177 FT /rpt_family="AT_rich" FT repeat_region 9372180..9372225 FT /rpt_family="ERVL" FT repeat_region 9372227..9372641 FT /rpt_family="ERVL" FT repeat_region 9372631..9372980 FT /rpt_family="ERVL" FT repeat_region 9375416..9375438 FT /rpt_family="(TA)n" FT repeat_region 9375439..9375936 FT /rpt_family="L1" FT repeat_region 9376104..9376180 FT /rpt_family="MER1_type" FT repeat_region 9376423..9376507 FT /rpt_family="L2" FT repeat_region 9377198..9377306 FT /rpt_family="CR1" FT repeat_region 9377325..9377633 FT /rpt_family="Alu" FT repeat_region 9377649..9377775 FT /rpt_family="(TA)n" FT repeat_region 9378044..9378094 FT /rpt_family="AT_rich" FT repeat_region 9378112..9378190 FT /rpt_family="GA-rich" FT repeat_region 9378374..9378523 FT /rpt_family="MIR" FT repeat_region 9378633..9379051 FT /rpt_family="L1" FT repeat_region 9379074..9380090 FT /rpt_family="L1" FT repeat_region 9380091..9380116 FT /rpt_family="(CA)n" FT repeat_region 9380117..9380942 FT /rpt_family="L1" FT repeat_region 9381032..9381503 FT /rpt_family="L1" FT repeat_region 9381504..9381709 FT /rpt_family="Alu" FT repeat_region 9381710..9381794 FT /rpt_family="L1" FT repeat_region 9381820..9382310 FT /rpt_family="MaLR" FT repeat_region 9382316..9382694 FT /rpt_family="L1" FT repeat_region 9382711..9382777 FT /rpt_family="L1" FT repeat_region 9382769..9382895 FT /rpt_family="L1" FT repeat_region 9383363..9383704 FT /rpt_family="MER2_type" FT repeat_region 9384448..9384470 FT /rpt_family="(T)n" FT repeat_region 9385510..9385584 FT /rpt_family="MIR" FT repeat_region 9385670..9385807 FT /rpt_family="Alu" FT repeat_region 9385808..9386100 FT /rpt_family="Alu" FT repeat_region 9387086..9387122 FT /rpt_family="L1" FT repeat_region 9387123..9387644 FT /rpt_family="ERV1" FT repeat_region 9388666..9388810 FT /rpt_family="L1" FT repeat_region 9390336..9390870 FT /rpt_family="MaLR" FT repeat_region 9391228..9391260 FT /rpt_family="AT_rich" FT repeat_region 9393035..9393485 FT /rpt_family="ERV1" FT repeat_region 9393486..9393865 FT /rpt_family="ERV1" FT repeat_region 9393864..9394080 FT /rpt_family="ERV1" FT repeat_region 9394082..9394741 FT /rpt_family="ERV1" FT repeat_region 9394745..9395249 FT /rpt_family="ERV1" FT repeat_region 9395240..9395389 FT /rpt_family="ERV1" FT repeat_region 9398387..9398837 FT /rpt_family="ERV1" FT repeat_region 9398983..9399019 FT /rpt_family="AT_rich" FT repeat_region 9399132..9399247 FT /rpt_family="AcHobo" FT repeat_region 9399282..9399707 FT /rpt_family="ERVL" FT repeat_region 9399749..9400361 FT /rpt_family="L1" FT repeat_region 9400373..9400851 FT /rpt_family="ERVL" FT repeat_region 9401327..9401371 FT /rpt_family="(TAAA)n" FT repeat_region 9402164..9402392 FT /rpt_family="Alu" FT repeat_region 9404026..9404271 FT /rpt_family="L1" FT repeat_region 9404436..9404542 FT /rpt_family="L1" FT repeat_region 9404567..9404657 FT /rpt_family="L1" FT repeat_region 9408151..9408171 FT /rpt_family="(TAAAA)n" FT repeat_region 9409083..9409474 FT /rpt_family="MaLR" FT unsure 9409467..9409481 FT /note="sequence derived from one plasmid subclone" FT repeat_region 9410318..9411302 FT /rpt_family="L1" FT repeat_region 9411305..9411328 FT /rpt_family="AT_rich" FT repeat_region 9411517..9411842 FT /rpt_family="Alu" FT repeat_region 9412555..9412738 FT /rpt_family="ERVL" FT repeat_region 9413234..9413339 FT /rpt_family="MIR" FT repeat_region 9414206..9414248 FT /rpt_family="AT_rich" FT repeat_region 9414342..9414844 FT /rpt_family="ERVL" FT repeat_region 9416427..9416454 FT /rpt_family="AT_rich" FT repeat_region 9417134..9417664 FT /rpt_family="L1" FT repeat_region 9418640..9418980 FT /rpt_family="MaLR" FT repeat_region 9419175..9419549 FT /rpt_family="L1" FT repeat_region 9420088..9420577 FT /rpt_family="L1" FT repeat_region 9420729..9420861 FT /rpt_family="L1" FT repeat_region 9420868..9421544 FT /rpt_family="L1" FT repeat_region 9421545..9421565 FT /rpt_family="(TTTTG)n" FT repeat_region 9421566..9421590 FT /rpt_family="L1" FT repeat_region 9421591..9421889 FT /rpt_family="Alu" FT repeat_region 9421890..9421924 FT /rpt_family="L1" FT repeat_region 9421957..9422086 FT /rpt_family="L1" FT repeat_region 9422089..9422338 FT /rpt_family="L1" FT repeat_region 9422340..9422592 FT /rpt_family="MaLR" FT repeat_region 9422601..9424308 FT /rpt_family="L1" FT repeat_region 9424309..9424716 FT /rpt_family="MaLR" FT repeat_region 9424717..9426009 FT /rpt_family="L1" FT repeat_region 9426015..9426775 FT /rpt_family="L1" FT repeat_region 9426773..9427667 FT /rpt_family="L1" FT repeat_region 9427668..9427968 FT /rpt_family="Alu" FT repeat_region 9427969..9428160 FT /rpt_family="L1" FT repeat_region 9428161..9428534 FT /rpt_family="MaLR" FT repeat_region 9428535..9429230 FT /rpt_family="L1" FT repeat_region 9429438..9429487 FT /rpt_family="G-rich" FT repeat_region 9429689..9429817 FT /rpt_family="L1" FT repeat_region 9429843..9429866 FT /rpt_family="AT_rich" FT repeat_region 9430110..9430413 FT /rpt_family="L1" FT repeat_region 9430419..9430824 FT /rpt_family="MaLR" FT repeat_region 9430946..9430975 FT /rpt_family="Alu" FT repeat_region 9430976..9431514 FT /rpt_family="ERV1" FT repeat_region 9431515..9431629 FT /rpt_family="Alu" FT repeat_region 9431633..9431833 FT /rpt_family="Alu" FT repeat_region 9431835..9432008 FT /rpt_family="L1" FT repeat_region 9432040..9432420 FT /rpt_family="L1" FT repeat_region 9432946..9432987 FT /rpt_family="AT_rich" FT repeat_region 9435161..9435213 FT /rpt_family="AT_rich" FT repeat_region 9435692..9435885 FT /rpt_family="MIR" FT repeat_region 9436308..9436330 FT /rpt_family="AT_rich" FT repeat_region 9438171..9438198 FT /rpt_family="AT_rich" FT misc_feature 9443972..9444276 FT /note="CpG_island (%GC=61.0, o/e=0.84, #CpGs=26)" FT repeat_region 9444721..9444743 FT /rpt_family="AT_rich" FT repeat_region 9445893..9445925 FT /rpt_family="AT_rich" FT repeat_region 9446428..9446520 FT /rpt_family="L2" FT repeat_region 9449024..9449102 FT /rpt_family="MER1_type" FT repeat_region 9449103..9449488 FT /rpt_family="MaLR" FT repeat_region 9449489..9449558 FT /rpt_family="MER1_type" FT repeat_region 9449562..9449842 FT /rpt_family="MER1_type" FT repeat_region 9450148..9450284 FT /rpt_family="L1" FT repeat_region 9450922..9450943 FT /rpt_family="(TTCTG)n" FT repeat_region 9453474..9453650 FT /rpt_family="L2" FT repeat_region 9453634..9453746 FT /rpt_family="L2" FT repeat_region 9453899..9453931 FT /rpt_family="AT_rich" FT repeat_region 9454591..9454630 FT /rpt_family="(TATATG)n" FT repeat_region 9454642..9454838 FT /rpt_family="MIR" FT repeat_region 9456874..9457163 FT /rpt_family="Alu" FT repeat_region 9457825..9457902 FT /rpt_family="L1" FT repeat_region 9457928..9458089 FT /rpt_family="(TA)n" FT repeat_region 9458121..9458974 FT /rpt_family="L1" FT repeat_region 9458975..9459285 FT /rpt_family="Alu" FT repeat_region 9459286..9460437 FT /rpt_family="L1" FT repeat_region 9460422..9460656 FT /rpt_family="L1" FT repeat_region 9460657..9461016 FT /rpt_family="MaLR" FT repeat_region 9461017..9461299 FT /rpt_family="L1" FT repeat_region 9461297..9461449 FT /rpt_family="L1" FT repeat_region 9461451..9461621 FT /rpt_family="Alu" FT repeat_region 9461642..9461720 FT /rpt_family="L1" FT repeat_region 9461733..9461766 FT /rpt_family="(CAAAA)n" FT repeat_region 9461770..9462749 FT /rpt_family="L1" FT repeat_region 9462750..9462788 FT /rpt_family="tRNA-Met" FT repeat_region 9462789..9462865 FT /rpt_family="L1" FT repeat_region 9462866..9463217 FT /rpt_family="MaLR" FT repeat_region 9464795..9465148 FT /rpt_family="MaLR" FT repeat_region 9465149..9465509 FT /rpt_family="L1" FT repeat_region 9465716..9465735 FT /rpt_family="(TTG)n" FT repeat_region 9466246..9466359 FT /rpt_family="L1" FT repeat_region 9466361..9466516 FT /rpt_family="ERV1" FT repeat_region 9466519..9467603 FT /rpt_family="L1" FT repeat_region 9467604..9469529 FT /rpt_family="L1" FT repeat_region 9469531..9470097 FT /rpt_family="ERV1" FT repeat_region 9470098..9470345 FT /rpt_family="L1" FT repeat_region 9470353..9470668 FT /rpt_family="Alu" FT repeat_region 9470669..9470709 FT /rpt_family="AT_rich" FT repeat_region 9470746..9470834 FT /rpt_family="CT-rich" FT repeat_region 9471091..9471116 FT /rpt_family="(TAAAAA)n" FT repeat_region 9471868..9471898 FT /rpt_family="AT_rich" FT repeat_region 9473114..9473298 FT /rpt_family="Alu" FT repeat_region 9474007..9474034 FT /rpt_family="AT_rich" FT repeat_region 9474428..9474571 FT /rpt_family="MER1_type" FT repeat_region 9474698..9474770 FT /rpt_family="ERVL" FT repeat_region 9474771..9474985 FT /rpt_family="MER1_type" FT repeat_region 9474990..9475096 FT /rpt_family="(TAGA)n" FT repeat_region 9475097..9475518 FT /rpt_family="ERVL" FT repeat_region 9475519..9475555 FT /rpt_family="(CATA)n" FT repeat_region 9475641..9476017 FT /rpt_family="L2" FT repeat_region 9482184..9482213 FT /rpt_family="AT_rich" FT repeat_region 9482607..9482828 FT /rpt_family="MaLR" FT repeat_region 9483505..9483759 FT /rpt_family="CR1" FT repeat_region 9484673..9484729 FT /rpt_family="AT_rich" FT repeat_region 9485413..9485443 FT /rpt_family="(GA)n" FT repeat_region 9485671..9485821 FT /rpt_family="AcHobo" FT repeat_region 9485830..9486071 FT /rpt_family="AcHobo" FT repeat_region 9486087..9486159 FT /rpt_family="Alu" FT repeat_region 9486160..9486296 FT /rpt_family="AcHobo" FT repeat_region 9486345..9486366 FT /rpt_family="AT_rich" FT repeat_region 9486646..9486668 FT /rpt_family="AT_rich" FT repeat_region 9486942..9487110 FT /rpt_family="MER1_type" FT repeat_region 9489769..9489789 FT /rpt_family="AT_rich" FT repeat_region 9489810..9489945 FT /rpt_family="L1" FT repeat_region 9491605..9491625 FT /rpt_family="AT_rich" FT repeat_region 9491642..9491941 FT /rpt_family="L1" FT repeat_region 9492183..9492508 FT /rpt_family="L1" FT repeat_region 9492563..9492672 FT /rpt_family="MER1_type" FT repeat_region 9493538..9493850 FT /rpt_family="Alu" FT repeat_region 9495973..9496279 FT /rpt_family="Alu" FT repeat_region 9497332..9497779 FT /rpt_family="ERV1" FT repeat_region 9497780..9498159 FT /rpt_family="ERV1" FT repeat_region 9498160..9498396 FT /rpt_family="ERV1" FT repeat_region 9503399..9503848 FT /rpt_family="ERV1" FT repeat_region 9503849..9505021 FT /rpt_family="L1" FT repeat_region 9505022..9505235 FT /rpt_family="MER1_type" FT repeat_region 9505236..9506116 FT /rpt_family="L1" FT repeat_region 9506145..9506175 FT /rpt_family="L1" FT repeat_region 9506176..9506476 FT /rpt_family="Alu" FT repeat_region 9506477..9507017 FT /rpt_family="L1" FT repeat_region 9507019..9507447 FT /rpt_family="ERV1" FT repeat_region 9507448..9507879 FT /rpt_family="ERV1" FT repeat_region 9507880..9508034 FT /rpt_family="ERV1" FT repeat_region 9508039..9508976 FT /rpt_family="L1" FT repeat_region 9508978..9509357 FT /rpt_family="MaLR" FT repeat_region 9509361..9510321 FT /rpt_family="MaLR" FT repeat_region 9510322..9510687 FT /rpt_family="ERV1" FT repeat_region 9510688..9511286 FT /rpt_family="MaLR" FT repeat_region 9511747..9511772 FT /rpt_family="AT_rich" FT repeat_region 9511800..9511831 FT /rpt_family="AT_rich" FT repeat_region 9512031..9512287 FT /rpt_family="L1" FT repeat_region 9512566..9512914 FT /rpt_family="MaLR" FT repeat_region 9513217..9514123 FT /rpt_family="L1" FT repeat_region 9514205..9514508 FT /rpt_family="Alu" FT repeat_region 9514794..9514839 FT /rpt_family="AT_rich" FT repeat_region 9519602..9519631 FT /rpt_family="AT_rich" FT repeat_region 9519932..9523468 FT /rpt_family="L1" FT repeat_region 9523467..9524182 FT /rpt_family="L1" FT repeat_region 9524183..9524454 FT /rpt_family="Alu" FT repeat_region 9524455..9524530 FT /rpt_family="L1" FT repeat_region 9524531..9524842 FT /rpt_family="Alu" FT repeat_region 9524843..9525267 FT /rpt_family="L1" FT repeat_region 9525278..9525881 FT /rpt_family="L1" FT repeat_region 9525879..9526108 FT /rpt_family="L1" FT repeat_region 9526310..9526347 FT /rpt_family="AT_rich" FT repeat_region 9526357..9526529 FT /rpt_family="MIR" FT repeat_region 9526945..9526971 FT /rpt_family="AT_rich" FT repeat_region 9527091..9527134 FT /rpt_family="(TG)n" FT repeat_region 9527205..9527415 FT /rpt_family="MaLR" FT repeat_region 9534005..9534345 FT /rpt_family="L1" FT repeat_region 9535639..9535877 FT /rpt_family="Alu" FT repeat_region 9536846..9536959 FT /rpt_family="L1" FT repeat_region 9537222..9537242 FT /rpt_family="AT_rich" FT repeat_region 9537568..9537623 FT /rpt_family="AT_rich" FT repeat_region 9537664..9537712 FT /rpt_family="CR1" FT repeat_region 9538382..9538427 FT /rpt_family="AT_rich" FT repeat_region 9538843..9538896 FT /rpt_family="AT_rich" FT repeat_region 9539182..9539519 FT /rpt_family="L2" FT repeat_region 9539520..9540026 FT /rpt_family="MaLR" FT repeat_region 9540027..9540131 FT /rpt_family="L2" FT repeat_region 9540253..9540547 FT /rpt_family="Alu" FT repeat_region 9540935..9541434 FT /rpt_family="L2" FT repeat_region 9541459..9541624 FT /rpt_family="AcHobo" FT repeat_region 9541709..9541745 FT /rpt_family="(CA)n" FT repeat_region 9542421..9542443 FT /rpt_family="AT_rich" FT repeat_region 9542675..9542956 FT /rpt_family="L1" FT repeat_region 9542957..9543417 FT /rpt_family="L1" FT repeat_region 9543867..9543928 FT /rpt_family="(TC)n" FT repeat_region 9543928..9543960 FT /rpt_family="(TA)n" FT repeat_region 9544591..9544702 FT /rpt_family="MER1_type" FT repeat_region 9545938..9546099 FT /rpt_family="L1" FT repeat_region 9546439..9546572 FT /rpt_family="L1" FT repeat_region 9546576..9546800 FT /rpt_family="L1" FT repeat_region 9546899..9547416 FT /rpt_family="MaLR" FT repeat_region 9549256..9551107 FT /rpt_family="L1" FT repeat_region 9551093..9552041 FT /rpt_family="L1" FT repeat_region 9552175..9552282 FT /rpt_family="AcHobo" FT repeat_region 9552285..9552880 FT /rpt_family="L1" FT repeat_region 9552881..9553214 FT /rpt_family="MER2_type" FT repeat_region 9553215..9553401 FT /rpt_family="L1" FT repeat_region 9553623..9553675 FT /rpt_family="MIR" FT repeat_region 9555842..9555876 FT /rpt_family="AT_rich" FT repeat_region 9556060..9556204 FT /rpt_family="MIR" FT repeat_region 9556545..9556851 FT /rpt_family="L2" FT repeat_region 9557565..9557844 FT /rpt_family="Alu" FT repeat_region 9558314..9558884 FT /rpt_family="L1" FT repeat_region 9558887..9560090 FT /rpt_family="L1" FT repeat_region 9560480..9560510 FT /rpt_family="(CA)n" FT repeat_region 9560724..9560755 FT /rpt_family="(A)n" FT repeat_region 9561130..9561152 FT /rpt_family="AT_rich" FT repeat_region 9561604..9561925 FT /rpt_family="Alu" FT repeat_region 9562184..9562344 FT /rpt_family="L1" FT repeat_region 9562495..9562584 FT /rpt_family="L1" FT repeat_region 9562609..9562642 FT /rpt_family="(TG)n" FT repeat_region 9562667..9562859 FT /rpt_family="L1" FT repeat_region 9563245..9563413 FT /rpt_family="(TA)n" FT repeat_region 9563414..9563442 FT /rpt_family="AT_rich" FT repeat_region 9563443..9564816 FT /rpt_family="L1" FT repeat_region 9564817..9564982 FT /rpt_family="(TA)n" FT repeat_region 9564994..9565161 FT /rpt_family="(TTATA)n" FT repeat_region 9565051..9565211 FT /rpt_family="(TA)n" FT repeat_region 9565275..9565439 FT /rpt_family="(TA)n" FT repeat_region 9566084..9566401 FT /rpt_family="L1" FT repeat_region 9566476..9566505 FT /rpt_family="(CATA)n" FT repeat_region 9566569..9566589 FT /rpt_family="(TA)n" FT repeat_region 9566785..9567181 FT /rpt_family="MaLR" FT repeat_region 9567249..9567464 FT /rpt_family="MER1_type" FT repeat_region 9567506..9567613 FT /rpt_family="L1" FT repeat_region 9568457..9568479 FT /rpt_family="L1" FT repeat_region 9568480..9568889 FT /rpt_family="MER2_type" FT repeat_region 9568890..9568928 FT /rpt_family="L1" FT repeat_region 9569223..9569348 FT /rpt_family="MaLR" FT repeat_region 9569645..9569666 FT /rpt_family="AT_rich" FT repeat_region 9570646..9570807 FT /rpt_family="Alu" FT repeat_region 9571257..9571368 FT /rpt_family="(TA)n" FT repeat_region 9571499..9571583 FT /rpt_family="Alu" FT repeat_region 9571596..9571934 FT /rpt_family="L1" FT repeat_region 9572291..9572938 FT /rpt_family="L1" FT repeat_region 9573123..9573434 FT /rpt_family="Alu" FT repeat_region 9573446..9573564 FT /rpt_family="L1" FT repeat_region 9573573..9576794 FT /rpt_family="L1" FT repeat_region 9577189..9577402 FT /rpt_family="L1" FT repeat_region 9577428..9577456 FT /rpt_family="AT_rich" FT repeat_region 9577457..9577500 FT /rpt_family="(TA)n" FT repeat_region 9579342..9579731 FT /rpt_family="MaLR" FT repeat_region 9579732..9581351 FT /rpt_family="MaLR" FT repeat_region 9581352..9581736 FT /rpt_family="MaLR" FT repeat_region 9581760..9581790 FT /rpt_family="AT_rich" FT repeat_region 9581855..9582213 FT /rpt_family="MaLR" FT repeat_region 9582375..9582761 FT /rpt_family="L2" FT repeat_region 9583192..9583807 FT /rpt_family="L1" FT repeat_region 9583834..9584094 FT /rpt_family="L1" FT repeat_region 9584116..9584254 FT /rpt_family="Alu" FT repeat_region 9584257..9586230 FT /rpt_family="L1" FT repeat_region 9586231..9586533 FT /rpt_family="Alu" FT repeat_region 9586534..9587205 FT /rpt_family="L1" FT repeat_region 9588008..9588230 FT /rpt_family="MER1_type" FT repeat_region 9588380..9588571 FT /rpt_family="L2" FT repeat_region 9589249..9589540 FT /rpt_family="Alu" FT repeat_region 9589653..9589965 FT /rpt_family="Alu" FT repeat_region 9590889..9590964 FT /rpt_family="AT_rich" FT repeat_region 9591060..9591135 FT /rpt_family="MIR" FT repeat_region 9591274..9591360 FT /rpt_family="L2" FT repeat_region 9592269..9592565 FT /rpt_family="Alu" FT repeat_region 9592851..9592889 FT /rpt_family="AT_rich" FT repeat_region 9593761..9594068 FT /rpt_family="MER1_type" FT repeat_region 9594069..9594423 FT /rpt_family="MaLR" FT repeat_region 9594424..9594462 FT /rpt_family="MER1_type" FT repeat_region 9594463..9594969 FT /rpt_family="L2" FT repeat_region 9594976..9595215 FT /rpt_family="MaLR" FT repeat_region 9595222..9595333 FT /rpt_family="MaLR" FT repeat_region 9595475..9595512 FT /rpt_family="AT_rich" FT repeat_region 9595837..9595942 FT /rpt_family="AcHobo" FT repeat_region 9595991..9596014 FT /rpt_family="(TG)n" FT repeat_region 9596065..9596403 FT /rpt_family="MaLR" FT repeat_region 9596477..9596505 FT /rpt_family="AT_rich" FT repeat_region 9596645..9596936 FT /rpt_family="L1" FT repeat_region 9598363..9598573 FT /rpt_family="MIR" FT repeat_region 9599847..9599926 FT /rpt_family="L1" FT repeat_region 9599932..9600138 FT /rpt_family="L1" FT repeat_region 9600211..9600817 FT /rpt_family="L1" FT repeat_region 9600820..9600852 FT /rpt_family="AT_rich" FT repeat_region 9600875..9601099 FT /rpt_family="Alu" FT repeat_region 9601100..9602602 FT /rpt_family="L1" FT repeat_region 9607559..9607994 FT /rpt_family="ERVL" FT repeat_region 9608440..9609013 FT /rpt_family="AcHobo" FT repeat_region 9609250..9609344 FT /rpt_family="(TA)n" FT repeat_region 9609591..9609806 FT /rpt_family="Alu" FT repeat_region 9609945..9610171 FT /rpt_family="MIR" FT repeat_region 9611074..9612565 FT /rpt_family="MER2_type" FT repeat_region 9612566..9613085 FT /rpt_family="L1" FT repeat_region 9613087..9613297 FT /rpt_family="L1" FT repeat_region 9613299..9614234 FT /rpt_family="MER2_type" FT repeat_region 9614663..9614790 FT /rpt_family="Alu" FT repeat_region 9614908..9614959 FT /rpt_family="CT-rich" FT repeat_region 9617781..9617807 FT /rpt_family="AT_rich" FT repeat_region 9617901..9618192 FT /rpt_family="MER1_type" FT repeat_region 9618429..9618915 FT /rpt_family="MER1_type" FT repeat_region 9619145..9619178 FT /rpt_family="AT_rich" FT repeat_region 9620965..9620998 FT /rpt_family="AT_rich" FT repeat_region 9621011..9621241 FT /rpt_family="L1" FT repeat_region 9621252..9621326 FT /rpt_family="(TATG)n" FT repeat_region 9621327..9621699 FT /rpt_family="MaLR" FT repeat_region 9621700..9621709 FT /rpt_family="(TATG)n" FT repeat_region 9622092..9622157 FT /rpt_family="(TA)n" FT repeat_region 9623617..9623649 FT /rpt_family="L1" FT repeat_region 9623651..9623732 FT /rpt_family="L1" FT repeat_region 9624126..9624319 FT /rpt_family="MER1_type" FT repeat_region 9625056..9625153 FT /rpt_family="MER1_type" FT repeat_region 9625256..9625567 FT /rpt_family="Alu" FT repeat_region 9626424..9626581 FT /rpt_family="MIR" FT repeat_region 9626572..9626989 FT /rpt_family="L2" FT repeat_region 9627133..9627365 FT /rpt_family="L1" FT repeat_region 9627366..9627560 FT /rpt_family="MER1_type" FT repeat_region 9627561..9627765 FT /rpt_family="L1" FT repeat_region 9628173..9630541 FT /rpt_family="L1" FT repeat_region 9630577..9630811 FT /rpt_family="L1" FT repeat_region 9630809..9632745 FT /rpt_family="L1" FT repeat_region 9633880..9634250 FT /rpt_family="MaLR" FT repeat_region 9634252..9634349 FT /rpt_family="Mariner" FT repeat_region 9634361..9634658 FT /rpt_family="MaLR" FT repeat_region 9634648..9635049 FT /rpt_family="L1" FT repeat_region 9635048..9635941 FT /rpt_family="L1" FT repeat_region 9635952..9635977 FT /rpt_family="(TAAA)n" FT repeat_region 9635978..9637150 FT /rpt_family="MaLR" FT repeat_region 9637153..9637285 FT /rpt_family="MaLR" FT repeat_region 9637341..9637606 FT /rpt_family="L1" FT repeat_region 9638158..9638845 FT /rpt_family="L1" FT repeat_region 9639127..9639193 FT /rpt_family="AcHobo" FT repeat_region 9639632..9639659 FT /rpt_family="AT_rich" FT repeat_region 9639692..9639841 FT /rpt_family="L2" FT repeat_region 9639856..9639882 FT /rpt_family="AT_rich" FT repeat_region 9639973..9640982 FT /rpt_family="L1" FT repeat_region 9641010..9641068 FT /rpt_family="L2" FT repeat_region 9641175..9641496 FT /rpt_family="MER2_type" FT repeat_region 9641882..9641914 FT /rpt_family="(TA)n" FT repeat_region 9641931..9641955 FT /rpt_family="(CA)n" FT repeat_region 9642154..9642184 FT /rpt_family="AT_rich" FT repeat_region 9642199..9642559 FT /rpt_family="MaLR" FT repeat_region 9644130..9644442 FT /rpt_family="Alu" FT repeat_region 9644732..9644885 FT /rpt_family="L1" FT repeat_region 9644886..9644926 FT /rpt_family="(TG)n" FT repeat_region 9644927..9644997 FT /rpt_family="L1" FT repeat_region 9644999..9645052 FT /rpt_family="L1" FT repeat_region 9645180..9645487 FT /rpt_family="L1" FT repeat_region 9645783..9645840 FT /rpt_family="L1" FT repeat_region 9645834..9645892 FT /rpt_family="L1" FT repeat_region 9645980..9647301 FT /rpt_family="L1" FT repeat_region 9647294..9647929 FT /rpt_family="L1" FT repeat_region 9647930..9648113 FT /rpt_family="(TA)n" FT repeat_region 9648114..9648319 FT /rpt_family="L1" FT repeat_region 9649968..9650012 FT /rpt_family="AT_rich" FT repeat_region 9650240..9650410 FT /rpt_family="MaLR" FT repeat_region 9651140..9651166 FT /rpt_family="(TG)n" FT repeat_region 9651326..9651646 FT /rpt_family="AcHobo" FT repeat_region 9652965..9653037 FT /rpt_family="MIR" FT repeat_region 9653205..9653320 FT /rpt_family="MIR" FT repeat_region 9653578..9654340 FT /rpt_family="L1" FT repeat_region 9655820..9655850 FT /rpt_family="(A)n" FT repeat_region 9656042..9656076 FT /rpt_family="AT_rich" FT repeat_region 9656228..9657380 FT /rpt_family="MER2_type" FT repeat_region 9658122..9658164 FT /rpt_family="(TA)n" FT repeat_region 9658173..9658208 FT /rpt_family="L2" FT repeat_region 9658215..9658400 FT /rpt_family="MaLR" FT repeat_region 9658636..9658677 FT /rpt_family="Mariner" FT repeat_region 9659483..9659504 FT /rpt_family="AT_rich" FT repeat_region 9660243..9661639 FT /rpt_family="ERV1" FT misc_feature 9661061..9661450 FT /note="CpG_island (%GC=74.9, o/e=0.67, #CpGs=41)" FT repeat_region 9661789..9661813 FT /rpt_family="(CA)n" FT repeat_region 9662268..9662439 FT /rpt_family="L1" FT repeat_region 9662470..9662781 FT /rpt_family="L1" FT repeat_region 9663433..9663562 FT /rpt_family="L1" FT repeat_region 9663844..9663896 FT /rpt_family="AT_rich" FT repeat_region 9663934..9664349 FT /rpt_family="L2" FT repeat_region 9664350..9664643 FT /rpt_family="Alu" FT repeat_region 9664644..9664800 FT /rpt_family="L2" FT repeat_region 9664823..9665116 FT /rpt_family="Alu" FT repeat_region 9665238..9665539 FT /rpt_family="L2" FT repeat_region 9665540..9665829 FT /rpt_family="MaLR" FT repeat_region 9665834..9665977 FT /rpt_family="L2" FT repeat_region 9666989..9667131 FT /rpt_family="L2" FT repeat_region 9667808..9667920 FT /rpt_family="MIR" FT repeat_region 9668161..9668537 FT /rpt_family="MaLR" FT repeat_region 9669404..9669619 FT /rpt_family="MIR" FT repeat_region 9670945..9671115 FT /rpt_family="L1" FT repeat_region 9671521..9671701 FT /rpt_family="MER1_type" FT repeat_region 9671706..9672043 FT /rpt_family="L1" FT repeat_region 9672104..9672238 FT /rpt_family="L2" FT repeat_region 9672542..9672831 FT /rpt_family="L1" FT repeat_region 9673017..9673302 FT /rpt_family="L2" FT repeat_region 9674418..9674962 FT /rpt_family="MER2_type" FT repeat_region 9675328..9675507 FT /rpt_family="L1" FT repeat_region 9676295..9676606 FT /rpt_family="CR1" FT repeat_region 9676758..9678702 FT /rpt_family="L1" FT repeat_region 9679046..9679177 FT /rpt_family="Alu" FT repeat_region 9679473..9679906 FT /rpt_family="L1" FT repeat_region 9680310..9680406 FT /rpt_family="GA-rich" FT repeat_region 9680631..9680901 FT /rpt_family="L1" FT repeat_region 9681764..9681785 FT /rpt_family="AT_rich" FT repeat_region 9682167..9682649 FT /rpt_family="ERV1" FT repeat_region 9683093..9683202 FT /rpt_family="MER1_type" FT repeat_region 9683204..9683321 FT /rpt_family="L1" FT repeat_region 9684687..9684876 FT /rpt_family="MER1_type" FT repeat_region 9684921..9684992 FT /rpt_family="MIR" FT repeat_region 9686344..9686551 FT /rpt_family="MIR" FT repeat_region 9687405..9687735 FT /rpt_family="L1" FT repeat_region 9687780..9687880 FT /rpt_family="(TTTA)n" FT repeat_region 9688033..9688058 FT /rpt_family="AT_rich" FT repeat_region 9688213..9688358 FT /rpt_family="L1" FT repeat_region 9688423..9688450 FT /rpt_family="AT_rich" FT repeat_region 9689094..9689118 FT /rpt_family="AT_rich" FT repeat_region 9689547..9689957 FT /rpt_family="MaLR" FT repeat_region 9689994..9690018 FT /rpt_family="(TA)n" FT repeat_region 9690043..9690128 FT /rpt_family="Alu" FT repeat_region 9690162..9690358 FT /rpt_family="Alu" FT repeat_region 9690573..9690598 FT /rpt_family="(TTTA)n" FT repeat_region 9690599..9691142 FT /rpt_family="L1" FT repeat_region 9691143..9691798 FT /rpt_family="L1" FT repeat_region 9691799..9692097 FT /rpt_family="Alu" FT repeat_region 9692098..9692330 FT /rpt_family="L1" FT repeat_region 9692401..9692522 FT /rpt_family="MIR" FT repeat_region 9692547..9693210 FT /rpt_family="L1" FT repeat_region 9693211..9693233 FT /rpt_family="(TA)n" FT repeat_region 9693237..9693276 FT /rpt_family="Alu" FT repeat_region 9693277..9693466 FT /rpt_family="Alu" FT repeat_region 9693478..9693562 FT /rpt_family="AT_rich" FT repeat_region 9693710..9693876 FT /rpt_family="L1" FT repeat_region 9693872..9694386 FT /rpt_family="L1" FT repeat_region 9695020..9695045 FT /rpt_family="AT_rich" FT repeat_region 9695046..9695411 FT /rpt_family="L1" FT repeat_region 9695412..9695729 FT /rpt_family="Alu" FT repeat_region 9695730..9696431 FT /rpt_family="L1" FT repeat_region 9696433..9697019 FT /rpt_family="L1" FT repeat_region 9697059..9697204 FT /rpt_family="ERVL" FT repeat_region 9697205..9697363 FT /rpt_family="L1" FT repeat_region 9697375..9697429 FT /rpt_family="AT_rich" FT repeat_region 9697559..9698442 FT /rpt_family="L1" FT repeat_region 9698564..9698722 FT /rpt_family="L1" FT repeat_region 9698721..9699871 FT /rpt_family="L1" FT repeat_region 9700042..9700112 FT /rpt_family="AT_rich" FT repeat_region 9702193..9702373 FT /rpt_family="ERVL" FT repeat_region 9702608..9702772 FT /rpt_family="Alu" FT repeat_region 9702837..9703107 FT /rpt_family="Alu" FT repeat_region 9703209..9703535 FT /rpt_family="ERV1" FT repeat_region 9707611..9707911 FT /rpt_family="Alu" FT repeat_region 9708325..9708553 FT /rpt_family="MER1_type" FT repeat_region 9708679..9708898 FT /rpt_family="MIR" FT repeat_region 9708956..9709256 FT /rpt_family="L1" FT repeat_region 9709473..9709783 FT /rpt_family="MER2_type" FT repeat_region 9709784..9709805 FT /rpt_family="(GGA)n" FT repeat_region 9709806..9709969 FT /rpt_family="MER2_type" FT repeat_region 9710204..9710496 FT /rpt_family="Alu" FT repeat_region 9710514..9710740 FT /rpt_family="Alu" FT repeat_region 9711037..9711318 FT /rpt_family="Alu" FT repeat_region 9712565..9712588 FT /rpt_family="AT_rich" FT repeat_region 9713963..9714327 FT /rpt_family="MaLR" FT repeat_region 9715484..9715660 FT /rpt_family="L2" FT repeat_region 9716248..9716413 FT /rpt_family="MER1_type" FT repeat_region 9716574..9716634 FT /rpt_family="(TA)n" FT repeat_region 9716741..9716850 FT /rpt_family="L1" FT repeat_region 9717072..9717120 FT /rpt_family="ERV1" FT repeat_region 9717121..9717402 FT /rpt_family="MaLR" FT repeat_region 9717946..9718076 FT /rpt_family="AcHobo" FT repeat_region 9718081..9718401 FT /rpt_family="MaLR" FT repeat_region 9718412..9718624 FT /rpt_family="MER1_type" FT repeat_region 9718992..9719127 FT /rpt_family="L1" FT repeat_region 9719129..9719385 FT /rpt_family="L1" FT repeat_region 9719494..9719918 FT /rpt_family="MaLR" FT repeat_region 9721271..9721320 FT /rpt_family="(TAGA)n" FT repeat_region 9721661..9721793 FT /rpt_family="ERV1" FT repeat_region 9721793..9721839 FT /rpt_family="ERV1" FT repeat_region 9722103..9722453 FT /rpt_family="MaLR" FT repeat_region 9722528..9722831 FT /rpt_family="Alu" FT repeat_region 9723698..9723847 FT /rpt_family="MaLR" FT repeat_region 9724133..9724153 FT /rpt_family="AT_rich" FT repeat_region 9724755..9725056 FT /rpt_family="Alu" FT repeat_region 9725261..9725368 FT /rpt_family="L2" FT repeat_region 9725785..9727519 FT /rpt_family="L1" FT repeat_region 9727520..9727540 FT /rpt_family="(TTTTA)n" FT repeat_region 9727541..9727870 FT /rpt_family="L1" FT repeat_region 9727871..9728289 FT /rpt_family="MaLR" FT repeat_region 9728290..9729356 FT /rpt_family="L1" FT repeat_region 9729366..9729427 FT /rpt_family="L1" FT repeat_region 9729430..9729454 FT /rpt_family="AT_rich" FT repeat_region 9729485..9729782 FT /rpt_family="Alu" FT repeat_region 9729789..9730412 FT /rpt_family="L1" FT repeat_region 9730414..9730763 FT /rpt_family="L1" FT repeat_region 9730750..9730891 FT /rpt_family="L1" FT repeat_region 9730895..9732550 FT /rpt_family="L1" FT repeat_region 9732623..9732972 FT /rpt_family="L1" FT repeat_region 9733099..9733393 FT /rpt_family="L1" FT repeat_region 9733473..9734120 FT /rpt_family="L1" FT repeat_region 9734419..9734510 FT /rpt_family="MIR" FT repeat_region 9734645..9734811 FT /rpt_family="MIR" FT repeat_region 9736822..9737387 FT /rpt_family="MaLR" FT repeat_region 9737487..9737620 FT /rpt_family="L2" FT repeat_region 9737650..9737949 FT /rpt_family="Alu" FT repeat_region 9738828..9739282 FT /rpt_family="MaLR" FT repeat_region 9739636..9739680 FT /rpt_family="(TAAA)n" FT repeat_region 9739712..9739745 FT /rpt_family="AT_rich" FT repeat_region 9740741..9742280 FT /rpt_family="L1" FT repeat_region 9742285..9742428 FT /rpt_family="(TA)n" FT repeat_region 9742430..9742800 FT /rpt_family="L1" FT repeat_region 9742963..9743104 FT /rpt_family="(TA)n" FT repeat_region 9743151..9743172 FT /rpt_family="AT_rich" FT repeat_region 9744938..9745269 FT /rpt_family="MER2_type" FT repeat_region 9745360..9745391 FT /rpt_family="AT_rich" FT repeat_region 9745448..9745474 FT /rpt_family="AT_rich" FT repeat_region 9745578..9745887 FT /rpt_family="Alu" FT repeat_region 9748562..9748585 FT /rpt_family="AT_rich" FT repeat_region 9749772..9749931 FT /rpt_family="MIR" FT repeat_region 9750013..9750161 FT /rpt_family="MER1_type" FT repeat_region 9750430..9750538 FT /rpt_family="MIR" FT repeat_region 9751715..9751736 FT /rpt_family="AT_rich" FT repeat_region 9751845..9751877 FT /rpt_family="AT_rich" FT repeat_region 9751885..9751927 FT /rpt_family="Mariner" FT repeat_region 9752427..9752670 FT /rpt_family="MIR" FT repeat_region 9752773..9753101 FT /rpt_family="Alu" FT repeat_region 9754042..9754122 FT /rpt_family="L2" FT repeat_region 9754434..9754572 FT /rpt_family="MIR" FT repeat_region 9754971..9755022 FT /rpt_family="MaLR" FT repeat_region 9755023..9755080 FT /rpt_family="(CA)n" FT repeat_region 9755081..9755578 FT /rpt_family="MaLR" FT repeat_region 9756208..9756272 FT /rpt_family="AcHobo" FT repeat_region 9756696..9757085 FT /rpt_family="AcHobo" FT repeat_region 9757188..9757500 FT /rpt_family="Alu" FT misc_feature 9757191..9757471 FT /note="CpG_island (%GC=61.9, o/e=0.89, #CpGs=25)" FT repeat_region 9758546..9758778 FT /rpt_family="Alu" FT repeat_region 9759171..9759228 FT /rpt_family="MIR" FT repeat_region 9759434..9759487 FT /rpt_family="GA-rich" FT repeat_region 9760210..9760718 FT /rpt_family="L1" FT repeat_region 9760726..9760754 FT /rpt_family="(TG)n" FT repeat_region 9760797..9761125 FT /rpt_family="Alu" FT misc_feature 9760804..9761034 FT /note="CpG_island (%GC=58.9, o/e=0.77, #CpGs=17)" FT repeat_region 9761443..9761482 FT /rpt_family="(TTTTA)n" FT repeat_region 9761483..9762356 FT /rpt_family="L1" FT repeat_region 9762352..9762853 FT /rpt_family="L1" FT repeat_region 9763722..9763854 FT /rpt_family="L2" FT repeat_region 9764065..9764101 FT /rpt_family="MIR" FT repeat_region 9765083..9765147 FT /rpt_family="(TA)n" FT repeat_region 9765149..9765170 FT /rpt_family="AT_rich" FT misc_feature 9765662..9766215 FT /note="CpG_island (%GC=72.0, o/e=0.74, #CpGs=57)" FT repeat_region 9765766..9765857 FT /rpt_family="GC_rich" FT repeat_region 9768009..9768315 FT /rpt_family="Alu" FT repeat_region 9768588..9768688 FT /rpt_family="Alu" FT repeat_region 9768720..9768860 FT /rpt_family="Alu" FT repeat_region 9768872..9769180 FT /rpt_family="Alu" FT repeat_region 9769366..9769645 FT /rpt_family="Alu" FT repeat_region 9769650..9769690 FT /rpt_family="(TAAA)n" FT repeat_region 9770158..9770245 FT /rpt_family="MER103" FT repeat_region 9770628..9770765 FT /rpt_family="CR1" FT repeat_region 9771124..9771323 FT /rpt_family="MIR" FT repeat_region 9772042..9772070 FT /rpt_family="(TTCA)n" FT repeat_region 9772071..9772370 FT /rpt_family="Alu" FT repeat_region 9772377..9772485 FT /rpt_family="L2" FT repeat_region 9772518..9772630 FT /rpt_family="L2" FT repeat_region 9774937..9775138 FT /rpt_family="MER53" FT repeat_region 9775295..9775424 FT /rpt_family="MaLR" FT repeat_region 9775432..9775669 FT /rpt_family="MaLR" FT repeat_region 9776103..9776136 FT /rpt_family="(A)n" FT repeat_region 9776674..9776756 FT /rpt_family="MaLR" FT repeat_region 9776759..9776865 FT /rpt_family="MaLR" FT repeat_region 9777950..9777970 FT /rpt_family="AT_rich" FT repeat_region 9778006..9779657 FT /rpt_family="L1" FT repeat_region 9779658..9780335 FT /rpt_family="L1" FT repeat_region 9780336..9780510 FT /rpt_family="MER1_type" FT repeat_region 9782265..9782758 FT /rpt_family="ERV1" FT repeat_region 9784921..9784980 FT /rpt_family="AT_rich" FT repeat_region 9785785..9787482 FT /rpt_family="L1" FT repeat_region 9787521..9787562 FT /rpt_family="MIR" FT repeat_region 9787801..9789719 FT /rpt_family="L1" FT repeat_region 9791815..9792060 FT /rpt_family="L1" FT repeat_region 9792061..9792086 FT /rpt_family="(CA)n" FT repeat_region 9792087..9793712 FT /rpt_family="L1" FT repeat_region 9793713..9794078 FT /rpt_family="MaLR" FT repeat_region 9794079..9795047 FT /rpt_family="L1" FT repeat_region 9795104..9795248 FT /rpt_family="MIR" FT repeat_region 9795415..9795460 FT /rpt_family="AT_rich" FT repeat_region 9795949..9796072 FT /rpt_family="T-rich" FT repeat_region 9796467..9796495 FT /rpt_family="AT_rich" FT repeat_region 9798134..9798497 FT /rpt_family="ERV1" FT repeat_region 9798791..9798987 FT /rpt_family="ERV1" FT repeat_region 9799471..9799691 FT /rpt_family="MIR" FT repeat_region 9799717..9799742 FT /rpt_family="(A)n" FT repeat_region 9799743..9799876 FT /rpt_family="MER1_type" FT repeat_region 9799919..9799941 FT /rpt_family="AT_rich" FT repeat_region 9800451..9800603 FT /rpt_family="MER1_type" FT repeat_region 9800704..9801221 FT /rpt_family="ERV1" FT repeat_region 9801274..9801336 FT /rpt_family="MER1_type" FT repeat_region 9801422..9801597 FT /rpt_family="(TA)n" FT repeat_region 9801616..9802353 FT /rpt_family="(TA)n" FT repeat_region 9802361..9802411 FT /rpt_family="AT_rich" FT repeat_region 9802426..9802491 FT /rpt_family="(TA)n" FT repeat_region 9802498..9802520 FT /rpt_family="AT_rich" FT repeat_region 9802531..9802663 FT /rpt_family="(TA)n" FT repeat_region 9802683..9802863 FT /rpt_family="(TA)n" FT repeat_region 9802912..9803091 FT /rpt_family="(TA)n" FT repeat_region 9803146..9803328 FT /rpt_family="(TA)n" FT repeat_region 9803353..9803531 FT /rpt_family="(TA)n" FT repeat_region 9803553..9803736 FT /rpt_family="(TA)n" FT repeat_region 9803783..9804095 FT /rpt_family="(TA)n" FT repeat_region 9804097..9804206 FT /rpt_family="L1" FT repeat_region 9804216..9804710 FT /rpt_family="(TA)n" FT repeat_region 9804731..9804857 FT /rpt_family="(TA)n" FT repeat_region 9804885..9805053 FT /rpt_family="(TA)n" FT repeat_region 9805055..9805078 FT /rpt_family="AT_rich" FT repeat_region 9805079..9805249 FT /rpt_family="(TA)n" FT repeat_region 9805256..9805452 FT /rpt_family="ERVL" FT repeat_region 9805825..9806327 FT /rpt_family="ERV1" FT repeat_region 9806334..9806387 FT /rpt_family="AT_rich" FT repeat_region 9807451..9807480 FT /rpt_family="AT_rich" FT repeat_region 9808028..9808368 FT /rpt_family="MaLR" FT repeat_region 9808656..9808707 FT /rpt_family="(CA)n" FT repeat_region 9811923..9812339 FT /rpt_family="L1" FT repeat_region 9812369..9814552 FT /rpt_family="L1" FT repeat_region 9815609..9815656 FT /rpt_family="AT_rich" FT repeat_region 9815717..9815863 FT /rpt_family="MIR" FT repeat_region 9817459..9817734 FT /rpt_family="ERVL" FT repeat_region 9817766..9818042 FT /rpt_family="MaLR" FT repeat_region 9818043..9818891 FT /rpt_family="ERV1" FT repeat_region 9818892..9818918 FT /rpt_family="MaLR" FT repeat_region 9818943..9819369 FT /rpt_family="ERVL" FT repeat_region 9819460..9819480 FT /rpt_family="(TAAAA)n" FT repeat_region 9819558..9819682 FT /rpt_family="MIR" FT repeat_region 9819889..9820356 FT /rpt_family="MaLR" FT repeat_region 9820470..9820639 FT /rpt_family="MIR" FT repeat_region 9821172..9821355 FT /rpt_family="ERVL" FT repeat_region 9821361..9821531 FT /rpt_family="ERVL" FT repeat_region 9821794..9821934 FT /rpt_family="L1" FT repeat_region 9822269..9822380 FT /rpt_family="L1" FT repeat_region 9822433..9822469 FT /rpt_family="AT_rich" FT repeat_region 9822914..9823223 FT /rpt_family="Alu" FT repeat_region 9823491..9823610 FT /rpt_family="MER1_type" FT repeat_region 9825129..9825308 FT /rpt_family="L1" FT repeat_region 9825309..9825640 FT /rpt_family="MER2_type" FT repeat_region 9825641..9825876 FT /rpt_family="L1" FT repeat_region 9825877..9826496 FT /rpt_family="ERVL" FT repeat_region 9826497..9826881 FT /rpt_family="MaLR" FT repeat_region 9826882..9827893 FT /rpt_family="MaLR" FT repeat_region 9827894..9828116 FT /rpt_family="MaLR" FT repeat_region 9828117..9828413 FT /rpt_family="Alu" FT repeat_region 9828414..9828602 FT /rpt_family="MaLR" FT repeat_region 9828603..9828688 FT /rpt_family="ERVL" FT repeat_region 9828689..9828738 FT /rpt_family="L1" FT repeat_region 9830684..9830807 FT /rpt_family="L2" FT repeat_region 9830909..9830950 FT /rpt_family="(TG)n" FT repeat_region 9831266..9831290 FT /rpt_family="AT_rich" FT repeat_region 9831337..9831772 FT /rpt_family="MaLR" FT repeat_region 9831773..9831796 FT /rpt_family="AT_rich" FT repeat_region 9832789..9832963 FT /rpt_family="(TATAA)n" FT repeat_region 9832998..9833367 FT /rpt_family="MaLR" FT repeat_region 9833831..9833962 FT /rpt_family="L2" FT repeat_region 9834008..9834317 FT /rpt_family="MaLR" FT repeat_region 9834318..9834691 FT /rpt_family="MaLR" FT repeat_region 9834692..9834872 FT /rpt_family="MaLR" FT repeat_region 9834931..9835005 FT /rpt_family="L2" FT repeat_region 9836425..9836689 FT /rpt_family="L1" FT repeat_region 9837146..9837194 FT /rpt_family="(TA)n" FT repeat_region 9837416..9837575 FT /rpt_family="Alu" FT repeat_region 9837712..9837846 FT /rpt_family="L1" FT repeat_region 9837784..9837846 FT /rpt_family="L1" FT repeat_region 9837847..9838091 FT /rpt_family="Alu" FT repeat_region 9838096..9838527 FT /rpt_family="L1" FT repeat_region 9838528..9838823 FT /rpt_family="Alu" FT repeat_region 9838824..9838974 FT /rpt_family="L1" FT repeat_region 9839016..9839710 FT /rpt_family="L1" FT repeat_region 9840330..9840475 FT /rpt_family="L1" FT repeat_region 9840476..9840522 FT /rpt_family="(TG)n" FT repeat_region 9840523..9840588 FT /rpt_family="L1" FT repeat_region 9840592..9841985 FT /rpt_family="L1" FT repeat_region 9841995..9842050 FT /rpt_family="AT_rich" FT repeat_region 9842905..9842965 FT /rpt_family="(TAG)n" FT repeat_region 9842989..9843165 FT /rpt_family="MIR" FT repeat_region 9843239..9843272 FT /rpt_family="AT_rich" FT repeat_region 9843454..9844222 FT /rpt_family="L1" FT repeat_region 9844223..9844296 FT /rpt_family="MER1_type" FT repeat_region 9844314..9845451 FT /rpt_family="L1" FT repeat_region 9847484..9847643 FT /rpt_family="L2" FT repeat_region 9847873..9849008 FT /rpt_family="L1" FT repeat_region 9849009..9849436 FT /rpt_family="L1" FT repeat_region 9850080..9850117 FT /rpt_family="AT_rich" FT repeat_region 9850387..9850665 FT /rpt_family="Alu" FT repeat_region 9850784..9851139 FT /rpt_family="MaLR" FT repeat_region 9851420..9851696 FT /rpt_family="Alu" FT repeat_region 9852921..9853460 FT /rpt_family="L1" FT repeat_region 9853463..9853500 FT /rpt_family="(CATA)n" FT repeat_region 9853644..9853756 FT /rpt_family="L1" FT repeat_region 9853767..9853794 FT /rpt_family="AT_rich" FT repeat_region 9854613..9854640 FT /rpt_family="AT_rich" FT repeat_region 9855633..9855672 FT /rpt_family="ERVL" FT repeat_region 9855673..9855748 FT /rpt_family="(TAGA)n" FT repeat_region 9855749..9856142 FT /rpt_family="ERVL" FT repeat_region 9856143..9857064 FT /rpt_family="ERVL" FT repeat_region 9859277..9859368 FT /rpt_family="MaLR" FT repeat_region 9859843..9859864 FT /rpt_family="AT_rich" FT repeat_region 9861073..9861124 FT /rpt_family="GA-rich" FT repeat_region 9861593..9862826 FT /rpt_family="ERV1" FT repeat_region 9863954..9864080 FT /rpt_family="L1" FT repeat_region 9865042..9865357 FT /rpt_family="Alu" FT repeat_region 9866420..9866718 FT /rpt_family="Alu" FT repeat_region 9868393..9868713 FT /rpt_family="L1" FT repeat_region 9868735..9869200 FT /rpt_family="L1" FT repeat_region 9869250..9870096 FT /rpt_family="L1" FT repeat_region 9872729..9874523 FT /rpt_family="AcHobo" FT repeat_region 9874524..9874653 FT /rpt_family="MaLR" FT repeat_region 9874612..9875022 FT /rpt_family="AcHobo" FT repeat_region 9875399..9875420 FT /rpt_family="AT_rich" FT repeat_region 9875505..9875687 FT /rpt_family="MER1_type" FT repeat_region 9876794..9877294 FT /rpt_family="MaLR" FT repeat_region 9877507..9877662 FT /rpt_family="MIR" FT repeat_region 9877797..9878018 FT /rpt_family="MER1_type" FT repeat_region 9879776..9879868 FT /rpt_family="MIR" FT repeat_region 9880067..9880221 FT /rpt_family="(TA)n" FT repeat_region 9880366..9880713 FT /rpt_family="MaLR" FT repeat_region 9881694..9881718 FT /rpt_family="(TTTC)n" FT repeat_region 9882778..9882800 FT /rpt_family="(TAAAA)n" FT repeat_region 9882896..9883008 FT /rpt_family="L1" FT repeat_region 9883108..9883132 FT /rpt_family="(TA)n" FT repeat_region 9883322..9884551 FT /rpt_family="L1" FT repeat_region 9884558..9884857 FT /rpt_family="Alu" FT repeat_region 9884877..9885204 FT /rpt_family="Alu" FT repeat_region 9885818..9886129 FT /rpt_family="Alu" FT repeat_region 9886337..9886406 FT /rpt_family="(TA)n" FT repeat_region 9886576..9886598 FT /rpt_family="(CA)n" FT repeat_region 9887766..9887793 FT /rpt_family="AT_rich" FT repeat_region 9888032..9888101 FT /rpt_family="AT_rich" FT repeat_region 9888444..9888521 FT /rpt_family="AT_rich" FT repeat_region 9888673..9888716 FT /rpt_family="AT_rich" FT repeat_region 9889220..9889241 FT /rpt_family="AT_rich" FT repeat_region 9889877..9889963 FT /rpt_family="AT_rich" FT repeat_region 9890049..9890354 FT /rpt_family="Alu" FT repeat_region 9890358..9890517 FT /rpt_family="(GGGGA)n" FT repeat_region 9891169..9891898 FT /rpt_family="L1" FT repeat_region 9892161..9892681 FT /rpt_family="L1" FT repeat_region 9893845..9894061 FT /rpt_family="MIR" FT repeat_region 9894356..9894559 FT /rpt_family="MaLR" FT repeat_region 9897077..9898000 FT /rpt_family="L1" FT repeat_region 9898001..9898295 FT /rpt_family="Alu" FT repeat_region 9898296..9898610 FT /rpt_family="L1" FT repeat_region 9898953..9899217 FT /rpt_family="L1" FT repeat_region 9899879..9901717 FT /rpt_family="L1" FT repeat_region 9902208..9902788 FT /rpt_family="L1" FT repeat_region 9902789..9902816 FT /rpt_family="AT_rich" FT repeat_region 9904738..9904766 FT /rpt_family="AT_rich" FT repeat_region complement(10097349..10097389) FT /rpt_family="(CA)n" FT repeat_region complement(10097271..10097347) FT /rpt_family="(TA)n" FT repeat_region complement(10095898..10096230) FT /rpt_family="MaLR" FT repeat_region complement(10095633..10095897) FT /rpt_family="Alu" FT repeat_region complement(10095603..10095632) FT /rpt_family="MaLR" FT repeat_region complement(10093698..10094030) FT /rpt_family="MaLR" FT repeat_region complement(10093594..10093636) FT /rpt_family="AT_rich" FT repeat_region complement(10088532..10088573) FT /rpt_family="MIR" FT repeat_region complement(10088000..10088296) FT /rpt_family="Alu" FT repeat_region complement(10086816..10087035) FT /rpt_family="L1" FT repeat_region complement(10086624..10086813) FT /rpt_family="ERVL" FT repeat_region complement(10086553..10086627) FT /rpt_family="ERVL" FT repeat_region complement(10086381..10086504) FT /rpt_family="L1" FT repeat_region complement(10086114..10086380) FT /rpt_family="Alu" FT repeat_region complement(10084505..10086113) FT /rpt_family="L1" FT repeat_region complement(10084281..10084308) FT /rpt_family="AT_rich" FT repeat_region complement(10083905..10084125) FT /rpt_family="L1" FT repeat_region complement(10083608..10083821) FT /rpt_family="MIR" FT repeat_region complement(10083572..10083605) FT /rpt_family="AT_rich" FT repeat_region complement(10083364..10083483) FT /rpt_family="L2" FT repeat_region complement(10082982..10083094) FT /rpt_family="L2" FT repeat_region complement(10082274..10082422) FT /rpt_family="MER1_type" FT repeat_region complement(10082198..10082235) FT /rpt_family="AT_rich" FT repeat_region complement(10082073..10082190) FT /rpt_family="MER1_type" FT repeat_region complement(10081385..10081511) FT /rpt_family="MIR" FT repeat_region complement(10080790..10080960) FT /rpt_family="(TA)n" FT repeat_region complement(10080704..10080773) FT /rpt_family="AT_rich" FT repeat_region complement(10080359..10080439) FT /rpt_family="CT-rich" FT repeat_region complement(10079557..10080311) FT /rpt_family="L1" FT repeat_region complement(10078681..10078772) FT /rpt_family="L2" FT repeat_region complement(10077782..10077913) FT /rpt_family="MIR" FT repeat_region complement(10077674..10077754) FT /rpt_family="AT_rich" FT repeat_region complement(10077403..10077491) FT /rpt_family="MIR" FT repeat_region complement(10076686..10076706) FT /rpt_family="(TAA)n" FT repeat_region complement(10076092..10076121) FT /rpt_family="AT_rich" FT repeat_region complement(10075964..10076046) FT /rpt_family="L1" FT repeat_region complement(10075635..10075724) FT /rpt_family="MER2_type" FT repeat_region complement(10075602..10075629) FT /rpt_family="(TG)n" FT repeat_region complement(10075553..10075599) FT /rpt_family="ERVL" FT repeat_region complement(10069775..10069881) FT /rpt_family="Ricksha" FT repeat_region complement(10069573..10069772) FT /rpt_family="ERVL" FT repeat_region complement(10069289..10069364) FT /rpt_family="T-rich" FT repeat_region complement(10069192..10069224) FT /rpt_family="(TTAAA)n" FT repeat_region complement(10069019..10069191) FT /rpt_family="L2" FT repeat_region complement(10068653..10068953) FT /rpt_family="Alu" FT repeat_region complement(10068230..10068649) FT /rpt_family="L2" FT repeat_region complement(10067314..10068186) FT /rpt_family="L1" FT repeat_region complement(10066595..10067253) FT /rpt_family="L1" FT repeat_region complement(10066047..10066593) FT /rpt_family="L1" FT repeat_region complement(10065696..10065969) FT /rpt_family="L1" FT repeat_region complement(10065167..10065685) FT /rpt_family="L1" FT repeat_region complement(10064967..10065015) FT /rpt_family="L2" FT repeat_region complement(10064048..10064105) FT /rpt_family="AT_rich" FT repeat_region complement(10063802..10063961) FT /rpt_family="MER1_type" FT repeat_region complement(10062551..10063038) FT /rpt_family="MaLR" FT repeat_region complement(10062265..10062311) FT /rpt_family="(TG)n" FT repeat_region complement(10060439..10060658) FT /rpt_family="L2" FT repeat_region complement(10059881..10059942) FT /rpt_family="AT_rich" FT repeat_region complement(10058739..10058867) FT /rpt_family="L2" FT repeat_region complement(10058647..10058726) FT /rpt_family="Tc2" FT repeat_region complement(10058212..10058618) FT /rpt_family="Tc2" FT repeat_region complement(10057780..10058184) FT /rpt_family="MaLR" FT repeat_region complement(10057406..10057713) FT /rpt_family="Alu" FT repeat_region complement(10057161..10057371) FT /rpt_family="L2" FT repeat_region complement(10056061..10056249) FT /rpt_family="MER1_type" FT repeat_region complement(10053255..10053369) FT /rpt_family="CR1" FT repeat_region complement(10053083..10053247) FT /rpt_family="MIR" FT repeat_region complement(10052937..10052969) FT /rpt_family="(CA)n" FT repeat_region complement(10052489..10052822) FT /rpt_family="L1" FT repeat_region complement(10052134..10052488) FT /rpt_family="MaLR" FT repeat_region complement(10050586..10052133) FT /rpt_family="MaLR" FT repeat_region complement(10050216..10050585) FT /rpt_family="MaLR" FT repeat_region complement(10050200..10050215) FT /rpt_family="L1" FT repeat_region complement(10050014..10050130) FT /rpt_family="CR1" FT repeat_region complement(10049472..10049566) FT /rpt_family="MIR" FT repeat_region complement(10048402..10048788) FT /rpt_family="L2" FT repeat_region complement(10048097..10048401) FT /rpt_family="Alu" FT repeat_region complement(10047748..10048096) FT /rpt_family="L2" FT repeat_region complement(10047459..10047510) FT /rpt_family="AT_rich" FT repeat_region complement(10046392..10046492) FT /rpt_family="GA-rich" FT repeat_region complement(10045851..10045890) FT /rpt_family="AT_rich" FT repeat_region complement(10044561..10044685) FT /rpt_family="MER1_type" FT repeat_region complement(10044249..10044560) FT /rpt_family="Alu" FT repeat_region complement(10044142..10044248) FT /rpt_family="MER1_type" FT repeat_region complement(10043918..10043977) FT /rpt_family="L1" FT repeat_region complement(10043650..10043917) FT /rpt_family="Alu" FT repeat_region complement(10043505..10043649) FT /rpt_family="L1" FT repeat_region complement(10043052..10043504) FT /rpt_family="ERV1" FT repeat_region complement(10042093..10043051) FT /rpt_family="L1" FT repeat_region complement(10042064..10042087) FT /rpt_family="(TG)n" FT repeat_region complement(10041903..10041996) FT /rpt_family="L1" FT repeat_region complement(10041701..10041901) FT /rpt_family="L1" FT repeat_region complement(10041334..10041700) FT /rpt_family="L1" FT repeat_region complement(10039661..10040252) FT /rpt_family="L2" FT repeat_region complement(10035960..10039624) FT /rpt_family="L1" FT repeat_region complement(10035620..10035959) FT /rpt_family="MaLR" FT repeat_region complement(10035597..10035619) FT /rpt_family="L1" FT repeat_region complement(10035556..10035587) FT /rpt_family="MaLR" FT repeat_region complement(10034924..10035460) FT /rpt_family="L2" FT repeat_region complement(10033903..10033926) FT /rpt_family="AT_rich" FT repeat_region complement(10032650..10032854) FT /rpt_family="Alu" FT repeat_region complement(10032468..10032590) FT /rpt_family="CR1" FT repeat_region complement(10030497..10030795) FT /rpt_family="Alu" FT repeat_region complement(10030373..10030411) FT /rpt_family="AT_rich" FT repeat_region complement(10029615..10030223) FT /rpt_family="L1" FT repeat_region complement(10028993..10029610) FT /rpt_family="L1" FT repeat_region complement(10028931..10028957) FT /rpt_family="(CA)n" FT repeat_region complement(10028072..10028899) FT /rpt_family="L1" FT repeat_region complement(10027469..10027851) FT /rpt_family="L1" FT repeat_region complement(10026691..10026958) FT /rpt_family="MaLR" FT repeat_region complement(10026540..10026576) FT /rpt_family="AT_rich" FT repeat_region complement(10025268..10025522) FT /rpt_family="MIR" FT repeat_region complement(10023595..10024446) FT /rpt_family="L1" FT repeat_region complement(10022147..10022189) FT /rpt_family="AT_rich" FT repeat_region complement(10020198..10020372) FT /rpt_family="(TA)n" FT repeat_region complement(10019412..10019719) FT /rpt_family="Alu" FT repeat_region complement(10019163..10019388) FT /rpt_family="MER1_type" FT repeat_region complement(10018970..10019153) FT /rpt_family="MER1_type" FT repeat_region complement(10018626..10018957) FT /rpt_family="MER1_type" FT repeat_region complement(10016487..10016777) FT /rpt_family="L1" FT repeat_region complement(10016267..10016486) FT /rpt_family="MER1_type" FT repeat_region complement(10016183..10016266) FT /rpt_family="L1" FT repeat_region complement(10016001..10016168) FT /rpt_family="(TA)n" FT repeat_region complement(10015459..10015753) FT /rpt_family="Alu" FT repeat_region complement(10014505..10014534) FT /rpt_family="AT_rich" FT repeat_region complement(10014202..10014231) FT /rpt_family="AT_rich" FT repeat_region complement(10012096..10013126) FT /rpt_family="L1" FT repeat_region complement(10011694..10012073) FT /rpt_family="MaLR" FT repeat_region complement(10010091..10011693) FT /rpt_family="MaLR" FT repeat_region complement(10009686..10010074) FT /rpt_family="MaLR" FT repeat_region complement(10009021..10009684) FT /rpt_family="L1" FT repeat_region complement(10008362..10008740) FT /rpt_family="MaLR" FT repeat_region complement(10008190..10008306) FT /rpt_family="MIR" FT repeat_region complement(10007911..10008189) FT /rpt_family="Alu" FT repeat_region complement(10007800..10007910) FT /rpt_family="MIR" FT repeat_region complement(10006954..10006983) FT /rpt_family="AT_rich" FT repeat_region complement(10006879..10006925) FT /rpt_family="AT_rich" FT repeat_region complement(10006685..10006748) FT /rpt_family="MIR" FT repeat_region complement(10006392..10006415) FT /rpt_family="AT_rich" FT repeat_region complement(10005220..10005449) FT /rpt_family="MER1_type" FT repeat_region complement(10005146..10005219) FT /rpt_family="(TA)n" FT repeat_region complement(10004999..10005033) FT /rpt_family="(CA)n" FT repeat_region complement(10003120..10003409) FT /rpt_family="Alu" FT repeat_region complement(10001920..10001955) FT /rpt_family="(TA)n" FT repeat_region complement(10000924..10001015) FT /rpt_family="MIR" FT repeat_region complement(10000643..10000797) FT /rpt_family="MIR" FT repeat_region complement(9999533..9999568) FT /rpt_family="(GA)n" FT repeat_region complement(9997369..9997683) FT /rpt_family="Alu" FT repeat_region complement(9996942..9997066) FT /rpt_family="Alu" FT repeat_region complement(9996791..9996929) FT /rpt_family="L2" FT repeat_region complement(9996553..9996579) FT /rpt_family="AT_rich" FT repeat_region complement(9996283..9996552) FT /rpt_family="Alu" FT repeat_region complement(9995609..9995710) FT /rpt_family="MIR" FT repeat_region complement(9995135..9995251) FT /rpt_family="L1" FT repeat_region complement(9993209..9994297) FT /rpt_family="L1" FT repeat_region complement(9991010..9993118) FT /rpt_family="L1" FT repeat_region complement(9990827..9990891) FT /rpt_family="AT_rich" FT repeat_region complement(9989375..9989685) FT /rpt_family="CT-rich" FT repeat_region complement(9988806..9989275) FT /rpt_family="L1" FT repeat_region complement(9988719..9988805) FT /rpt_family="(TA)n" FT repeat_region complement(9988377..9988718) FT /rpt_family="L1" FT repeat_region complement(9987854..9988381) FT /rpt_family="L1" FT repeat_region complement(9987510..9987847) FT /rpt_family="L1" FT repeat_region complement(9986470..9987483) FT /rpt_family="L1" FT repeat_region complement(9986094..9986397) FT /rpt_family="Alu" FT repeat_region complement(9984088..9984465) FT /rpt_family="MER2_type" FT repeat_region complement(9983761..9984032) FT /rpt_family="L1" FT repeat_region complement(9982948..9982968) FT /rpt_family="AT_rich" FT repeat_region complement(9982514..9982709) FT /rpt_family="L1" FT repeat_region complement(9981764..9981810) FT /rpt_family="AT_rich" FT repeat_region complement(9981552..9981582) FT /rpt_family="(TC)n" FT repeat_region complement(9981527..9981552) FT /rpt_family="(TA)n" FT repeat_region complement(9981199..9981379) FT /rpt_family="MIR" FT repeat_region complement(9980314..9980551) FT /rpt_family="L2" FT repeat_region complement(9980074..9980125) FT /rpt_family="(CA)n" FT repeat_region complement(9980015..9980074) FT /rpt_family="(TA)n" FT repeat_region complement(9979702..9979937) FT /rpt_family="L1" FT repeat_region complement(9978831..9979140) FT /rpt_family="ERV1" FT repeat_region complement(9976083..9976366) FT /rpt_family="L1" FT repeat_region complement(9974462..9975678) FT /rpt_family="L1" FT repeat_region complement(9974116..9974434) FT /rpt_family="L1" FT repeat_region complement(9973647..9974101) FT /rpt_family="L1" FT repeat_region complement(9973516..9973536) FT /rpt_family="AT_rich" FT repeat_region complement(9972954..9973391) FT /rpt_family="L1" FT repeat_region complement(9972684..9972951) FT /rpt_family="ERVL" FT repeat_region complement(9972375..9972683) FT /rpt_family="Alu" FT repeat_region complement(9972257..9972374) FT /rpt_family="ERVL" FT repeat_region complement(9970493..9972239) FT /rpt_family="L1" FT repeat_region complement(9970066..9970375) FT /rpt_family="MaLR" FT repeat_region complement(9968741..9970064) FT /rpt_family="MaLR" FT repeat_region complement(9968303..9968740) FT /rpt_family="MaLR" FT repeat_region complement(9967394..9968301) FT /rpt_family="L1" FT repeat_region complement(9966661..9967347) FT /rpt_family="L1" FT repeat_region complement(9966336..9966454) FT /rpt_family="L1" FT repeat_region complement(9966004..9966111) FT /rpt_family="ERVL" FT repeat_region complement(9965867..9965970) FT /rpt_family="L2" FT repeat_region complement(9965507..9965573) FT /rpt_family="MIR" FT repeat_region complement(9964878..9965063) FT /rpt_family="L2" FT repeat_region complement(9963525..9964657) FT /rpt_family="L1" FT repeat_region complement(9962262..9963524) FT /rpt_family="L1" FT repeat_region complement(9961683..9961889) FT /rpt_family="MER1_type" FT repeat_region complement(9960947..9961003) FT /rpt_family="MER1_type" FT repeat_region complement(9959692..9960411) FT /rpt_family="L1" FT repeat_region complement(9959595..9959672) FT /rpt_family="AT_rich" FT repeat_region complement(9959304..9959541) FT /rpt_family="L1" FT repeat_region complement(9958366..9958621) FT /rpt_family="Alu" FT repeat_region complement(10185195..10185436) FT /rpt_family="L2" FT repeat_region complement(10184703..10185194) FT /rpt_family="L1" FT repeat_region complement(10184368..10184541) FT /rpt_family="L1" FT repeat_region complement(10184068..10184370) FT /rpt_family="L1" FT repeat_region complement(10183724..10184003) FT /rpt_family="L1" FT repeat_region complement(10183504..10183639) FT /rpt_family="MIR" FT repeat_region complement(10182942..10183165) FT /rpt_family="MIR" FT repeat_region complement(10181718..10181818) FT /rpt_family="GA-rich" FT repeat_region complement(10181335..10181505) FT /rpt_family="MIR" FT repeat_region complement(10180426..10180659) FT /rpt_family="L2" FT repeat_region complement(10178454..10178503) FT /rpt_family="MaLR" FT repeat_region complement(10177974..10178453) FT /rpt_family="ERV1" FT repeat_region complement(10177680..10177972) FT /rpt_family="MaLR" FT repeat_region complement(10177188..10177217) FT /rpt_family="AT_rich" FT repeat_region complement(10176788..10177078) FT /rpt_family="Alu" FT repeat_region complement(10176674..10176697) FT /rpt_family="AT_rich" FT repeat_region complement(10176045..10176242) FT /rpt_family="CR1" FT repeat_region complement(10175680..10176044) FT /rpt_family="MaLR" FT repeat_region complement(10174971..10175679) FT /rpt_family="CR1" FT repeat_region complement(10174425..10174583) FT /rpt_family="MIR" FT repeat_region complement(10173584..10173960) FT /rpt_family="MaLR" FT repeat_region complement(10172698..10173007) FT /rpt_family="Alu" FT repeat_region complement(10172203..10172346) FT /rpt_family="MIR" FT repeat_region complement(10172020..10172107) FT /rpt_family="MIR" FT repeat_region complement(10171277..10171591) FT /rpt_family="Alu" FT repeat_region complement(10170452..10170760) FT /rpt_family="Alu" FT repeat_region complement(10168228..10168294) FT /rpt_family="ERV1" FT repeat_region complement(10168182..10168227) FT /rpt_family="(CA)n" FT repeat_region complement(10165784..10166488) FT /rpt_family="MER1_type" FT repeat_region complement(10165540..10165560) FT /rpt_family="(TTAAA)n" FT repeat_region complement(10165445..10165475) FT /rpt_family="AT_rich" FT repeat_region complement(10165216..10165236) FT /rpt_family="AT_rich" FT repeat_region complement(10164399..10164784) FT /rpt_family="L1" FT repeat_region complement(10164065..10164398) FT /rpt_family="MER2_type" FT repeat_region complement(10163827..10164060) FT /rpt_family="MER2_type" FT repeat_region complement(10163509..10163821) FT /rpt_family="MaLR" FT repeat_region complement(10163312..10163339) FT /rpt_family="AT_rich" FT repeat_region complement(10162968..10162990) FT /rpt_family="AT_rich" FT repeat_region complement(10160343..10160404) FT /rpt_family="L2" FT repeat_region complement(10159768..10159969) FT /rpt_family="MIR" FT repeat_region complement(10158483..10159109) FT /rpt_family="L1" FT repeat_region complement(10158308..10158482) FT /rpt_family="Alu" FT repeat_region complement(10157786..10158261) FT /rpt_family="L1" FT repeat_region complement(10157738..10157785) FT /rpt_family="(TAAA)n" FT repeat_region complement(10157443..10157737) FT /rpt_family="L1" FT repeat_region complement(10157154..10157355) FT /rpt_family="Alu" FT repeat_region complement(10157101..10157124) FT /rpt_family="L1" FT repeat_region complement(10156974..10157100) FT /rpt_family="Alu" FT repeat_region complement(10156822..10156973) FT /rpt_family="L1" FT repeat_region complement(10156156..10156408) FT /rpt_family="Alu" FT repeat_region complement(10154789..10154837) FT /rpt_family="L2" FT repeat_region complement(10154058..10154356) FT /rpt_family="Alu" FT repeat_region complement(10153894..10153926) FT /rpt_family="(TTTG)n" FT repeat_region complement(10153621..10153700) FT /rpt_family="L2" FT repeat_region complement(10153231..10153518) FT /rpt_family="Alu" FT repeat_region complement(10152924..10153222) FT /rpt_family="Alu" FT misc_feature complement(10152946..10153215) FT /note="CpG_island (%GC=61.1, o/e=0.84, #CpGs=21)" FT repeat_region complement(10151824..10151920) FT /rpt_family="AT_rich" FT repeat_region complement(10151261..10151283) FT /rpt_family="AT_rich" FT repeat_region complement(10150629..10151045) FT /rpt_family="MER2_type" FT repeat_region complement(10148010..10148353) FT /rpt_family="Alu" FT repeat_region complement(10147597..10147833) FT /rpt_family="L1" FT repeat_region complement(10146911..10147122) FT /rpt_family="L1" FT repeat_region complement(10145963..10146054) FT /rpt_family="MER1_type" FT repeat_region complement(10145271..10145549) FT /rpt_family="Alu" FT repeat_region complement(10144977..10145104) FT /rpt_family="Alu" FT repeat_region complement(10144775..10144797) FT /rpt_family="AT_rich" FT repeat_region complement(10143827..10144201) FT /rpt_family="MaLR" FT repeat_region complement(10143426..10143679) FT /rpt_family="L1" FT repeat_region complement(10143121..10143425) FT /rpt_family="Alu" FT repeat_region complement(10142225..10143120) FT /rpt_family="L1" FT repeat_region complement(10141963..10141977) FT /rpt_family="MER1_type" FT repeat_region complement(10141932..10141962) FT /rpt_family="(CA)n" FT repeat_region complement(10141614..10141931) FT /rpt_family="MER1_type" FT repeat_region complement(10140528..10140595) FT /rpt_family="AT_rich" FT repeat_region complement(10140285..10140393) FT /rpt_family="L2" FT repeat_region complement(10139669..10139884) FT /rpt_family="MIR" FT repeat_region complement(10139350..10139656) FT /rpt_family="Alu" FT repeat_region complement(10139181..10139287) FT /rpt_family="MIR" FT repeat_region complement(10138982..10139030) FT /rpt_family="AT_rich" FT repeat_region complement(10137760..10137903) FT /rpt_family="MIR" FT repeat_region complement(10137715..10137746) FT /rpt_family="AT_rich" FT repeat_region complement(10137454..10137484) FT /rpt_family="AT_rich" FT repeat_region complement(10137200..10137250) FT /rpt_family="AT_rich" FT repeat_region complement(10136890..10136932) FT /rpt_family="AT_rich" FT repeat_region complement(10136653..10136777) FT /rpt_family="L1" FT repeat_region complement(10135829..10135928) FT /rpt_family="MIR" FT repeat_region complement(10135074..10135811) FT /rpt_family="L1" FT repeat_region complement(10134590..10135075) FT /rpt_family="L1" FT repeat_region complement(10132013..10134583) FT /rpt_family="L1" FT repeat_region complement(10130251..10131515) FT /rpt_family="L2" FT repeat_region complement(10130048..10130068) FT /rpt_family="AT_rich" FT repeat_region complement(10129917..10129938) FT /rpt_family="AT_rich" FT repeat_region complement(10128584..10129053) FT /rpt_family="ERV1" FT repeat_region complement(10128061..10128251) FT /rpt_family="ERV1" FT repeat_region complement(10127750..10127867) FT /rpt_family="ERV1" FT repeat_region complement(10126800..10127329) FT /rpt_family="ERV1" FT repeat_region complement(10126580..10126688) FT /rpt_family="ERV1" FT repeat_region complement(10126271..10126579) FT /rpt_family="MER2_type" FT repeat_region complement(10125908..10126270) FT /rpt_family="ERV1" FT repeat_region complement(10124657..10125354) FT /rpt_family="ERV1" FT repeat_region complement(10124501..10124544) FT /rpt_family="AT_rich" FT repeat_region complement(10119891..10120437) FT /rpt_family="ERV1" FT repeat_region complement(10119770..10119844) FT /rpt_family="(TA)n" FT repeat_region complement(10118089..10119636) FT /rpt_family="ERV1" FT repeat_region complement(10118034..10118073) FT /rpt_family="ERV1" FT repeat_region complement(10117832..10118033) FT /rpt_family="ERVL" FT repeat_region complement(10117676..10117836) FT /rpt_family="MaLR" FT repeat_region complement(10117106..10117314) FT /rpt_family="L2" FT repeat_region complement(10116623..10116905) FT /rpt_family="MaLR" FT repeat_region complement(10116066..10116437) FT /rpt_family="L2" FT repeat_region complement(10115987..10116014) FT /rpt_family="(TTTTC)n" FT repeat_region complement(10114236..10114547) FT /rpt_family="Alu" FT repeat_region complement(10114023..10114232) FT /rpt_family="L1" FT repeat_region complement(10113960..10113982) FT /rpt_family="AT_rich" FT repeat_region complement(10113698..10113787) FT /rpt_family="GA-rich" FT repeat_region complement(10113482..10113614) FT /rpt_family="MIR" FT repeat_region complement(10112884..10113175) FT /rpt_family="Alu" FT repeat_region complement(10112559..10112696) FT /rpt_family="CR1" FT repeat_region complement(10112506..10112547) FT /rpt_family="L1" FT repeat_region complement(10111875..10112505) FT /rpt_family="L1" FT repeat_region complement(10110550..10111867) FT /rpt_family="L1" FT repeat_region complement(10109795..10110542) FT /rpt_family="L1" FT repeat_region complement(10109488..10109794) FT /rpt_family="Alu" FT repeat_region complement(10109249..10109487) FT /rpt_family="L1" FT repeat_region complement(10108594..10109232) FT /rpt_family="L1" FT repeat_region complement(10107529..10108273) FT /rpt_family="L1" FT repeat_region complement(10107342..10107514) FT /rpt_family="L1" FT repeat_region complement(10107295..10107335) FT /rpt_family="Alu" FT repeat_region complement(10106233..10107276) FT /rpt_family="L1" FT repeat_region complement(10106094..10106236) FT /rpt_family="L1" FT repeat_region complement(10105919..10106083) FT /rpt_family="Alu" FT repeat_region complement(10104276..10105917) FT /rpt_family="L1" FT repeat_region complement(10103871..10104035) FT /rpt_family="L1" FT repeat_region complement(10103690..10103870) FT /rpt_family="L1" FT repeat_region complement(10103402..10103687) FT /rpt_family="Alu" FT repeat_region complement(10102980..10103179) FT /rpt_family="L1" FT repeat_region complement(10102704..10102756) FT /rpt_family="AT_rich" FT repeat_region complement(10102588..10102634) FT /rpt_family="CT-rich" FT repeat_region complement(10101384..10101577) FT /rpt_family="MIR" FT repeat_region complement(10100793..10101061) FT /rpt_family="L2" FT repeat_region complement(10100760..10100792) FT /rpt_family="AT_rich" FT repeat_region complement(10100446..10100758) FT /rpt_family="Alu" FT repeat_region complement(10099783..10100261) FT /rpt_family="L2" FT misc_feature complement(10099507..10099783) FT /note="CpG_island (%GC=63.5, o/e=0.89, #CpGs=25)" FT repeat_region complement(10099473..10099782) FT /rpt_family="Alu" FT repeat_region complement(10099450..10099472) FT /rpt_family="L2" FT repeat_region complement(10099153..10099241) FT /rpt_family="L2" FT repeat_region complement(10098815..10099075) FT /rpt_family="L2" FT repeat_region complement(10319602..10319715) FT /rpt_family="L1" FT repeat_region complement(10319536..10319601) FT /rpt_family="L1" FT repeat_region complement(10319164..10319535) FT /rpt_family="MaLR" FT repeat_region complement(10319076..10319163) FT /rpt_family="L1" FT repeat_region complement(10318135..10318661) FT /rpt_family="MaLR" FT repeat_region complement(10317150..10317171) FT /rpt_family="AT_rich" FT repeat_region complement(10316746..10316949) FT /rpt_family="MIR" FT repeat_region complement(10316275..10316400) FT /rpt_family="MER1_type" FT repeat_region complement(10316240..10316274) FT /rpt_family="(TG)n" FT repeat_region complement(10316191..10316239) FT /rpt_family="MER1_type" FT repeat_region complement(10309453..10309743) FT /rpt_family="Alu" FT repeat_region complement(10309363..10309410) FT /rpt_family="A-rich" FT repeat_region complement(10307073..10307224) FT /rpt_family="Alu" FT repeat_region complement(10306773..10306913) FT /rpt_family="MIR" FT repeat_region complement(10306401..10306509) FT /rpt_family="L2" FT repeat_region complement(10305825..10305871) FT /rpt_family="(T)n" FT repeat_region complement(10304222..10304274) FT /rpt_family="AT_rich" FT repeat_region complement(10304154..10304214) FT /rpt_family="(TA)n" FT repeat_region complement(10303969..10304064) FT /rpt_family="MaLR" FT repeat_region complement(10302737..10303278) FT /rpt_family="L2" FT repeat_region complement(10301059..10301972) FT /rpt_family="L1" FT repeat_region complement(10300499..10300715) FT /rpt_family="L1" FT repeat_region complement(10300296..10300487) FT /rpt_family="L1" FT repeat_region complement(10297698..10297784) FT /rpt_family="(TA)n" FT repeat_region complement(10296804..10296852) FT /rpt_family="AT_rich" FT repeat_region complement(10294924..10295112) FT /rpt_family="MIR" FT repeat_region complement(10294663..10294899) FT /rpt_family="MIR" FT repeat_region complement(10294544..10294621) FT /rpt_family="MIR" FT repeat_region complement(10294257..10294368) FT /rpt_family="MaLR" FT repeat_region complement(10293641..10293855) FT /rpt_family="L1" FT repeat_region complement(10286819..10287094) FT /rpt_family="MER1_type" FT repeat_region complement(10285929..10286815) FT /rpt_family="L1" FT repeat_region complement(10285476..10285565) FT /rpt_family="MIR" FT repeat_region complement(10285401..10285434) FT /rpt_family="AT_rich" FT repeat_region complement(10281452..10283118) FT /rpt_family="L1" FT repeat_region complement(10280645..10280777) FT /rpt_family="L2" FT repeat_region complement(10277834..10277989) FT /rpt_family="ERVL" FT repeat_region complement(10273564..10276782) FT /rpt_family="L1" FT repeat_region complement(10273519..10273563) FT /rpt_family="Mariner" FT repeat_region complement(10270944..10273518) FT /rpt_family="L1" FT repeat_region complement(10270234..10270354) FT /rpt_family="L1" FT repeat_region complement(10269844..10270030) FT /rpt_family="L1" FT repeat_region complement(10269557..10269838) FT /rpt_family="Alu" FT repeat_region complement(10269376..10269536) FT /rpt_family="MER2_type" FT repeat_region complement(10269156..10269260) FT /rpt_family="L1" FT repeat_region complement(10268759..10269107) FT /rpt_family="MaLR" FT repeat_region complement(10268450..10268658) FT /rpt_family="L1" FT repeat_region complement(10268155..10268440) FT /rpt_family="L1" FT repeat_region complement(10267821..10268111) FT /rpt_family="Alu" FT repeat_region complement(10266971..10267409) FT /rpt_family="L1" FT repeat_region complement(10266287..10266423) FT /rpt_family="Alu" FT repeat_region complement(10264420..10264457) FT /rpt_family="(TG)n" FT repeat_region complement(10264029..10264188) FT /rpt_family="L1" FT repeat_region complement(10263942..10263985) FT /rpt_family="(TCTA)n" FT repeat_region complement(10263321..10263626) FT /rpt_family="MaLR" FT repeat_region complement(10263016..10263320) FT /rpt_family="Alu" FT repeat_region complement(10262951..10263015) FT /rpt_family="MaLR" FT repeat_region complement(10262810..10262884) FT /rpt_family="L2" FT repeat_region complement(10262424..10262638) FT /rpt_family="U3" FT ncRNA 10262224..10262438 FT /product="snoRNA-U3-related" FT /ncRNA_class="snoRNA" FT repeat_region complement(10262057..10262098) FT /rpt_family="AT_rich" FT repeat_region complement(10261930..10261977) FT /rpt_family="AT_rich" FT repeat_region complement(10259840..10260129) FT /rpt_family="Alu" FT repeat_region complement(10257647..10257681) FT /rpt_family="MaLR" FT repeat_region complement(10254790..10255244) FT /rpt_family="MaLR" FT repeat_region complement(10254552..10254670) FT /rpt_family="MIR" FT repeat_region complement(10254375..10254419) FT /rpt_family="tRNA-Arg-CGY" FT repeat_region complement(10253762..10254190) FT /rpt_family="ERV1" FT repeat_region complement(10253318..10253761) FT /rpt_family="ERV1" FT repeat_region complement(10252888..10253201) FT /rpt_family="ERV1" FT repeat_region complement(10252668..10252823) FT /rpt_family="ERV1" FT repeat_region complement(10252605..10252682) FT /rpt_family="ERV1" FT repeat_region complement(10251631..10252611) FT /rpt_family="ERV1" FT repeat_region complement(10251197..10251629) FT /rpt_family="ERV1" FT repeat_region complement(10250522..10250549) FT /rpt_family="AT_rich" FT repeat_region complement(10249774..10250108) FT /rpt_family="L2" FT repeat_region complement(10248599..10248712) FT /rpt_family="Alu" FT repeat_region complement(10248559..10248595) FT /rpt_family="(TAA)n" FT repeat_region complement(10247279..10247409) FT /rpt_family="L2" FT repeat_region complement(10247056..10247226) FT /rpt_family="L2" FT repeat_region complement(10244807..10244907) FT /rpt_family="(TTCCC)n" FT repeat_region complement(10244766..10244806) FT /rpt_family="(TC)n" FT repeat_region complement(10244459..10244757) FT /rpt_family="Alu" FT repeat_region complement(10244120..10244175) FT /rpt_family="CT-rich" FT repeat_region complement(10243843..10243961) FT /rpt_family="L2" FT repeat_region complement(10243046..10243402) FT /rpt_family="L1" FT repeat_region complement(10242755..10243045) FT /rpt_family="Alu" FT repeat_region complement(10242298..10242754) FT /rpt_family="L1" FT repeat_region complement(10242263..10242283) FT /rpt_family="(TA)n" FT repeat_region complement(10242036..10242259) FT /rpt_family="L1" FT repeat_region complement(10241835..10242034) FT /rpt_family="L1" FT repeat_region complement(10241535..10241834) FT /rpt_family="Alu" FT repeat_region complement(10238417..10241534) FT /rpt_family="L1" FT repeat_region complement(10237539..10237893) FT /rpt_family="L1" FT repeat_region complement(10237480..10237535) FT /rpt_family="(TA)n" FT repeat_region complement(10237431..10237480) FT /rpt_family="(GA)n" FT repeat_region complement(10237072..10237427) FT /rpt_family="L1" FT repeat_region complement(10234914..10235063) FT /rpt_family="MER1_type" FT repeat_region complement(10234420..10234729) FT /rpt_family="Alu" FT repeat_region complement(10234135..10234401) FT /rpt_family="MIR" FT repeat_region complement(10234026..10234080) FT /rpt_family="(TA)n" FT repeat_region complement(10230386..10230934) FT /rpt_family="ERV1" FT repeat_region complement(10227950..10227985) FT /rpt_family="AT_rich" FT repeat_region complement(10227683..10227710) FT /rpt_family="AT_rich" FT repeat_region complement(10227491..10227665) FT /rpt_family="(TA)n" FT repeat_region complement(10227208..10227465) FT /rpt_family="(TA)n" FT repeat_region complement(10226908..10227206) FT /rpt_family="L1" FT repeat_region complement(10226435..10226884) FT /rpt_family="ERV1" FT repeat_region complement(10226015..10226171) FT /rpt_family="Alu" FT repeat_region complement(10225365..10225590) FT /rpt_family="L1" FT repeat_region complement(10224780..10225140) FT /rpt_family="MaLR" FT repeat_region complement(10224574..10224735) FT /rpt_family="L1" FT repeat_region complement(10224526..10224570) FT /rpt_family="(TTC)n" FT repeat_region complement(10224362..10224389) FT /rpt_family="AT_rich" FT repeat_region complement(10223061..10223601) FT /rpt_family="L2" FT repeat_region complement(10222673..10222978) FT /rpt_family="Alu" FT repeat_region complement(10222215..10222240) FT /rpt_family="AT_rich" FT repeat_region complement(10221702..10221955) FT /rpt_family="ERVL" FT repeat_region complement(10221062..10221175) FT /rpt_family="L1" FT repeat_region complement(10220771..10221061) FT /rpt_family="Alu" FT repeat_region complement(10220258..10220770) FT /rpt_family="L1" FT repeat_region complement(10219541..10220225) FT /rpt_family="L1" FT repeat_region complement(10219290..10219444) FT /rpt_family="L1" FT repeat_region complement(10218253..10218309) FT /rpt_family="L2" FT repeat_region complement(10218059..10218095) FT /rpt_family="(TATATG)n" FT repeat_region complement(10217723..10217849) FT /rpt_family="L1" FT repeat_region complement(10217163..10217708) FT /rpt_family="L1" FT repeat_region complement(10217094..10217121) FT /rpt_family="AT_rich" FT repeat_region complement(10216983..10217091) FT /rpt_family="L1" FT repeat_region complement(10216841..10216950) FT /rpt_family="MaLR" FT repeat_region complement(10216711..10216839) FT /rpt_family="L1" FT repeat_region complement(10216361..10216503) FT /rpt_family="L1" FT repeat_region complement(10216077..10216344) FT /rpt_family="L1" FT repeat_region complement(10215501..10216089) FT /rpt_family="L1" FT repeat_region complement(10215047..10215460) FT /rpt_family="L1" FT repeat_region complement(10214021..10215033) FT /rpt_family="L1" FT repeat_region complement(10213717..10214020) FT /rpt_family="Alu" FT repeat_region complement(10213362..10213716) FT /rpt_family="L1" FT repeat_region complement(10213216..10213364) FT /rpt_family="L1" FT repeat_region complement(10212964..10213194) FT /rpt_family="L1" FT repeat_region complement(10212204..10212378) FT /rpt_family="MIR" FT repeat_region complement(10205749..10205826) FT /rpt_family="L2" FT repeat_region complement(10205299..10205600) FT /rpt_family="L1" FT repeat_region complement(10205214..10205258) FT /rpt_family="(TG)n" FT repeat_region complement(10204900..10204937) FT /rpt_family="AT_rich" FT repeat_region complement(10203697..10203724) FT /rpt_family="AT_rich" FT repeat_region complement(10202728..10203191) FT /rpt_family="MER1_type" FT repeat_region complement(10202677..10202725) FT /rpt_family="AT_rich" FT repeat_region complement(10202501..10202676) FT /rpt_family="(TA)n" FT repeat_region complement(10201936..10202492) FT /rpt_family="MER1_type" FT repeat_region complement(10201513..10201798) FT /rpt_family="ERVL" FT repeat_region complement(10201129..10201150) FT /rpt_family="AT_rich" FT repeat_region complement(10199987..10200436) FT /rpt_family="MaLR" FT repeat_region complement(10199434..10199470) FT /rpt_family="AT_rich" FT repeat_region complement(10199352..10199374) FT /rpt_family="AT_rich" FT repeat_region complement(10199039..10199351) FT /rpt_family="Alu" FT repeat_region complement(10198339..10198524) FT /rpt_family="(TA)n" FT repeat_region complement(10198126..10198177) FT /rpt_family="AT_rich" FT repeat_region complement(10197566..10197861) FT /rpt_family="Alu" FT repeat_region complement(10197120..10197510) FT /rpt_family="L1" FT repeat_region complement(10197091..10197113) FT /rpt_family="L1" FT repeat_region complement(10197055..10197090) FT /rpt_family="(CA)n" FT repeat_region complement(10196938..10197054) FT /rpt_family="L1" FT repeat_region complement(10196454..10196936) FT /rpt_family="ERV1" FT repeat_region complement(10196289..10196442) FT /rpt_family="T-rich" FT repeat_region complement(10196200..10196246) FT /rpt_family="AT_rich" FT repeat_region complement(10195687..10195966) FT /rpt_family="L1" FT repeat_region complement(10195505..10195587) FT /rpt_family="L1" FT repeat_region complement(10190629..10190922) FT /rpt_family="Alu" FT repeat_region complement(10189931..10190375) FT /rpt_family="L1" FT repeat_region complement(10189884..10189923) FT /rpt_family="AT_rich" FT repeat_region complement(10189745..10189765) FT /rpt_family="AT_rich" FT repeat_region complement(10187533..10188161) FT /rpt_family="ERV1" FT repeat_region complement(10187338..10187499) FT /rpt_family="Alu" FT repeat_region complement(10186816..10187042) FT /rpt_family="ERV1" FT repeat_region complement(10186750..10186798) FT /rpt_family="ERV1" FT repeat_region complement(10185973..10186408) FT /rpt_family="MaLR" FT repeat_region complement(10185662..10185831) FT /rpt_family="L2" FT repeat_region complement(10185238..10185503) FT /rpt_family="L2" FT repeat_region complement(10403096..10403458) FT /rpt_family="MaLR" FT repeat_region complement(10401748..10403095) FT /rpt_family="MaLR" FT repeat_region complement(10401253..10401746) FT /rpt_family="L1" FT repeat_region complement(10400877..10401252) FT /rpt_family="L1" FT repeat_region complement(10400865..10400876) FT /rpt_family="L1" FT repeat_region complement(10400588..10400859) FT /rpt_family="MaLR" FT repeat_region complement(10400222..10400587) FT /rpt_family="MaLR" FT repeat_region complement(10397651..10400219) FT /rpt_family="L1" FT repeat_region complement(10396837..10397479) FT /rpt_family="ERV1" FT repeat_region complement(10395286..10395316) FT /rpt_family="(TTA)n" FT repeat_region complement(10393778..10394358) FT /rpt_family="L1" FT repeat_region complement(10393756..10393777) FT /rpt_family="AT_rich" FT repeat_region complement(10393383..10393692) FT /rpt_family="Alu" FT repeat_region complement(10391136..10393382) FT /rpt_family="L1" FT repeat_region complement(10391042..10391131) FT /rpt_family="L1" FT repeat_region complement(10390057..10391040) FT /rpt_family="L1" FT repeat_region complement(10388375..10388417) FT /rpt_family="(TTTTG)n" FT repeat_region complement(10388347..10388367) FT /rpt_family="AT_rich" FT repeat_region complement(10387319..10387387) FT /rpt_family="MaLR" FT repeat_region complement(10387039..10387186) FT /rpt_family="MIR" FT repeat_region complement(10386440..10386524) FT /rpt_family="MaLR" FT repeat_region complement(10385533..10385901) FT /rpt_family="MaLR" FT repeat_region complement(10385465..10385480) FT /rpt_family="(GAAA)n" FT repeat_region complement(10385238..10385464) FT /rpt_family="Alu" FT repeat_region complement(10385215..10385237) FT /rpt_family="(GAAA)n" FT repeat_region complement(10384281..10384826) FT /rpt_family="L2" FT repeat_region complement(10382859..10383837) FT /rpt_family="L2" FT repeat_region complement(10381234..10381299) FT /rpt_family="MIR" FT repeat_region complement(10380786..10381123) FT /rpt_family="CR1" FT repeat_region complement(10380357..10380784) FT /rpt_family="CR1" FT repeat_region complement(10380271..10380334) FT /rpt_family="(CA)n" FT repeat_region complement(10380052..10380226) FT /rpt_family="CR1" FT repeat_region complement(10379218..10379291) FT /rpt_family="MIR" FT repeat_region complement(10378937..10379045) FT /rpt_family="L1" FT repeat_region complement(10377986..10378205) FT /rpt_family="MIR" FT repeat_region complement(10375202..10375846) FT /rpt_family="MaLR" FT repeat_region complement(10374716..10374892) FT /rpt_family="MIR" FT repeat_region complement(10373621..10373994) FT /rpt_family="MaLR" FT repeat_region complement(10372753..10373071) FT /rpt_family="Alu" FT repeat_region complement(10371995..10372750) FT /rpt_family="L2" FT repeat_region complement(10371624..10371923) FT /rpt_family="MaLR" FT repeat_region complement(10371181..10371479) FT /rpt_family="Alu" FT repeat_region complement(10370888..10371125) FT /rpt_family="L2" FT repeat_region complement(10369285..10369333) FT /rpt_family="AT_rich" FT repeat_region complement(10368559..10368601) FT /rpt_family="AT_rich" FT repeat_region complement(10368116..10368235) FT /rpt_family="MIR" FT repeat_region complement(10367563..10367663) FT /rpt_family="L2" FT repeat_region complement(10367372..10367490) FT /rpt_family="L2" FT repeat_region complement(10366309..10366532) FT /rpt_family="ERVL" FT repeat_region complement(10365792..10365853) FT /rpt_family="(CA)n" FT repeat_region complement(10365440..10365644) FT /rpt_family="L2" FT repeat_region complement(10364505..10364879) FT /rpt_family="MaLR" FT repeat_region complement(10360012..10360039) FT /rpt_family="AT_rich" FT repeat_region complement(10359065..10359393) FT /rpt_family="L1" FT repeat_region complement(10358843..10359047) FT /rpt_family="Alu" FT repeat_region complement(10358141..10358792) FT /rpt_family="L1" FT repeat_region complement(10357901..10358113) FT /rpt_family="L1" FT misc_feature complement(10357622..10357901) FT /note="CpG_island (%GC=60.4, o/e=0.81, #CpGs=22)" FT repeat_region complement(10357606..10357900) FT /rpt_family="Alu" FT repeat_region complement(10357139..10357605) FT /rpt_family="L1" FT repeat_region complement(10356447..10357095) FT /rpt_family="L1" FT repeat_region complement(10356135..10356460) FT /rpt_family="L1" FT repeat_region complement(10355797..10356064) FT /rpt_family="L1" FT repeat_region complement(10355344..10355788) FT /rpt_family="ERVK" FT repeat_region complement(10355087..10355335) FT /rpt_family="L1" FT repeat_region complement(10354733..10355086) FT /rpt_family="MaLR" FT repeat_region complement(10354342..10354732) FT /rpt_family="L1" FT repeat_region complement(10353757..10353778) FT /rpt_family="(T)n" FT repeat_region complement(10353697..10353720) FT /rpt_family="(TTTTG)n" FT repeat_region complement(10352630..10352808) FT /rpt_family="MIR" FT repeat_region complement(10349139..10349323) FT /rpt_family="MIR" FT repeat_region complement(10348614..10349060) FT /rpt_family="MaLR" FT repeat_region complement(10348476..10348513) FT /rpt_family="(TCCCC)n" FT repeat_region complement(10346120..10347203) FT /rpt_family="ERVK" FT repeat_region complement(10345802..10345879) FT /rpt_family="Mariner" FT repeat_region complement(10345335..10345633) FT /rpt_family="L2" FT repeat_region complement(10344741..10344774) FT /rpt_family="AT_rich" FT repeat_region complement(10344455..10344740) FT /rpt_family="Alu" FT repeat_region complement(10344001..10344330) FT /rpt_family="L1" FT repeat_region complement(10341999..10343376) FT /rpt_family="ERVL" FT repeat_region complement(10341381..10341988) FT /rpt_family="L1" FT repeat_region complement(10341267..10341288) FT /rpt_family="AT_rich" FT repeat_region complement(10340924..10340945) FT /rpt_family="AT_rich" FT repeat_region complement(10340590..10340674) FT /rpt_family="L1" FT repeat_region complement(10340167..10340589) FT /rpt_family="ERV1" FT repeat_region complement(10339229..10340166) FT /rpt_family="L1" FT repeat_region complement(10338610..10338726) FT /rpt_family="L1" FT repeat_region complement(10336360..10336831) FT /rpt_family="ERV1" FT repeat_region complement(10335841..10335907) FT /rpt_family="ERV1" FT repeat_region complement(10335140..10335476) FT /rpt_family="MER2_type" FT repeat_region complement(10335045..10335090) FT /rpt_family="GA-rich" FT repeat_region complement(10333934..10334418) FT /rpt_family="MaLR" FT repeat_region complement(10333394..10333440) FT /rpt_family="(CA)n" FT repeat_region complement(10332463..10332938) FT /rpt_family="L1" FT repeat_region complement(10331908..10332462) FT /rpt_family="ERV1" FT repeat_region complement(10331604..10331875) FT /rpt_family="L1" FT repeat_region complement(10331277..10331506) FT /rpt_family="L2" FT repeat_region complement(10331157..10331217) FT /rpt_family="AT_rich" FT repeat_region complement(10330957..10331057) FT /rpt_family="MER2_type" FT repeat_region complement(10330589..10330900) FT /rpt_family="Alu" FT repeat_region complement(10330362..10330587) FT /rpt_family="MER2_type" FT repeat_region complement(10328934..10329662) FT /rpt_family="L1" FT repeat_region complement(10327961..10328940) FT /rpt_family="L1" FT repeat_region complement(10327852..10327954) FT /rpt_family="(TA)n" FT repeat_region complement(10327483..10327850) FT /rpt_family="L1" FT repeat_region complement(10327430..10327482) FT /rpt_family="AT_rich" FT repeat_region complement(10326894..10326942) FT /rpt_family="AT_rich" FT repeat_region complement(10325901..10326076) FT /rpt_family="MER1_type" FT repeat_region complement(10325822..10325888) FT /rpt_family="L2" FT repeat_region complement(10325639..10325659) FT /rpt_family="AT_rich" FT repeat_region complement(10325302..10325478) FT /rpt_family="MIR" FT repeat_region complement(10324711..10324740) FT /rpt_family="(T)n" FT repeat_region complement(10324015..10324204) FT /rpt_family="MIR" FT repeat_region complement(10323171..10323280) FT /rpt_family="MIR" FT repeat_region complement(10323047..10323100) FT /rpt_family="MIR" FT repeat_region complement(10322913..10323026) FT /rpt_family="L2" FT repeat_region complement(10321718..10322154) FT /rpt_family="L1" FT repeat_region complement(10320886..10321436) FT /rpt_family="MER1_type" FT repeat_region complement(10462771..10463251) FT /rpt_family="L1" FT repeat_region complement(10460873..10461350) FT /rpt_family="MaLR" FT repeat_region complement(10460579..10460664) FT /rpt_family="MIR" FT repeat_region complement(10460480..10460541) FT /rpt_family="L2" FT repeat_region complement(10457966..10458016) FT /rpt_family="AT_rich" FT repeat_region complement(10457616..10457766) FT /rpt_family="L2" FT repeat_region complement(10456723..10457187) FT /rpt_family="L2" FT repeat_region complement(10455634..10455854) FT /rpt_family="L1" FT repeat_region complement(10455028..10455234) FT /rpt_family="MIR" FT repeat_region complement(10453754..10454730) FT /rpt_family="L1" FT repeat_region complement(10453291..10453755) FT /rpt_family="L1" FT repeat_region complement(10453255..10453290) FT /rpt_family="Mariner" FT repeat_region complement(10453112..10453254) FT /rpt_family="L1" FT repeat_region complement(10453023..10453099) FT /rpt_family="(TA)n" FT repeat_region complement(10452337..10452360) FT /rpt_family="AT_rich" FT repeat_region complement(10451582..10451886) FT /rpt_family="Alu" FT repeat_region complement(10450954..10451129) FT /rpt_family="MER1_type" FT repeat_region complement(10450353..10450379) FT /rpt_family="(TG)n" FT repeat_region complement(10449087..10449170) FT /rpt_family="L2" FT repeat_region complement(10448635..10448936) FT /rpt_family="Alu" FT repeat_region complement(10447860..10447896) FT /rpt_family="(CAAAA)n" FT repeat_region complement(10447789..10447822) FT /rpt_family="(CAAAA)n" FT repeat_region complement(10446630..10446664) FT /rpt_family="AT_rich" FT repeat_region complement(10444116..10444173) FT /rpt_family="CT-rich" FT repeat_region complement(10444022..10444032) FT /rpt_family="MIR" FT repeat_region complement(10443718..10444021) FT /rpt_family="Alu" FT repeat_region complement(10443572..10443717) FT /rpt_family="MIR" FT repeat_region complement(10442518..10442817) FT /rpt_family="MER1_type" FT repeat_region complement(10441633..10441987) FT /rpt_family="MaLR" FT repeat_region complement(10440207..10441630) FT /rpt_family="MaLR" FT repeat_region complement(10439814..10440206) FT /rpt_family="MaLR" FT repeat_region complement(10438697..10439340) FT /rpt_family="L1" FT repeat_region complement(10438519..10438696) FT /rpt_family="MIR" FT repeat_region complement(10437933..10438070) FT /rpt_family="MIR" FT repeat_region complement(10437033..10437201) FT /rpt_family="L2" FT repeat_region complement(10436364..10436911) FT /rpt_family="L2" FT repeat_region complement(10435960..10436310) FT /rpt_family="L1" FT repeat_region complement(10434910..10435831) FT /rpt_family="L1" FT repeat_region complement(10434580..10434909) FT /rpt_family="Alu" FT repeat_region complement(10434124..10434579) FT /rpt_family="L1" FT repeat_region complement(10433393..10434069) FT /rpt_family="L1" FT repeat_region complement(10433273..10433387) FT /rpt_family="(TA)n" FT repeat_region complement(10433033..10433218) FT /rpt_family="L2" FT repeat_region complement(10432560..10432589) FT /rpt_family="AT_rich" FT repeat_region complement(10430212..10430895) FT /rpt_family="ERV1" FT repeat_region complement(10429780..10429976) FT /rpt_family="MaLR" FT repeat_region complement(10429740..10429778) FT /rpt_family="MaLR" FT repeat_region complement(10429215..10429499) FT /rpt_family="Alu" FT repeat_region complement(10428687..10428890) FT /rpt_family="MER1_type" FT repeat_region complement(10426140..10426183) FT /rpt_family="AT_rich" FT repeat_region complement(10425306..10425345) FT /rpt_family="AT_rich" FT repeat_region complement(10424893..10425054) FT /rpt_family="Alu" FT repeat_region complement(10424639..10424892) FT /rpt_family="Alu" FT repeat_region complement(10424188..10424263) FT /rpt_family="Mariner" FT repeat_region complement(10423834..10423909) FT /rpt_family="L2" FT repeat_region complement(10423066..10423753) FT /rpt_family="L1" FT repeat_region complement(10418781..10418801) FT /rpt_family="AT_rich" FT repeat_region complement(10418411..10418780) FT /rpt_family="L1" FT repeat_region complement(10418359..10418399) FT /rpt_family="(CA)n" FT repeat_region complement(10538316..10538571) FT /rpt_family="Alu" FT repeat_region complement(10536137..10538315) FT /rpt_family="L1" FT repeat_region complement(10535834..10536136) FT /rpt_family="Alu" FT repeat_region complement(10535484..10535833) FT /rpt_family="L1" FT repeat_region complement(10535191..10535478) FT /rpt_family="L1" FT repeat_region complement(10534927..10535190) FT /rpt_family="L1" FT repeat_region complement(10534290..10534924) FT /rpt_family="L1" FT repeat_region complement(10534235..10534289) FT /rpt_family="ERVL" FT repeat_region complement(10534184..10534234) FT /rpt_family="(TA)n" FT repeat_region complement(10534154..10534178) FT /rpt_family="(CA)n" FT repeat_region complement(10533779..10534153) FT /rpt_family="ERVL" FT repeat_region complement(10532996..10533778) FT /rpt_family="L1" FT repeat_region complement(10532890..10532957) FT /rpt_family="MIR" FT repeat_region complement(10530790..10532521) FT /rpt_family="L1" FT repeat_region complement(10529409..10529701) FT /rpt_family="Alu" FT repeat_region complement(10528578..10528729) FT /rpt_family="MER103" FT repeat_region complement(10527866..10528082) FT /rpt_family="ERV1" FT repeat_region complement(10527563..10527865) FT /rpt_family="Alu" FT repeat_region complement(10527381..10527562) FT /rpt_family="ERV1" FT repeat_region complement(10527263..10527357) FT /rpt_family="MIR" FT repeat_region complement(10526965..10527114) FT /rpt_family="L2" FT repeat_region complement(10525653..10525912) FT /rpt_family="L2" FT repeat_region complement(10525347..10525534) FT /rpt_family="L2" FT repeat_region complement(10524722..10525296) FT /rpt_family="L2" FT repeat_region complement(10524471..10524718) FT /rpt_family="MIR" FT repeat_region complement(10524151..10524449) FT /rpt_family="L2" FT repeat_region complement(10524014..10524143) FT /rpt_family="MaLR" FT repeat_region complement(10523751..10524009) FT /rpt_family="L2" FT repeat_region complement(10523176..10523682) FT /rpt_family="L2" FT repeat_region complement(10522752..10523018) FT /rpt_family="Alu" FT repeat_region complement(10522187..10522387) FT /rpt_family="L1" FT repeat_region complement(10521821..10522185) FT /rpt_family="MaLR" FT repeat_region complement(10521771..10521802) FT /rpt_family="(GA)n" FT repeat_region complement(10521508..10521712) FT /rpt_family="MaLR" FT repeat_region complement(10521216..10521500) FT /rpt_family="L1" FT repeat_region complement(10519585..10519612) FT /rpt_family="AT_rich" FT repeat_region complement(10519409..10519450) FT /rpt_family="AT_rich" FT repeat_region complement(10518295..10518320) FT /rpt_family="AT_rich" FT repeat_region complement(10517655..10518114) FT /rpt_family="L2" FT repeat_region complement(10517080..10517306) FT /rpt_family="L1" FT repeat_region complement(10515579..10515762) FT /rpt_family="MIR" FT repeat_region complement(10514086..10514242) FT /rpt_family="L2" FT repeat_region complement(10512800..10512908) FT /rpt_family="(TA)n" FT repeat_region complement(10510966..10510986) FT /rpt_family="AT_rich" FT repeat_region complement(10510701..10510742) FT /rpt_family="(TG)n" FT repeat_region complement(10510657..10510699) FT /rpt_family="GA-rich" FT repeat_region complement(10509185..10509274) FT /rpt_family="MER103" FT repeat_region complement(10507981..10508386) FT /rpt_family="L2" FT repeat_region complement(10506995..10507057) FT /rpt_family="L1" FT repeat_region complement(10506718..10506906) FT /rpt_family="MIR" FT repeat_region complement(10506611..10506635) FT /rpt_family="(TTTA)n" FT repeat_region complement(10506506..10506593) FT /rpt_family="L1" FT repeat_region complement(10506134..10506205) FT /rpt_family="MaLR" FT repeat_region complement(10505349..10506048) FT /rpt_family="SVA" FT repeat_region complement(10504343..10505330) FT /rpt_family="SVA" FT repeat_region complement(10503946..10504316) FT /rpt_family="MaLR" FT repeat_region complement(10503638..10503828) FT /rpt_family="L1" FT repeat_region complement(10503366..10503592) FT /rpt_family="MER1_type" FT repeat_region complement(10502676..10503224) FT /rpt_family="L1" FT repeat_region complement(10501852..10502600) FT /rpt_family="L1" FT repeat_region complement(10501027..10501851) FT /rpt_family="MER2_type" FT repeat_region complement(10500040..10501026) FT /rpt_family="L1" FT repeat_region complement(10499796..10500031) FT /rpt_family="L1" FT repeat_region complement(10499770..10499795) FT /rpt_family="(TG)n" FT repeat_region complement(10498785..10499769) FT /rpt_family="L1" FT repeat_region complement(10497711..10498784) FT /rpt_family="ERVK" FT repeat_region complement(10495514..10497710) FT /rpt_family="L1" FT repeat_region complement(10494515..10495284) FT /rpt_family="L1" FT repeat_region complement(10494339..10494447) FT /rpt_family="MER2_type" FT repeat_region complement(10493762..10494244) FT /rpt_family="L2" FT repeat_region complement(10493450..10493761) FT /rpt_family="Alu" FT repeat_region complement(10493247..10493449) FT /rpt_family="L2" FT repeat_region complement(10488355..10489986) FT /rpt_family="L1" FT repeat_region complement(10483479..10483777) FT /rpt_family="Alu" FT repeat_region complement(10481342..10481488) FT /rpt_family="L1" FT repeat_region complement(10480943..10481125) FT /rpt_family="L1" FT repeat_region complement(10480502..10480623) FT /rpt_family="MIR" FT repeat_region complement(10480104..10480260) FT /rpt_family="MaLR" FT repeat_region complement(10479802..10480103) FT /rpt_family="Alu" FT repeat_region complement(10479577..10479801) FT /rpt_family="MaLR" FT repeat_region complement(10479497..10479528) FT /rpt_family="AT_rich" FT repeat_region complement(10477995..10478032) FT /rpt_family="(TG)n" FT repeat_region complement(10477325..10477775) FT /rpt_family="AcHobo" FT repeat_region complement(10476932..10477339) FT /rpt_family="AcHobo" FT repeat_region complement(10476770..10476931) FT /rpt_family="AcHobo" FT repeat_region complement(10476231..10476408) FT /rpt_family="AcHobo" FT repeat_region complement(10475692..10476032) FT /rpt_family="L1" FT repeat_region complement(10475272..10475411) FT /rpt_family="L2" FT repeat_region complement(10475109..10475191) FT /rpt_family="L2" FT repeat_region complement(10474888..10475108) FT /rpt_family="MER1_type" FT repeat_region complement(10474217..10474887) FT /rpt_family="L2" FT repeat_region complement(10473913..10474216) FT /rpt_family="Alu" FT repeat_region complement(10473392..10473912) FT /rpt_family="L2" FT repeat_region complement(10472767..10473125) FT /rpt_family="L1" FT repeat_region complement(10472340..10472608) FT /rpt_family="L1" FT repeat_region complement(10471842..10472129) FT /rpt_family="Alu" FT repeat_region complement(10471598..10471775) FT /rpt_family="MaLR" FT repeat_region complement(10471262..10471595) FT /rpt_family="L1" FT repeat_region complement(10471159..10471258) FT /rpt_family="L1" FT repeat_region complement(10471074..10471157) FT /rpt_family="(TA)n" FT repeat_region complement(10470848..10470873) FT /rpt_family="AT_rich" FT repeat_region complement(10468992..10469101) FT /rpt_family="CR1" FT repeat_region complement(10468237..10468401) FT /rpt_family="MER1_type" FT repeat_region complement(10467623..10467655) FT /rpt_family="AT_rich" FT repeat_region complement(10467048..10467472) FT /rpt_family="ERVL" FT repeat_region complement(10465797..10467047) FT /rpt_family="L1" FT repeat_region complement(10464312..10465814) FT /rpt_family="L1" FT repeat_region complement(10463351..10464309) FT /rpt_family="L1" FT repeat_region complement(10463061..10463350) FT /rpt_family="L1" FT repeat_region complement(10705292..10705407) FT /rpt_family="L2" FT repeat_region complement(10704801..10704827) FT /rpt_family="(TAA)n" FT repeat_region complement(10704613..10704657) FT /rpt_family="AT_rich" FT repeat_region complement(10704526..10704561) FT /rpt_family="AT_rich" FT repeat_region complement(10704228..10704525) FT /rpt_family="Alu" FT repeat_region complement(10704176..10704226) FT /rpt_family="(TCTG)n" FT repeat_region complement(10703756..10703912) FT /rpt_family="MIR" FT repeat_region complement(10703052..10703209) FT /rpt_family="MIR" FT repeat_region complement(10702111..10702144) FT /rpt_family="AT_rich" FT repeat_region complement(10701592..10701627) FT /rpt_family="AT_rich" FT repeat_region complement(10701256..10701566) FT /rpt_family="MER2_type" FT repeat_region complement(10700795..10701254) FT /rpt_family="MER1_type" FT repeat_region complement(10700773..10700794) FT /rpt_family="AT_rich" FT repeat_region complement(10700569..10700706) FT /rpt_family="MER1_type" FT repeat_region complement(10699352..10699377) FT /rpt_family="(CA)n" FT repeat_region complement(10698988..10699016) FT /rpt_family="AT_rich" FT repeat_region complement(10698181..10698344) FT /rpt_family="MIR" FT repeat_region complement(10696746..10696832) FT /rpt_family="MIR" FT repeat_region complement(10696627..10696752) FT /rpt_family="L2" FT repeat_region complement(10695867..10696613) FT /rpt_family="L2" FT repeat_region complement(10695842..10695864) FT /rpt_family="(TGAA)n" FT repeat_region complement(10695640..10695664) FT /rpt_family="AT_rich" FT repeat_region complement(10695037..10695382) FT /rpt_family="MER1_type" FT repeat_region complement(10693500..10693796) FT /rpt_family="Alu" FT misc_feature complement(10693499..10693764) FT /note="CpG_island (%GC=63.9, o/e=0.96, #CpGs=27)" FT repeat_region complement(10692553..10692863) FT /rpt_family="Alu" FT repeat_region complement(10691570..10691611) FT /rpt_family="AT_rich" FT repeat_region complement(10691180..10691527) FT /rpt_family="L1" FT repeat_region complement(10690821..10690882) FT /rpt_family="MER1_type" FT repeat_region complement(10690318..10690710) FT /rpt_family="MER1_type" FT repeat_region complement(10689964..10690317) FT /rpt_family="MaLR" FT repeat_region complement(10688053..10688404) FT /rpt_family="MaLR" FT repeat_region complement(10687845..10688052) FT /rpt_family="MER1_type" FT repeat_region complement(10686640..10686685) FT /rpt_family="(TTCA)n" FT repeat_region complement(10686524..10686636) FT /rpt_family="L2" FT repeat_region complement(10683545..10683644) FT /rpt_family="MIR" FT repeat_region complement(10682731..10682780) FT /rpt_family="(TG)n" FT repeat_region complement(10681958..10681993) FT /rpt_family="AT_rich" FT repeat_region complement(10681142..10681212) FT /rpt_family="AT_rich" FT repeat_region complement(10678605..10678632) FT /rpt_family="AT_rich" FT repeat_region complement(10678407..10678560) FT /rpt_family="MIR" FT repeat_region complement(10678255..10678350) FT /rpt_family="L2" FT repeat_region complement(10677431..10677801) FT /rpt_family="MaLR" FT repeat_region complement(10677057..10677430) FT /rpt_family="MaLR" FT repeat_region complement(10676755..10677056) FT /rpt_family="Alu" FT repeat_region complement(10676711..10676754) FT /rpt_family="MaLR" FT repeat_region complement(10676556..10676710) FT /rpt_family="MaLR" FT repeat_region complement(10676134..10676235) FT /rpt_family="MaLR" FT repeat_region complement(10675524..10675545) FT /rpt_family="AT_rich" FT repeat_region complement(10675252..10675523) FT /rpt_family="Alu" FT repeat_region complement(10674763..10675113) FT /rpt_family="MaLR" FT repeat_region complement(10674438..10674495) FT /rpt_family="AT_rich" FT repeat_region complement(10674243..10674294) FT /rpt_family="AT_rich" FT repeat_region complement(10674018..10674156) FT /rpt_family="MaLR" FT repeat_region complement(10672432..10672635) FT /rpt_family="MaLR" FT repeat_region complement(10671487..10671868) FT /rpt_family="L1" FT repeat_region complement(10666193..10666491) FT /rpt_family="Alu" FT repeat_region complement(10664521..10664693) FT /rpt_family="L1" FT repeat_region complement(10664226..10664520) FT /rpt_family="Alu" FT repeat_region complement(10664025..10664225) FT /rpt_family="L1" FT repeat_region complement(10663619..10664004) FT /rpt_family="MaLR" FT repeat_region complement(10663024..10663065) FT /rpt_family="A-rich" FT repeat_region complement(10662357..10662539) FT /rpt_family="(TTTC)n" FT repeat_region complement(10662043..10662350) FT /rpt_family="Alu" FT repeat_region complement(10661671..10661729) FT /rpt_family="MER1_type" FT repeat_region complement(10661580..10661624) FT /rpt_family="(TG)n" FT repeat_region complement(10661265..10661557) FT /rpt_family="Alu" FT repeat_region complement(10660882..10661007) FT /rpt_family="ERVL" FT repeat_region complement(10660509..10660859) FT /rpt_family="MaLR" FT repeat_region complement(10660304..10660452) FT /rpt_family="MER1_type" FT repeat_region complement(10659412..10659838) FT /rpt_family="MaLR" FT repeat_region complement(10657576..10657893) FT /rpt_family="L1" FT repeat_region complement(10657276..10657574) FT /rpt_family="MaLR" FT repeat_region complement(10656123..10657265) FT /rpt_family="L1" FT repeat_region complement(10655745..10656120) FT /rpt_family="MER2_type" FT repeat_region complement(10655427..10655733) FT /rpt_family="L1" FT repeat_region complement(10654797..10655428) FT /rpt_family="L1" FT repeat_region complement(10654523..10654746) FT /rpt_family="MaLR" FT repeat_region complement(10654072..10654494) FT /rpt_family="L1" FT repeat_region complement(10653684..10654066) FT /rpt_family="L1" FT repeat_region complement(10653365..10653683) FT /rpt_family="Alu" FT repeat_region complement(10652952..10653102) FT /rpt_family="MIR" FT repeat_region complement(10651438..10652017) FT /rpt_family="ERVL" FT repeat_region complement(10650475..10650514) FT /rpt_family="AT_rich" FT repeat_region complement(10650168..10650472) FT /rpt_family="Alu" FT misc_feature complement(10650192..10650425) FT /note="CpG_island (%GC=58.1, o/e=0.82, #CpGs=18)" FT repeat_region complement(10648951..10649143) FT /rpt_family="MaLR" FT repeat_region complement(10648324..10648949) FT /rpt_family="L2" FT repeat_region complement(10648022..10648323) FT /rpt_family="Alu" FT repeat_region complement(10647335..10648021) FT /rpt_family="L2" FT repeat_region complement(10646701..10647334) FT /rpt_family="MaLR" FT repeat_region complement(10645942..10646700) FT /rpt_family="L2" FT repeat_region complement(10645103..10645883) FT /rpt_family="L1" FT repeat_region complement(10641948..10642078) FT /rpt_family="L2" FT repeat_region complement(10641531..10641556) FT /rpt_family="AT_rich" FT repeat_region complement(10641231..10641439) FT /rpt_family="MIR" FT repeat_region complement(10640611..10641049) FT /rpt_family="MaLR" FT repeat_region complement(10639819..10640176) FT /rpt_family="MaLR" FT repeat_region complement(10638952..10639369) FT /rpt_family="ERV1" FT repeat_region complement(10638521..10638541) FT /rpt_family="AT_rich" FT repeat_region complement(10638188..10638520) FT /rpt_family="L1" FT repeat_region complement(10638104..10638168) FT /rpt_family="AT_rich" FT repeat_region complement(10637572..10637924) FT /rpt_family="L1" FT repeat_region complement(10637489..10637549) FT /rpt_family="A-rich" FT repeat_region complement(10636647..10636802) FT /rpt_family="MER1_type" FT repeat_region complement(10636448..10636633) FT /rpt_family="MER1_type" FT repeat_region complement(10634909..10635219) FT /rpt_family="Alu" FT repeat_region complement(10634695..10634874) FT /rpt_family="MIR" FT repeat_region complement(10633590..10633632) FT /rpt_family="AT_rich" FT repeat_region complement(10632706..10632869) FT /rpt_family="MER1_type" FT repeat_region complement(10632066..10632686) FT /rpt_family="AcHobo" FT repeat_region complement(10631751..10632065) FT /rpt_family="Alu" FT repeat_region complement(10631465..10631750) FT /rpt_family="AcHobo" FT repeat_region complement(10631238..10631277) FT /rpt_family="(TC)n" FT repeat_region complement(10631214..10631238) FT /rpt_family="(TA)n" FT repeat_region complement(10630280..10631069) FT /rpt_family="L1" FT repeat_region complement(10630178..10630230) FT /rpt_family="Mariner" FT repeat_region complement(10630071..10630168) FT /rpt_family="L1" FT repeat_region complement(10628681..10628842) FT /rpt_family="MER1_type" FT repeat_region complement(10628200..10628225) FT /rpt_family="AT_rich" FT repeat_region complement(10625966..10626564) FT /rpt_family="L1" FT repeat_region complement(10625146..10625171) FT /rpt_family="(A)n" FT repeat_region complement(10624580..10624672) FT /rpt_family="MIR" FT repeat_region complement(10623327..10623693) FT /rpt_family="MER2_type" FT repeat_region complement(10621275..10621459) FT /rpt_family="L2" FT repeat_region complement(10621102..10621274) FT /rpt_family="L1" FT repeat_region complement(10620901..10621106) FT /rpt_family="L1" FT repeat_region complement(10620767..10620897) FT /rpt_family="L2" FT repeat_region complement(10620516..10620752) FT /rpt_family="L2" FT repeat_region complement(10620304..10620406) FT /rpt_family="MER1_type" FT repeat_region complement(10620030..10620204) FT /rpt_family="Alu" FT repeat_region complement(10620009..10620029) FT /rpt_family="(TA)n" FT repeat_region complement(10619711..10620008) FT /rpt_family="Alu" FT repeat_region complement(10619577..10619710) FT /rpt_family="Alu" FT repeat_region complement(10618544..10618776) FT /rpt_family="L1" FT repeat_region complement(10618404..10618423) FT /rpt_family="(CAA)n" FT repeat_region complement(10617264..10617328) FT /rpt_family="L1" FT repeat_region complement(10615517..10615537) FT /rpt_family="(T)n" FT repeat_region complement(10614744..10615046) FT /rpt_family="CR1" FT repeat_region complement(10613837..10613859) FT /rpt_family="AT_rich" FT repeat_region complement(10613515..10613820) FT /rpt_family="MaLR" FT repeat_region complement(10613111..10613338) FT /rpt_family="MIR" FT repeat_region complement(10612410..10612446) FT /rpt_family="(TTA)n" FT repeat_region complement(10611882..10612165) FT /rpt_family="Alu" FT repeat_region complement(10610144..10610673) FT /rpt_family="MER2_type" FT repeat_region complement(10609344..10609496) FT /rpt_family="MIR" FT repeat_region complement(10608637..10609256) FT /rpt_family="L2" FT repeat_region complement(10608157..10608459) FT /rpt_family="L1" FT repeat_region complement(10607859..10608156) FT /rpt_family="Alu" FT misc_feature complement(10607858..10608137) FT /note="CpG_island (%GC=60.4, o/e=0.72, #CpGs=21)" FT repeat_region complement(10607654..10607858) FT /rpt_family="L1" FT repeat_region complement(10607620..10607653) FT /rpt_family="(TTTTA)n" FT repeat_region complement(10607602..10607619) FT /rpt_family="L1" FT repeat_region complement(10606073..10607601) FT /rpt_family="L1" FT repeat_region complement(10605930..10606054) FT /rpt_family="L1" FT repeat_region complement(10604510..10605908) FT /rpt_family="L1" FT repeat_region complement(10604114..10604444) FT /rpt_family="L1" FT repeat_region complement(10603411..10603700) FT /rpt_family="Alu" FT repeat_region complement(10603011..10603410) FT /rpt_family="ERV1" FT repeat_region complement(10602469..10602496) FT /rpt_family="AT_rich" FT repeat_region complement(10602285..10602323) FT /rpt_family="AT_rich" FT repeat_region complement(10601418..10601826) FT /rpt_family="ERV1" FT repeat_region complement(10601155..10601430) FT /rpt_family="ERV1" FT repeat_region complement(10600534..10600893) FT /rpt_family="MaLR" FT repeat_region complement(10600026..10600442) FT /rpt_family="ERVL" FT repeat_region complement(10599853..10600020) FT /rpt_family="(TA)n" FT repeat_region complement(10599800..10599851) FT /rpt_family="ERVL" FT repeat_region complement(10596604..10596914) FT /rpt_family="Alu" FT repeat_region complement(10595968..10596540) FT /rpt_family="L1" FT repeat_region complement(10594677..10595943) FT /rpt_family="L1" FT repeat_region complement(10594002..10594071) FT /rpt_family="CR1" FT repeat_region complement(10593689..10593930) FT /rpt_family="CR1" FT repeat_region complement(10593281..10593308) FT /rpt_family="AT_rich" FT repeat_region complement(10591122..10591313) FT /rpt_family="ERV1" FT repeat_region complement(10590579..10591121) FT /rpt_family="ERVL" FT repeat_region complement(10590192..10590578) FT /rpt_family="ERV1" FT repeat_region complement(10589753..10589804) FT /rpt_family="MIR" FT repeat_region complement(10588860..10589111) FT /rpt_family="MER2_type" FT repeat_region complement(10588737..10588861) FT /rpt_family="MER2_type" FT repeat_region complement(10587010..10587165) FT /rpt_family="L2" FT repeat_region complement(10586710..10586912) FT /rpt_family="MER53" FT repeat_region complement(10586125..10586151) FT /rpt_family="(TTTA)n" FT repeat_region complement(10584593..10586020) FT /rpt_family="L2" FT repeat_region complement(10584510..10584580) FT /rpt_family="L2" FT repeat_region complement(10584225..10584257) FT /rpt_family="AT_rich" FT repeat_region complement(10582054..10582110) FT /rpt_family="(CA)n" FT repeat_region complement(10581046..10581089) FT /rpt_family="(TCTG)n" FT repeat_region complement(10580390..10580699) FT /rpt_family="MaLR" FT repeat_region complement(10579316..10579524) FT /rpt_family="MIR" FT repeat_region complement(10578859..10578937) FT /rpt_family="(TA)n" FT repeat_region complement(10575618..10576135) FT /rpt_family="L1" FT repeat_region complement(10566056..10567062) FT /rpt_family="L1" FT repeat_region complement(10565654..10566055) FT /rpt_family="L1" FT repeat_region complement(10565519..10565654) FT /rpt_family="L1" FT repeat_region complement(10565313..10565509) FT /rpt_family="MIR" FT repeat_region complement(10564908..10565065) FT /rpt_family="Alu" FT repeat_region complement(10564246..10564272) FT /rpt_family="(CAAA)n" FT repeat_region complement(10563803..10563896) FT /rpt_family="L1" FT repeat_region complement(10563338..10563787) FT /rpt_family="L1" FT repeat_region complement(10563155..10563249) FT /rpt_family="L1" FT repeat_region complement(10562638..10563045) FT /rpt_family="MaLR" FT repeat_region complement(10561168..10561580) FT /rpt_family="L2" FT repeat_region complement(10560793..10560828) FT /rpt_family="(TG)n" FT repeat_region complement(10559524..10559649) FT /rpt_family="L2" FT repeat_region complement(10559034..10559179) FT /rpt_family="MER1_type" FT repeat_region complement(10558915..10559029) FT /rpt_family="L2" FT repeat_region complement(10558150..10558334) FT /rpt_family="L2" FT repeat_region complement(10557785..10558116) FT /rpt_family="L2" FT repeat_region complement(10556749..10557283) FT /rpt_family="L1" FT repeat_region complement(10556286..10556736) FT /rpt_family="L2" FT repeat_region complement(10556073..10556274) FT /rpt_family="L2" FT repeat_region complement(10555005..10555062) FT /rpt_family="L1" FT repeat_region complement(10553017..10554118) FT /rpt_family="L1" FT repeat_region complement(10552684..10553016) FT /rpt_family="MER2_type" FT repeat_region complement(10549530..10552683) FT /rpt_family="L1" FT repeat_region complement(10548851..10549533) FT /rpt_family="L1" FT repeat_region complement(10546798..10548848) FT /rpt_family="L1" FT repeat_region complement(10546724..10546780) FT /rpt_family="T-rich" FT repeat_region complement(10538372..10538600) FT /rpt_family="Alu" FT repeat_region complement(10746237..10746478) FT /rpt_family="L1" FT repeat_region complement(10745981..10746177) FT /rpt_family="MIR" FT repeat_region complement(10744928..10745579) FT /rpt_family="L1" FT repeat_region complement(10744667..10744922) FT /rpt_family="MER1_type" FT repeat_region complement(10743188..10744152) FT /rpt_family="MER2_type" FT repeat_region complement(10741696..10743191) FT /rpt_family="MER2_type" FT repeat_region complement(10733958..10734363) FT /rpt_family="L2" FT repeat_region complement(10733787..10733949) FT /rpt_family="MER1_type" FT repeat_region complement(10733146..10733778) FT /rpt_family="L1" FT repeat_region complement(10732956..10733122) FT /rpt_family="L2" FT repeat_region complement(10731771..10731823) FT /rpt_family="(TATG)n" FT repeat_region complement(10731410..10731677) FT /rpt_family="Alu" FT repeat_region complement(10730876..10731190) FT /rpt_family="Alu" FT repeat_region complement(10730419..10730468) FT /rpt_family="T-rich" FT repeat_region complement(10729583..10730414) FT /rpt_family="L1" FT repeat_region complement(10729510..10729582) FT /rpt_family="Alu" FT repeat_region complement(10721089..10721225) FT /rpt_family="MIR" FT repeat_region complement(10720909..10721011) FT /rpt_family="MIR" FT repeat_region complement(10719766..10719795) FT /rpt_family="AT_rich" FT repeat_region complement(10718341..10718479) FT /rpt_family="AcHobo" FT repeat_region complement(10717438..10717833) FT /rpt_family="ERVL" FT repeat_region complement(10717231..10717260) FT /rpt_family="AT_rich" FT repeat_region complement(10716522..10716612) FT /rpt_family="L2" FT repeat_region complement(10716095..10716508) FT /rpt_family="L1" FT repeat_region complement(10713276..10713427) FT /rpt_family="Tc2" FT repeat_region complement(10710540..10712459) FT /rpt_family="L1" FT repeat_region complement(10856294..10856518) FT /rpt_family="MaLR" FT repeat_region complement(10855979..10856172) FT /rpt_family="L2" FT repeat_region complement(10855591..10855960) FT /rpt_family="MaLR" FT repeat_region complement(10855494..10855578) FT /rpt_family="L2" FT repeat_region complement(10855437..10855491) FT /rpt_family="MaLR" FT repeat_region complement(10855136..10855429) FT /rpt_family="L2" FT repeat_region complement(10853352..10853508) FT /rpt_family="MIR" FT repeat_region complement(10845503..10845522) FT /rpt_family="(TAAA)n" FT repeat_region complement(10845159..10845269) FT /rpt_family="MIR" FT repeat_region complement(10844811..10845152) FT /rpt_family="L1" FT repeat_region complement(10844340..10844417) FT /rpt_family="MIR" FT repeat_region complement(10843303..10843333) FT /rpt_family="AT_rich" FT repeat_region complement(10842397..10842724) FT /rpt_family="MaLR" FT repeat_region complement(10842160..10842196) FT /rpt_family="AT_rich" FT repeat_region complement(10841878..10842065) FT /rpt_family="MER1_type" FT repeat_region complement(10840809..10840849) FT /rpt_family="AT_rich" FT repeat_region complement(10838234..10838430) FT /rpt_family="L1" FT repeat_region complement(10835496..10835721) FT /rpt_family="L2" FT repeat_region complement(10835127..10835426) FT /rpt_family="Alu" FT repeat_region complement(10835044..10835078) FT /rpt_family="(TG)n" FT repeat_region complement(10834919..10835038) FT /rpt_family="Alu" FT repeat_region complement(10834738..10834885) FT /rpt_family="(TA)n" FT repeat_region complement(10834569..10834610) FT /rpt_family="AT_rich" FT repeat_region complement(10833467..10834241) FT /rpt_family="L1" FT repeat_region complement(10832171..10832199) FT /rpt_family="AT_rich" FT repeat_region complement(10832063..10832170) FT /rpt_family="L1" FT repeat_region complement(10831953..10832049) FT /rpt_family="L2" FT repeat_region complement(10830377..10830916) FT /rpt_family="MER2_type" FT repeat_region complement(10827900..10828719) FT /rpt_family="L1" FT repeat_region complement(10827837..10827871) FT /rpt_family="AT_rich" FT repeat_region complement(10826524..10826806) FT /rpt_family="Alu" FT repeat_region complement(10826260..10826463) FT /rpt_family="Alu" FT repeat_region complement(10825649..10825956) FT /rpt_family="Alu" FT repeat_region complement(10825609..10825648) FT /rpt_family="(TA)n" FT repeat_region complement(10824403..10824427) FT /rpt_family="AT_rich" FT repeat_region complement(10824082..10824117) FT /rpt_family="(TA)n" FT repeat_region complement(10823700..10823993) FT /rpt_family="L1" FT repeat_region complement(10822959..10823319) FT /rpt_family="L1" FT repeat_region complement(10822465..10822665) FT /rpt_family="L1" FT repeat_region complement(10822156..10822464) FT /rpt_family="Alu" FT repeat_region complement(10821540..10822155) FT /rpt_family="L1" FT repeat_region complement(10821490..10821539) FT /rpt_family="AT_rich" FT repeat_region complement(10821343..10821476) FT /rpt_family="L1" FT repeat_region complement(10820378..10820407) FT /rpt_family="AT_rich" FT misc_feature complement(10819306..10819710) FT /note="CpG_island (%GC=65.9, o/e=0.84, #CpGs=31)" FT repeat_region complement(10817417..10818360) FT /rpt_family="L1" FT repeat_region complement(10817117..10817414) FT /rpt_family="L1" FT repeat_region complement(10816328..10816378) FT /rpt_family="(CA)n" FT repeat_region complement(10815503..10815931) FT /rpt_family="L1" FT repeat_region complement(10815240..10815501) FT /rpt_family="L1" FT repeat_region complement(10814945..10815239) FT /rpt_family="Alu" FT repeat_region complement(10814898..10814944) FT /rpt_family="L1" FT repeat_region complement(10813759..10813851) FT /rpt_family="MIR" FT repeat_region complement(10811399..10811663) FT /rpt_family="L1" FT repeat_region complement(10810634..10811165) FT /rpt_family="L1" FT repeat_region complement(10810227..10810443) FT /rpt_family="MIR" FT repeat_region complement(10809226..10809726) FT /rpt_family="ERVL" FT repeat_region complement(10808830..10808953) FT /rpt_family="MaLR" FT repeat_region complement(10808460..10808494) FT /rpt_family="AT_rich" FT repeat_region complement(10807066..10807367) FT /rpt_family="Alu" FT repeat_region complement(10806362..10806449) FT /rpt_family="L2" FT repeat_region complement(10804300..10804381) FT /rpt_family="MIR" FT repeat_region complement(10803649..10803704) FT /rpt_family="L2" FT repeat_region complement(10803541..10803583) FT /rpt_family="(TG)n" FT repeat_region complement(10802879..10803258) FT /rpt_family="MaLR" FT repeat_region complement(10801962..10802352) FT /rpt_family="MaLR" FT repeat_region complement(10800982..10801100) FT /rpt_family="L1" FT repeat_region complement(10800679..10800981) FT /rpt_family="Alu" FT repeat_region complement(10800542..10800678) FT /rpt_family="L1" FT repeat_region complement(10798886..10799427) FT /rpt_family="ERV1" FT repeat_region complement(10798681..10798861) FT /rpt_family="MIR" FT repeat_region complement(10798185..10798252) FT /rpt_family="MIR" FT repeat_region complement(10797696..10797954) FT /rpt_family="Alu" FT repeat_region complement(10795498..10795657) FT /rpt_family="MIR" FT repeat_region complement(10794683..10794764) FT /rpt_family="ERVL" FT repeat_region complement(10794296..10794513) FT /rpt_family="Mariner" FT repeat_region complement(10794224..10794276) FT /rpt_family="(CA)n" FT repeat_region complement(10793038..10794027) FT /rpt_family="L1" FT repeat_region complement(10792855..10793026) FT /rpt_family="CR1" FT repeat_region complement(10780526..10780672) FT /rpt_family="MaLR" FT repeat_region complement(10779638..10779758) FT /rpt_family="L2" FT repeat_region complement(10778853..10779161) FT /rpt_family="Alu" FT repeat_region complement(10778517..10778687) FT /rpt_family="MIR" FT repeat_region complement(10778259..10778438) FT /rpt_family="MER1_type" FT repeat_region complement(10777178..10777775) FT /rpt_family="L2" FT repeat_region complement(10776714..10776838) FT /rpt_family="MIR" FT repeat_region complement(10776598..10776675) FT /rpt_family="CR1" FT repeat_region complement(10775460..10775707) FT /rpt_family="MaLR" FT repeat_region complement(10775276..10775386) FT /rpt_family="ERVL" FT repeat_region complement(10774720..10774878) FT /rpt_family="MaLR" FT repeat_region complement(10773781..10774170) FT /rpt_family="MaLR" FT repeat_region complement(10773010..10773131) FT /rpt_family="Alu" FT repeat_region complement(10772589..10772801) FT /rpt_family="MaLR" FT repeat_region complement(10771485..10771529) FT /rpt_family="(AGTTG)n" FT repeat_region complement(10770962..10771317) FT /rpt_family="MaLR" FT repeat_region complement(10769951..10770211) FT /rpt_family="Alu" FT repeat_region complement(10769452..10769615) FT /rpt_family="MIR" FT repeat_region complement(10769298..10769468) FT /rpt_family="MIR" FT repeat_region complement(10769063..10769083) FT /rpt_family="AT_rich" FT repeat_region complement(10768149..10768255) FT /rpt_family="L1" FT repeat_region complement(10768039..10768148) FT /rpt_family="L1" FT repeat_region complement(10767896..10768007) FT /rpt_family="L2" FT repeat_region complement(10766529..10766599) FT /rpt_family="Tc2" FT repeat_region complement(10766207..10766513) FT /rpt_family="Alu" FT repeat_region complement(10764818..10765145) FT /rpt_family="MaLR" FT repeat_region complement(10763373..10763405) FT /rpt_family="(CA)n" FT repeat_region complement(10763273..10763350) FT /rpt_family="(GA)n" FT repeat_region complement(10762992..10763271) FT /rpt_family="Alu" FT repeat_region complement(10762537..10762863) FT /rpt_family="MaLR" FT repeat_region complement(10761010..10761241) FT /rpt_family="MIR" FT repeat_region complement(10759613..10759650) FT /rpt_family="GA-rich" FT repeat_region complement(10758308..10758438) FT /rpt_family="Alu" FT repeat_region complement(10757422..10757521) FT /rpt_family="MIR" FT repeat_region complement(10756228..10756462) FT /rpt_family="L1" FT repeat_region complement(10755603..10756141) FT /rpt_family="MaLR" FT repeat_region complement(10755302..10755333) FT /rpt_family="AT_rich" FT repeat_region complement(10754627..10754935) FT /rpt_family="MaLR" FT repeat_region complement(10753836..10753951) FT /rpt_family="Alu" FT repeat_region complement(10752821..10753140) FT /rpt_family="MER2_type" FT repeat_region complement(10751809..10751993) FT /rpt_family="MER53" FT repeat_region complement(10751550..10751757) FT /rpt_family="MIR" FT repeat_region complement(10750091..10750291) FT /rpt_family="MIR" FT repeat_region complement(10749711..10749851) FT /rpt_family="MIR" FT repeat_region complement(10749285..10749343) FT /rpt_family="AT_rich" FT repeat_region complement(10748777..10749284) FT /rpt_family="L1" FT repeat_region complement(10938408..10938542) FT /rpt_family="Alu" FT repeat_region complement(10938325..10938352) FT /rpt_family="AT_rich" FT repeat_region complement(10938158..10938321) FT /rpt_family="L1" FT repeat_region complement(10937859..10938157) FT /rpt_family="Alu" FT repeat_region complement(10937094..10937858) FT /rpt_family="L1" FT repeat_region complement(10936782..10937093) FT /rpt_family="Alu" FT repeat_region complement(10935578..10936781) FT /rpt_family="L1" FT repeat_region complement(10935366..10935512) FT /rpt_family="L1" FT repeat_region complement(10935070..10935365) FT /rpt_family="Alu" FT repeat_region complement(10934970..10935069) FT /rpt_family="L1" FT repeat_region complement(10933254..10934702) FT /rpt_family="L2" FT repeat_region complement(10932849..10933253) FT /rpt_family="MaLR" FT repeat_region complement(10931750..10932848) FT /rpt_family="L2" FT repeat_region complement(10931503..10931631) FT /rpt_family="L2" FT repeat_region complement(10930835..10930932) FT /rpt_family="L1" FT repeat_region complement(10929994..10930291) FT /rpt_family="Alu" FT repeat_region complement(10929810..10929955) FT /rpt_family="L1" FT repeat_region complement(10929427..10929730) FT /rpt_family="Alu" FT repeat_region complement(10928356..10928536) FT /rpt_family="MIR" FT repeat_region complement(10927469..10927772) FT /rpt_family="Alu" FT repeat_region complement(10926289..10926319) FT /rpt_family="(TG)n" FT repeat_region complement(10926025..10926046) FT /rpt_family="(TA)n" FT repeat_region complement(10925864..10926024) FT /rpt_family="Alu" FT repeat_region complement(10925823..10925847) FT /rpt_family="(T)n" FT repeat_region complement(10925321..10925452) FT /rpt_family="Alu" FT repeat_region complement(10925181..10925320) FT /rpt_family="Alu" FT repeat_region complement(10924431..10925180) FT /rpt_family="L1" FT repeat_region complement(10924233..10924430) FT /rpt_family="Alu" FT repeat_region complement(10923910..10924209) FT /rpt_family="Alu" FT repeat_region complement(10922692..10923479) FT /rpt_family="L1" FT repeat_region complement(10922296..10922672) FT /rpt_family="L1" FT repeat_region complement(10921670..10922295) FT /rpt_family="ERV1" FT repeat_region complement(10920672..10921669) FT /rpt_family="L1" FT repeat_region complement(10919952..10920151) FT /rpt_family="L1" FT repeat_region complement(10918164..10918471) FT /rpt_family="Alu" FT repeat_region complement(10915587..10917462) FT /rpt_family="L1" FT repeat_region complement(10915323..10915442) FT /rpt_family="MIR" FT repeat_region complement(10915029..10915322) FT /rpt_family="L1" FT repeat_region complement(10914990..10915028) FT /rpt_family="MIR" FT repeat_region complement(10914391..10914989) FT /rpt_family="ERV1" FT repeat_region complement(10914311..10914390) FT /rpt_family="MIR" FT repeat_region complement(10914184..10914296) FT /rpt_family="MIR" FT repeat_region complement(10913309..10913456) FT /rpt_family="MER103" FT repeat_region complement(10913127..10913251) FT /rpt_family="MIR" FT repeat_region complement(10912825..10913025) FT /rpt_family="L2" FT repeat_region complement(10912397..10912520) FT /rpt_family="MER103" FT repeat_region complement(10911688..10911752) FT /rpt_family="(TA)n" FT repeat_region complement(10911337..10911371) FT /rpt_family="AT_rich" FT repeat_region complement(10909806..10909932) FT /rpt_family="Alu" FT repeat_region complement(10909514..10909798) FT /rpt_family="Alu" FT repeat_region complement(10909094..10909223) FT /rpt_family="MIR" FT repeat_region complement(10908312..10908835) FT /rpt_family="ERVL" FT repeat_region complement(10907616..10907856) FT /rpt_family="L2" FT repeat_region complement(10907080..10907107) FT /rpt_family="AT_rich" FT repeat_region complement(10906190..10906502) FT /rpt_family="Alu" FT repeat_region complement(10906074..10906101) FT /rpt_family="AT_rich" FT repeat_region complement(10905482..10905814) FT /rpt_family="L1" FT repeat_region complement(10904808..10904921) FT /rpt_family="Alu" FT repeat_region complement(10904208..10904247) FT /rpt_family="AT_rich" FT repeat_region complement(10903441..10903779) FT /rpt_family="L1" FT repeat_region complement(10903147..10903440) FT /rpt_family="Alu" FT repeat_region complement(10902814..10903146) FT /rpt_family="L1" FT repeat_region complement(10902645..10902774) FT /rpt_family="Alu" FT repeat_region complement(10901977..10902621) FT /rpt_family="L1" FT repeat_region complement(10901939..10901971) FT /rpt_family="(TC)n" FT repeat_region complement(10901454..10901938) FT /rpt_family="ERVL" FT repeat_region complement(10901187..10901230) FT /rpt_family="(TG)n" FT repeat_region complement(10900829..10901137) FT /rpt_family="Alu" FT repeat_region complement(10900606..10900718) FT /rpt_family="L1" FT repeat_region complement(10899948..10900117) FT /rpt_family="CT-rich" FT repeat_region complement(10898686..10898969) FT /rpt_family="Alu" FT repeat_region complement(10897846..10898019) FT /rpt_family="ERVL" FT repeat_region complement(10897418..10897631) FT /rpt_family="ERVL" FT repeat_region complement(10896895..10897190) FT /rpt_family="Alu" FT repeat_region complement(10896643..10896767) FT /rpt_family="L2" FT repeat_region complement(10896597..10896632) FT /rpt_family="(TG)n" FT repeat_region complement(10895630..10896009) FT /rpt_family="L1" FT repeat_region complement(10894336..10895622) FT /rpt_family="ERV1" FT repeat_region complement(10894282..10894320) FT /rpt_family="(TC)n" FT repeat_region complement(10894248..10894282) FT /rpt_family="(TG)n" FT repeat_region complement(10893932..10894232) FT /rpt_family="Alu" FT repeat_region complement(10893070..10893518) FT /rpt_family="L1" FT repeat_region complement(10892771..10893069) FT /rpt_family="Alu" FT repeat_region complement(10892471..10892770) FT /rpt_family="L1" FT repeat_region complement(10892335..10892456) FT /rpt_family="L1" FT repeat_region complement(10892126..10892335) FT /rpt_family="L1" FT repeat_region complement(10891945..10892125) FT /rpt_family="MER53" FT repeat_region complement(10890479..10891944) FT /rpt_family="L1" FT repeat_region complement(10890169..10890478) FT /rpt_family="Alu" FT repeat_region complement(10889631..10890168) FT /rpt_family="L1" FT repeat_region complement(10889045..10889535) FT /rpt_family="L1" FT repeat_region complement(10888793..10888991) FT /rpt_family="L1" FT repeat_region complement(10888452..10888495) FT /rpt_family="tRNA-Met" FT repeat_region complement(10888369..10888391) FT /rpt_family="AT_rich" FT repeat_region complement(10886335..10886637) FT /rpt_family="Alu" FT repeat_region complement(10886291..10886311) FT /rpt_family="AT_rich" FT repeat_region complement(10885181..10886118) FT /rpt_family="L1" FT repeat_region complement(10884307..10885003) FT /rpt_family="MER1_type" FT repeat_region complement(10884112..10884305) FT /rpt_family="Alu" FT repeat_region complement(10884079..10884107) FT /rpt_family="(CAA)n" FT repeat_region complement(10883917..10884077) FT /rpt_family="MER1_type" FT repeat_region complement(10883710..10883916) FT /rpt_family="L1" FT repeat_region complement(10883685..10883709) FT /rpt_family="MER1_type" FT repeat_region complement(10883411..10883435) FT /rpt_family="AT_rich" FT repeat_region complement(10882984..10883171) FT /rpt_family="L2" FT repeat_region complement(10882299..10882734) FT /rpt_family="L2" FT repeat_region complement(10882009..10882222) FT /rpt_family="ERVL" FT repeat_region complement(10880183..10880715) FT /rpt_family="ERVL" FT repeat_region complement(10879359..10879543) FT /rpt_family="MIR" FT repeat_region complement(10879155..10879329) FT /rpt_family="MIR" FT repeat_region complement(10878894..10878922) FT /rpt_family="AT_rich" FT repeat_region complement(10877866..10877897) FT /rpt_family="AT_rich" FT repeat_region complement(10876980..10877271) FT /rpt_family="Alu" FT repeat_region complement(10876448..10876579) FT /rpt_family="Alu" FT repeat_region complement(10874856..10874935) FT /rpt_family="(TA)n" FT repeat_region complement(10874707..10874846) FT /rpt_family="(TCTA)n" FT repeat_region complement(10874190..10874234) FT /rpt_family="L2" FT repeat_region complement(10873107..10873734) FT /rpt_family="L1" FT repeat_region complement(10872312..10873106) FT /rpt_family="L1" FT repeat_region complement(10872118..10872298) FT /rpt_family="L1" FT repeat_region complement(10871798..10872117) FT /rpt_family="Alu" FT repeat_region complement(10871762..10871797) FT /rpt_family="L1" FT repeat_region complement(10871444..10871761) FT /rpt_family="Alu" FT repeat_region complement(10870598..10871443) FT /rpt_family="L1" FT repeat_region complement(10870180..10870597) FT /rpt_family="ERV1" FT repeat_region complement(10869945..10870179) FT /rpt_family="ERV1" FT repeat_region complement(10869822..10869944) FT /rpt_family="ERV1" FT repeat_region complement(10866468..10866551) FT /rpt_family="Alu" FT repeat_region complement(10865433..10865551) FT /rpt_family="ERV1" FT repeat_region complement(10864497..10865436) FT /rpt_family="ERV1" FT repeat_region complement(10864125..10864499) FT /rpt_family="ERV1" FT repeat_region complement(10863694..10864124) FT /rpt_family="ERV1" FT repeat_region complement(10863326..10863693) FT /rpt_family="L1" FT repeat_region complement(10862445..10862740) FT /rpt_family="Alu" FT repeat_region complement(10862378..10862418) FT /rpt_family="(TG)n" FT repeat_region complement(10861198..10861326) FT /rpt_family="L1" FT repeat_region complement(10860794..10861197) FT /rpt_family="MaLR" FT repeat_region complement(10860619..10860793) FT /rpt_family="L1" FT repeat_region complement(10860433..10860590) FT /rpt_family="L2" FT repeat_region complement(10860216..10860415) FT /rpt_family="Alu" FT repeat_region complement(10859155..10860061) FT /rpt_family="L2" FT repeat_region complement(10858754..10859152) FT /rpt_family="ERVL" FT repeat_region complement(10858098..10858750) FT /rpt_family="L2" FT repeat_region complement(10857953..10858097) FT /rpt_family="Alu" FT repeat_region complement(10857092..10857952) FT /rpt_family="L2" FT repeat_region complement(10856781..10857058) FT /rpt_family="Alu" FT repeat_region complement(10856715..10856770) FT /rpt_family="L2" FT repeat_region complement(10856391..10856712) FT /rpt_family="MaLR" FT repeat_region 11031782..11031980 FT /rpt_family="Alu" FT repeat_region 11031983..11032007 FT /rpt_family="L1" FT repeat_region 11032008..11032313 FT /rpt_family="Alu" FT repeat_region 11032314..11032721 FT /rpt_family="L1" FT repeat_region 11032762..11032837 FT /rpt_family="L1" FT repeat_region 11032842..11032862 FT /rpt_family="(TTA)n" FT repeat_region 11033084..11033352 FT /rpt_family="L2" FT repeat_region 11033353..11033653 FT /rpt_family="Alu" FT repeat_region 11033654..11033783 FT /rpt_family="L2" FT repeat_region 11033784..11034074 FT /rpt_family="Alu" FT repeat_region 11034075..11034232 FT /rpt_family="L2" FT repeat_region 11034233..11035716 FT /rpt_family="ERV1" FT repeat_region 11035717..11035894 FT /rpt_family="L2" FT repeat_region 11035931..11036013 FT /rpt_family="L2" FT repeat_region 11036041..11036144 FT /rpt_family="L2" FT repeat_region 11036865..11037068 FT /rpt_family="L2" FT repeat_region 11037069..11037628 FT /rpt_family="MaLR" FT repeat_region 11037629..11038034 FT /rpt_family="L2" FT repeat_region 11038043..11038097 FT /rpt_family="(CATATA)n" FT repeat_region 11038544..11038668 FT /rpt_family="MER1_type" FT repeat_region complement(11172555..11173089) FT /rpt_family="L1" FT repeat_region complement(11171605..11172555) FT /rpt_family="L1" FT repeat_region complement(11170141..11171434) FT /rpt_family="L1" FT repeat_region complement(11169599..11169923) FT /rpt_family="MaLR" FT repeat_region complement(11169328..11169441) FT /rpt_family="L2" FT repeat_region complement(11167859..11167965) FT /rpt_family="L2" FT misc_feature complement(11166132..11166415) FT /note="similar to EST AA548043 (NID:g2318325) nk54g02.s1" FT misc_feature complement(11165969..11166402) FT /note="similar to EST AA961630 (NID:g3133794) op44h01.s1" FT repeat_region complement(11164114..11164350) FT /rpt_family="MIR" FT repeat_region complement(11163452..11163557) FT /rpt_family="Alu" FT repeat_region complement(11163388..11163451) FT /rpt_family="Alu" FT repeat_region complement(11163127..11163387) FT /rpt_family="Alu" FT repeat_region complement(11161855..11161947) FT /rpt_family="MER2_type" FT repeat_region complement(11161482..11161854) FT /rpt_family="L1" FT repeat_region complement(11161166..11161481) FT /rpt_family="MER2_type" FT repeat_region complement(11161072..11161143) FT /rpt_family="MER2_type" FT repeat_region complement(11159810..11159914) FT /rpt_family="MIR" FT repeat_region complement(11156320..11156405) FT /rpt_family="MER1_type" FT repeat_region complement(11155709..11156188) FT /rpt_family="L1" FT repeat_region complement(11155630..11155705) FT /rpt_family="L1" FT repeat_region complement(11155215..11155560) FT /rpt_family="L1" FT repeat_region complement(11154997..11155152) FT /rpt_family="MER1_type" FT repeat_region complement(11152127..11152410) FT /rpt_family="Alu" FT misc_feature complement(11151233..11151535) FT /note="similar to EST AI873785 (NID:g5547834) wm41d02.x1" FT misc_feature complement(11150977..11151124) FT /note="similar to EST AA608749 (NID:g2457177) ae56h02.s1" FT /note="similar to EST AA888418 (NID:g3004093) nw74c12.s1" FT /note="similar to EST AA837024 (NID:g2912223) og09c08.s1" FT /note="similar to EST AI800150 (NID:g5365622) tr23a02.x1" FT misc_feature complement(11150977..11151119) FT /note="similar to EST AW553139 (NID:g7198562)" FT /note="similar to EST AV006686 (NID:g4783673)" FT /note="similar to EST AA190122 (NID:g1776772) mu46f05.r1" FT /note="similar to EST AI606019 (NID:g4615186) mu46f05.y1" FT misc_feature complement(11150977..11151118) FT /note="similar to EST AA748991 (NID:g2788949) oa58a08.s1" FT misc_feature complement(11150977..11151106) FT /note="similar to EST AA998053 (NID:g4287186)" FT misc_feature complement(11150977..11151070) FT /note="similar to EST AA388212 (NID:g2041239) vc24b05.r1" FT misc_feature complement(11150002..11150334) FT /note="similar to EST AA600172 (NID:g2433797) ae50g02.s1" FT misc_feature complement(11150149..11150178) FT /note="similar to EST AI606019 (NID:g4615186) mu46f05.y1" FT /note="similar to EST AA190122 (NID:g1776772) mu46f05.r1" FT misc_feature complement(11146927..11147374) FT /note="similar to EST N40202 (NID:g1163747) yy44g04.s1" FT misc_feature complement(11146836..11146952) FT /note="similar to EST AI606019 (NID:g4615186) mu46f05.y1" FT /note="similar to EST AA190122 (NID:g1776772) mu46f05.r1" FT repeat_region complement(11144280..11144490) FT /rpt_family="MER1_type" FT misc_feature complement(11142868..11143281) FT /note="similar to EST AA253408 (NID:g1885582) zr77c12.s1" FT misc_feature complement(11142446..11142890) FT /note="similar to EST AI554071 (NID:g4486434) te49g01.x1" FT misc_feature complement(11142669..11142883) FT /note="similar to EST AI370141 (NID:g4148894) qu18h09.x1" FT misc_feature complement(11142168..11142630) FT /note="similar to EST AA666080 (NID:g2620693) ac41d11.s1" FT misc_feature complement(11142113..11142179) FT /note="similar to EST Z43974 (NID:g573092)" FT misc_feature complement(11141119..11141354) FT /note="similar to EST AI539735 (NID:g4453870) tp72a09.x1" FT repeat_region complement(11140232..11140467) FT /rpt_family="MIR" FT repeat_region complement(11139954..11140092) FT /rpt_family="MIR" FT repeat_region complement(11139275..11139393) FT /rpt_family="MIR" FT repeat_region complement(11137205..11137262) FT /rpt_family="CR1" FT repeat_region complement(11136601..11136905) FT /rpt_family="Alu" FT misc_feature complement(11135887..11136263) FT /note="similar to EST AA658076 (NID:g2594230) nu17h06.s1" FT repeat_region complement(11135185..11135366) FT /rpt_family="MER105" FT repeat_region complement(11134790..11135024) FT /rpt_family="MIR" FT repeat_region complement(11134253..11134586) FT /rpt_family="L1" FT repeat_region complement(11133815..11134251) FT /rpt_family="MaLR" FT misc_feature complement(11133305..11133718) FT /note="similar to EST AW445090 (NID:g6986852)" FT repeat_region complement(11132836..11133567) FT /rpt_family="L1" FT repeat_region complement(11132708..11132828) FT /rpt_family="L1" FT repeat_region complement(11132088..11132189) FT /rpt_family="MER1_type" FT repeat_region complement(11131888..11132050) FT /rpt_family="MER1_type" FT repeat_region complement(11131109..11131399) FT /rpt_family="Alu" FT repeat_region complement(11129386..11129697) FT /rpt_family="Alu" FT repeat_region complement(11129037..11129169) FT /rpt_family="Alu" FT repeat_region complement(11127668..11127987) FT /rpt_family="MER2_type" FT misc_feature complement(11127141..11127335) FT /note="similar to EST T05228 (NID:g316380)" FT repeat_region complement(11126818..11127116) FT /rpt_family="Alu" FT repeat_region complement(11125725..11125947) FT /rpt_family="L2" FT repeat_region complement(11125531..11125720) FT /rpt_family="MIR" FT repeat_region complement(11125269..11125455) FT /rpt_family="Alu" FT repeat_region complement(11125136..11125268) FT /rpt_family="L2" FT repeat_region complement(11124391..11124580) FT /rpt_family="L1" FT repeat_region complement(11124128..11124268) FT /rpt_family="L1" FT repeat_region complement(11123092..11123386) FT /rpt_family="Alu" FT repeat_region complement(11122440..11122932) FT /rpt_family="ERV1" FT repeat_region complement(11121693..11121995) FT /rpt_family="Alu" FT repeat_region complement(11121209..11121495) FT /rpt_family="Alu" FT repeat_region complement(11120826..11121080) FT /rpt_family="L1" FT repeat_region complement(11120583..11120672) FT /rpt_family="L1" FT repeat_region complement(11117992..11118190) FT /rpt_family="MIR" FT repeat_region complement(11116948..11117248) FT /rpt_family="Alu" FT repeat_region complement(11116183..11116494) FT /rpt_family="Alu" FT repeat_region complement(11115755..11115835) FT /rpt_family="MIR" FT repeat_region complement(11115477..11115754) FT /rpt_family="Alu" FT repeat_region complement(11115344..11115476) FT /rpt_family="MIR" FT repeat_region complement(11114926..11115342) FT /rpt_family="MaLR" FT repeat_region complement(11114866..11114910) FT /rpt_family="MaLR" FT repeat_region complement(11114565..11114865) FT /rpt_family="Alu" FT repeat_region complement(11114137..11114564) FT /rpt_family="MaLR" FT repeat_region complement(11113827..11114136) FT /rpt_family="Alu" FT repeat_region complement(11112706..11113826) FT /rpt_family="MaLR" FT repeat_region complement(11112304..11112703) FT /rpt_family="MaLR" FT repeat_region complement(11112111..11112257) FT /rpt_family="MIR" FT repeat_region complement(11111659..11112071) FT /rpt_family="MaLR" FT repeat_region complement(11111137..11111352) FT /rpt_family="L1" FT repeat_region complement(11110712..11110885) FT /rpt_family="MIR" FT repeat_region complement(11109769..11110004) FT /rpt_family="Alu" FT repeat_region complement(11109520..11109702) FT /rpt_family="L1" FT repeat_region complement(11109363..11109465) FT /rpt_family="Alu" FT repeat_region complement(11109107..11109205) FT /rpt_family="L1" FT repeat_region complement(11108891..11109023) FT /rpt_family="ERV" FT repeat_region complement(11108646..11108827) FT /rpt_family="ERV" FT repeat_region complement(11108431..11108613) FT /rpt_family="L1" FT repeat_region complement(11108001..11108333) FT /rpt_family="L1" FT repeat_region complement(11107696..11108000) FT /rpt_family="Alu" FT repeat_region complement(11107649..11107695) FT /rpt_family="L1" FT repeat_region complement(11107240..11107648) FT /rpt_family="MaLR" FT repeat_region complement(11106539..11107239) FT /rpt_family="L1" FT repeat_region complement(11106462..11106520) FT /rpt_family="L1" FT repeat_region complement(11106078..11106460) FT /rpt_family="L1" FT repeat_region complement(11105922..11106025) FT /rpt_family="Alu" FT misc_feature complement(11105407..11105830) FT /note="similar to EST AA053060 (NID:g1544199) zl71b08.r1" FT repeat_region complement(11104393..11104560) FT /rpt_family="MIR" FT misc_feature complement(11102625..11103009) FT /note="similar to EST AA554006 (NID:g2324545) nk35d09.s1" FT misc_feature complement(11102298..11102626) FT /note="similar to EST AI335654 (NID:g4072581) qt24h09.x1" FT misc_feature complement(11102131..11102518) FT /note="similar to EST R80300 (NID:g856581) yi92f01.r1" FT misc_feature complement(11101591..11101712) FT /note="similar to EST AA998053 (NID:g4287186)" FT /note="similar to EST AA388212 (NID:g2041239) vc24b05.r1" FT /note="similar to EST AV006686 (NID:g4783673)" FT /note="similar to EST Z43974 (NID:g573092)" FT /note="similar to EST AA608749 (NID:g2457177) ae56h02.s1" FT /note="similar to EST AW553139 (NID:g7198562)" FT misc_feature complement(11101689..11101712) FT /note="similar to EST AA748991 (NID:g2788949) oa58a08.s1" FT misc_feature complement(11101594..11101712) FT /note="similar to EST AI800150 (NID:g5365622) tr23a02.x1" FT misc_feature complement(11101596..11101712) FT /note="similar to EST AA888418 (NID:g3004093) nw74c12.s1" FT misc_feature complement(11101622..11101712) FT /note="similar to EST AI335654 (NID:g4072581) qt24h09.x1" FT misc_feature complement(11101613..11101712) FT /note="similar to EST AA837024 (NID:g2912223) og09c08.s1" FT misc_feature complement(11101591..11101648) FT /note="similar to EST F06945 (NID:g672581)" FT misc_feature complement(11101591..11101622) FT /note="similar to EST W89023 (NID:g1403909) zh72e10.r1" FT misc_feature complement(11101418..11101469) FT /note="similar to EST AA474109 (NID:g2202336) ve60e01.r1" FT misc_feature complement(11101418..11101468) FT /note="similar to EST Z43974 (NID:g573092)" FT /note="similar to EST AW553139 (NID:g7198562)" FT /note="similar to EST W89023 (NID:g1403909) zh72e10.r1" FT /note="similar to EST AA388212 (NID:g2041239) vc24b05.r1" FT /note="similar to EST AV006686 (NID:g4783673)" FT /note="similar to EST F06945 (NID:g672581)" FT misc_feature complement(11101438..11101468) FT /note="similar to EST AA998053 (NID:g4287186)" FT misc_feature complement(11101427..11101468) FT /note="similar to EST AA608749 (NID:g2457177) ae56h02.s1" FT misc_feature complement(11101418..11101457) FT /note="similar to EST AW150474 (NID:g6198370) xg52d04.x1" FT repeat_region complement(11100173..11100276) FT /rpt_family="MER1_type" FT repeat_region complement(11099492..11099803) FT /rpt_family="Alu" FT repeat_region complement(11099121..11099414) FT /rpt_family="Alu" FT repeat_region complement(11098408..11098509) FT /rpt_family="MIR" FT repeat_region complement(11097001..11097300) FT /rpt_family="Alu" FT repeat_region complement(11093804..11093875) FT /rpt_family="MER1_type" FT misc_feature complement(11093261..11093650) FT /note="similar to EST AA280620 (NID:g1924730) zt11c02.s1" FT misc_feature complement(11092400..11092831) FT /note="similar to EST AA280599 (NID:g1924828) zt11c02.r1" FT repeat_region complement(11092448..11092657) FT /rpt_family="L1" FT repeat_region complement(11091820..11092449) FT /rpt_family="L1" FT misc_feature complement(11091238..11091407) FT /note="similar to EST AA474109 (NID:g2202336) ve60e01.r1" FT misc_feature complement(11091281..11091407) FT /note="similar to EST AV006686 (NID:g4783673)" FT misc_feature complement(11091297.