ID CM000666; SV 1; linear; genomic DNA; CON; HUM; 191154276 BP. XX AC CM000666; XX PR Project:PRJNA31257; XX DT 09-MAR-2009 (Rel. 100, Created) DT 29-SEP-2009 (Rel. 102, Last updated, Version 2) XX DE Homo sapiens chromosome 4, GRCh37 primary reference assembly. XX KW . XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RC Erratum:[Nature 2001 Aug 2;412(6846):565] RP 1-191154276 RX DOI; 10.1038/35057062. RX PUBMED; 11237011. RG International Human Genome Sequencing Consortium RA Lander E.S., Linton L.M., Birren B., Nusbaum C., Zody M.C., Baldwin J., RA Devon K., Dewar K., Doyle M., FitzHugh W., Funke R., Gage D., Harris K., RA Heaford A., Howland J., Kann L., Lehoczky J., LeVine R., McEwan P., RA McKernan K., Meldrim J., Mesirov J.P., Miranda C., Morris W., Naylor J., RA Raymond C., Rosetti M., Santos R., Sheridan A., Sougnez C., RA Stange-Thomann N., Stojanovic N., Subramanian A., Wyman D., Rogers J., RA Sulston J., Ainscough R., Beck S., Bentley D., Burton J., Clee C., RA Carter N., Coulson A., Deadman R., Deloukas P., Dunham A., Dunham I., RA Durbin R., French L., Grafham D., Gregory S., Hubbard T., Humphray S., RA Hunt A., Jones M., Lloyd C., McMurray A., Matthews L., Mercer S., Milne S., RA Mullikin J.C., Mungall A., Plumb R., Ross M., Shownkeen R., Sims S., RA Waterston R.H., Wilson R.K., Hillier L.W., McPherson J.D., Marra M.A., RA Mardis E.R., Fulton L.A., Chinwalla A.T., Pepin K.H., Gish W.R., RA Chissoe S.L., Wendl M.C., Delehaunty K.D., Miner T.L., Delehaunty A., RA Kramer J.B., Cook L.L., Fulton R.S., Johnson D.L., Minx P.J., Clifton S.W., RA Hawkins T., Branscomb E., Predki P., Richardson P., Wenning S., Slezak T., RA Doggett N., Cheng J.F., Olsen A., Lucas S., Elkin C., Uberbacher E., RA Frazier M., Gibbs R.A., Muzny D.M., Scherer S.E., Bouck J.B., RA Sodergren E.J., Worley K.C., Rives C.M., Gorrell J.H., Metzker M.L., RA Naylor S.L., Kucherlapati R.S., Nelson D.L., Weinstock G.M., Sakaki Y., RA Fujiyama A., Hattori M., Yada T., Toyoda A., Itoh T., Kawagoe C., RA Watanabe H., Totoki Y., Taylor T., Weissenbach J., Heilig R., Saurin W., RA Artiguenave F., Brottier P., Bruls T., Pelletier E., Robert C., Wincker P., RA Smith D.R., Doucette-Stamm L., Rubenfield M., Weinstock K., Lee H.M., RA Dubois J., Rosenthal A., Platzer M., Nyakatura G., Taudien S., Rump A., RA Yang H., Yu J., Wang J., Huang G., Gu J., Hood L., Rowen L., Madan A., RA Qin S., Davis R.W., Federspiel N.A., Abola A.P., Proctor M.J., Myers R.M., RA Schmutz J., Dickson M., Grimwood J., Cox D.R., Olson M.V., Kaul R., RA Raymond C., Shimizu N., Kawasaki K., Minoshima S., Evans G.A., RA Athanasiou M., Schultz R., Roe B.A., Chen F., Pan H., Ramser J., RA Lehrach H., Reinhardt R., McCombie W.R., de la Bastide M., Dedhia N., RA Blocker H., Hornischer K., Nordsiek G., Agarwala R., Aravind L., RA Bailey J.A., Bateman A., Batzoglou S., Birney E., Bork P., Brown D.G., RA Burge C.B., Cerutti L., Chen H.C., Church D., Clamp M., Copley R.R., RA Doerks T., Eddy S.R., Eichler E.E., Furey T.S., Galagan J., Gilbert J.G., RA Harmon C., Hayashizaki Y., Haussler D., Hermjakob H., Hokamp K., Jang W., RA Johnson L.S., Jones T.A., Kasif S., Kaspryzk A., Kennedy S., Kent W.J., RA Kitts P., Koonin E.V., Korf I., Kulp D., Lancet D., Lowe T.M., RA McLysaght A., Mikkelsen T., Moran J.V., Mulder N., Pollara V.J., RA Ponting C.P., Schuler G., Schultz J., Slater G., Smit A.F., Stupka E., RA Szustakowski J., Thierry-Mieg D., Thierry-Mieg J., Wagner L., Wallis J., RA Wheeler R., Williams A., Wolf Y.I., Wolfe K.H., Yang S.P., Yeh R.F., RA Collins F., Guyer M.S., Peterson J., Felsenfeld A., Wetterstrand K.A., RA Patrinos A., Morgan M.J., de Jong P., Catanese J.J., Osoegawa K., RA Shizuya H., Choi S., Chen Y.J.; RT "Initial sequencing and analysis of the human genome"; RL Nature 409(6822):860-921(2001). XX RN [2] RP 1-191154276 RX DOI; 10.1038/nature03001. RX PUBMED; 15496913. RG International Human Genome Sequencing Consortium RA ; RT "Finishing the euchromatic sequence of the human genome"; RL Nature 431(7011):931-945(2004). XX RN [3] RP 1-191154276 RX DOI; 10.1038/nature03466. RX PUBMED; 15815621. RA Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., RA Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., RA Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., RA Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., RA Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., RA Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., RA Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., RA Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., RA Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., RA McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., RA Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., RA Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., RA Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., RA Tin-Wollam A.M., Maupin R., Latreille P., Wendl M.C., Yang S.P., Pohl C., RA Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., RA Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., RA Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., RA Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., RA Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., RA Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., RA Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., RA Wilson R.K.; RT "Generation and annotation of the DNA sequences of human chromosomes 2 and RT 4"; RL Nature 434(7034):724-731(2005). XX RN [4] RP 1-191154276 RG Genome Reference Consortium RA ; RT ; RL Submitted (24-FEB-2009) to the INSDC. RL NCBI, NIH, Bethesda, MD 20892, USA XX CC The DNA sequence is composed of genomic sequence, primarily CC finished clones that were sequenced as part of the Human Genome CC Project. PCR products and WGS shotgun sequence have been added CC where necessary to fill gaps or correct errors. All such additions CC are manually curated by GRC staff. For more information see: CC http://genomereference.org. XX CO join(gap(10000),GL000037.1:1..1413146,gap(55500),GL000038.1:1..7320557, CO gap(19000),GL000039.1:1..23002714,gap(16500),GL000040.1:1..997221, CO gap(6000),GL000041.1:1..7455758,gap(700),GL000042.1:1..9041845,gap(150000), CO GL000043.1:1..171176,gap(3000000),GL000044.1:1..7079216,gap(50000), CO GL000045.1:1..15638046,gap(24900),GL000046.1:1..115591997,gap(100000), CO gap(10000)) XX FH Key Location/Qualifiers FH FT source 1..191154276 FT /organism="Homo sapiens" FT /chromosome="4" FT /mol_type="genomic DNA" FT /db_xref="taxon:9606" FT gap 1..10000 FT /estimated_length=10000 FT repeat_region 10001..10122 FT /note="2 copies of 61 mer 89 % conserved" FT repeat_region 10001..10198 FT /note="11 copies of 18 mer 81 % conserved" FT repeat_region 10001..10198 FT /note="33 copies of 6 mer 81 % conserved" FT repeat_region 10053..10196 FT /note="3 copies of 48 mer 83 % conserved" FT repeat_region 10081..10200 FT /note="2 copies of 60 mer 83 % conserved" FT repeat_region 10086..10143 FT /note="2 copies of 29 mer 100 % conserved" FT repeat_region 10465..10522 FT /note="2 copies of 29 mer 93 % conserved" FT repeat_region 10530..10721 FT /note="4 copies of 48 mer 84 % conserved" FT repeat_region 10813..11015 FT /note="7 copies of 29 mer 99 % conserved" FT repeat_region 11179..11326 FT /note="4 copies of 37 mer 84 % conserved" FT repeat_region 11375..11452 FT /note="2 copies of 39 mer 92 % conserved" FT repeat_region 11451..11504 FT /note="3 copies of 18 mer 85 % conserved" FT repeat_region 11929..12114 FT /note="3 copies of 62 mer 87 % conserved" FT repeat_region 12054..12175 FT /note="2 copies of 61 mer 87 % conserved" FT repeat_region 12132..12251 FT /note="2 copies of 60 mer 88 % conserved" FT repeat_region 12196..12317 FT /note="2 copies of 61 mer 90 % conserved" FT repeat_region 12268..12387 FT /note="2 copies of 60 mer 85 % conserved" FT repeat_region 16458..16489 FT /note="16 copies of 2 mer 88 % conserved" FT repeat_region 28431..28468 FT /note="19 copies of 2 mer 87 % conserved" FT repeat_region 47505..47600 FT /note="16 copies of 6 mer 90 % conserved" FT repeat_region 47609..47668 FT /note="10 copies of 6 mer 85 % conserved" FT repeat_region 50782..50903 FT /note="2 copies of 61 mer 84 % conserved" FT repeat_region 91151..91184 FT /note="17 copies of 2 mer 85 % conserved" FT repeat_region 96506..96541 FT /note="18 copies of 2 mer 92 % conserved" FT repeat_region 97721..97772 FT /note="2 copies of 26 mer 96 % conserved" FT repeat_region 113611..113688 FT /note="3 copies of 26 mer 82 % conserved" FT repeat_region 115928..115963 FT /note="18 copies of 2 mer 92 % conserved" FT repeat_region 116413..116436 FT /note="12 copies of 2 mer 96 % conserved" FT repeat_region 10208..10352 FT /note="HSREP271 repeat: matches 36..182 of consensus" FT repeat_region 10365..10457 FT /note="HSREP271 repeat: matches 103..195 of consensus" FT repeat_region 13819..14118 FT /note="AluY repeat: matches 2..301 of consensus" FT repeat_region 14767..15361 FT /note="L1 repeat: matches 4800..5390 of consensus" FT repeat_region 15212..16112 FT /note="L1PA2 repeat: matches 1..891 of consensus" FT repeat_region 17342..17605 FT /note="AluJb repeat: matches 1..290 of consensus" FT repeat_region 17846..18029 FT /note="L1MC2 repeat: matches 509..693 of consensus" FT repeat_region 18072..18253 FT /note="L1MC3 repeat: matches 809..1010 of consensus" FT repeat_region 18257..18698 FT /note="MSTB repeat: matches 4..426 of consensus" FT repeat_region 18698..19018 FT /note="L1MC3 repeat: matches 1005..1331 of consensus" FT repeat_region 19027..20027 FT /note="LTR5 repeat: matches 6..969 of consensus" FT repeat_region 20156..20293 FT /note="MER42c repeat: matches 236..386 of consensus" FT repeat_region 20312..20711 FT /note="MER42B repeat: matches 414..825 of consensus" FT repeat_region 20719..21056 FT /note="L1MC3 repeat: matches 2117..2447 of consensus" FT repeat_region 22005..22155 FT /note="MER4A2 repeat: matches 1..152 of consensus" FT repeat_region 22156..22448 FT /note="MER4A2 repeat: matches 211..504 of consensus" FT repeat_region 26732..26791 FT /note="MIR repeat: matches 54..114 of consensus" FT repeat_region 29958..31148 FT /note="L1 repeat: matches 4197..5387 of consensus" FT repeat_region 31004..31887 FT /note="L1PA2 repeat: matches 1..891 of consensus" FT repeat_region 34234..35027 FT /note="L1PA12 repeat: matches 912..113 of consensus" FT repeat_region 35036..35335 FT /note="AluY repeat: matches 301..2 of consensus" FT repeat_region 35338..35826 FT /note="L1 repeat: matches 5356..4861 of consensus" FT repeat_region 37399..40541 FT /note="L1 repeat: matches 4081..959 of consensus" FT repeat_region 40542..41494 FT /note="LTR5 repeat: matches 969..14 of consensus" FT repeat_region 41503..42685 FT /note="L1 repeat: matches 1207..6 of consensus" FT repeat_region 44179..44478 FT /note="AluSp repeat: matches 303..3 of consensus" FT repeat_region 44688..44792 FT /note="MIR repeat: matches 179..48 of consensus" FT repeat_region 45516..45797 FT /note="AluSq repeat: matches 303..28 of consensus" FT /note="incomplete repeat" FT repeat_region 46098..46401 FT /note="AluSq repeat: matches 1..303 of consensus" FT repeat_region 46830..47134 FT /note="MER21B repeat: matches 386..78 of consensus" FT repeat_region 47193..47492 FT /note="AluSg repeat: matches 1..300 of consensus" FT repeat_region 50195..50496 FT /note="AluY repeat: matches 1..301 of consensus" FT repeat_region 54783..55080 FT /note="AluY repeat: matches 292..1 of consensus" FT repeat_region 60516..60601 FT /note="L1PA3 repeat: matches 889..804 of consensus" FT repeat_region 60809..60925 FT /note="MER30 repeat: matches 5..116 of consensus" FT repeat_region 61044..61327 FT /note="AluSx repeat: matches 302..1 of consensus" FT repeat_region 61558..61682 FT /note="MER6 repeat: matches 865..738 of consensus" FT repeat_region 61785..62465 FT /note="L1MA6 repeat: matches 1028..294 of consensus" FT repeat_region 61787..62286 FT /note="L1MA9 repeat: matches 1020..529 of consensus" FT repeat_region 62492..63361 FT /note="L1 repeat: matches 5358..4470 of consensus" FT repeat_region 63433..63630 FT /note="AluSg repeat: matches 298..103 of consensus" FT /note="incomplete repeat" FT repeat_region 63882..64095 FT /note="L1 repeat: matches 4089..4311 of consensus" FT repeat_region 64106..64245 FT /note="FLAM_C repeat: matches 131..1 of consensus" FT repeat_region 64364..64459 FT /note="AluSq repeat: matches 1..96 of consensus" FT /note="incomplete repeat" FT repeat_region 64510..64571 FT /note="MER6 repeat: matches 803..864 of consensus" FT repeat_region 65169..65442 FT /note="L1MA10 repeat: matches 738..456 of consensus" FT repeat_region 65439..65858 FT /note="MSTA repeat: matches 1..426 of consensus" FT repeat_region 65844..66236 FT /note="L1MB3 repeat: matches 462..41 of consensus" FT repeat_region 66336..66934 FT /note="L1 repeat: matches 5144..4530 of consensus" FT repeat_region 67079..67188 FT /note="L1PA13 repeat: matches 782..892 of consensus" FT repeat_region 67235..67576 FT /note="L1MB2 repeat: matches 770..421 of consensus" FT repeat_region 67777..68051 FT /note="AluY repeat: matches 301..6 of consensus" FT repeat_region 68511..69531 FT /note="L1MA2 repeat: matches 1055..3 of consensus" FT repeat_region 69385..69791 FT /note="L1 repeat: matches 5390..5013 of consensus" FT repeat_region 70099..70215 FT /note="L1 repeat: matches 5019..4903 of consensus" FT repeat_region 70234..70527 FT /note="AluSx repeat: matches 296..1 of consensus" FT repeat_region 70550..71291 FT /note="L1 repeat: matches 4855..4064 of consensus" FT repeat_region 73556..73858 FT /note="MER21B repeat: matches 388..79 of consensus" FT repeat_region 73919..74136 FT /note="AluJb repeat: matches 1..221 of consensus" FT /note="incomplete repeat" FT repeat_region 74369..74666 FT /note="MER4A repeat: matches 644..367 of consensus" FT repeat_region 74667..74814 FT /note="MER4A2 repeat: matches 152..1 of consensus" FT repeat_region 75112..75468 FT /note="MSTD repeat: matches 382..1 of consensus" FT repeat_region 75788..76086 FT /note="AluJb repeat: matches 295..1 of consensus" FT repeat_region 76125..76200 FT /note="AluJo repeat: matches 136..61 of consensus" FT /note="incomplete repeat" FT repeat_region 76637..76827 FT /note="L1 repeat: matches 1847..1654 of consensus" FT repeat_region 77901..78199 FT /note="AluY repeat: matches 299..1 of consensus" FT repeat_region 78608..78884 FT /note="AluSp repeat: matches 303..1 of consensus" FT repeat_region 78887..79134 FT /note="L1MB2 repeat: matches 868..607 of consensus" FT repeat_region 79012..79320 FT /note="L1MB6 repeat: matches 742..419 of consensus" FT repeat_region 79322..79816 FT /note="L1 repeat: matches 4941..4446 of consensus" FT repeat_region 79919..80210 FT /note="AluSp repeat: matches 297..2 of consensus" FT repeat_region 80221..80318 FT /note="L1 repeat: matches 3931..4027 of consensus" FT repeat_region 80361..80664 FT /note="LTR7 repeat: matches 448..134 of consensus" FT repeat_region 80616..80725 FT /note="LTR7 repeat: matches 131..1 of consensus" FT repeat_region 80727..81075 FT /note="L1PA8 repeat: matches 899..552 of consensus" FT repeat_region 81429..81889 FT /note="L1MB2 repeat: matches 914..421 of consensus" FT repeat_region 81927..82187 FT /note="L1 repeat: matches 4802..4536 of consensus" FT repeat_region 82273..82575 FT /note="AluSp repeat: matches 303..1 of consensus" FT repeat_region 83230..83531 FT /note="AluY repeat: matches 1..301 of consensus" FT repeat_region 87449..87602 FT /note="L1MA2 repeat: matches 1051..895 of consensus" FT repeat_region 87607..87907 FT /note="AluSg repeat: matches 300..1 of consensus" FT repeat_region 89458..89801 FT /note="L1MB2 repeat: matches 707..349 of consensus" FT repeat_region 89838..90128 FT /note="AluJb repeat: matches 302..12 of consensus" FT repeat_region 90129..90410 FT /note="L1MA5A repeat: matches 359..68 of consensus" FT repeat_region 91868..91936 FT /note="MSTA repeat: matches 426..358 of consensus" FT repeat_region 91938..92177 FT /note="AluSq repeat: matches 2..243 of consensus" FT /note="incomplete repeat" FT repeat_region 92178..92307 FT /note="THE1C repeat: matches 128..1 of consensus" FT repeat_region 92308..93799 FT /note="THE1B-INTERNAL repeat: matches 1580..1 of consensus" FT repeat_region 93805..94162 FT /note="THE1C repeat: matches 365..1 of consensus" FT repeat_region 94499..94739 FT /note="L1 repeat: matches 1014..766 of consensus" FT repeat_region 96000..96291 FT /note="AluSg repeat: matches 1..298 of consensus" FT repeat_region 96543..96836 FT /note="AluSc repeat: matches 294..1 of consensus" FT repeat_region 98851..99145 FT /note="AluSg repeat: matches 287..1 of consensus" FT repeat_region 99186..99441 FT /note="AluY repeat: matches 293..39 of consensus" FT /note="incomplete repeat" FT repeat_region 102201..102284 FT /note="MIR repeat: matches 144..47 of consensus" FT repeat_region 103706..103902 FT /note="MIR repeat: matches 261..40 of consensus" FT repeat_region 103969..104079 FT /note="MIR repeat: matches 37..160 of consensus" FT repeat_region 108155..108250 FT /note="MIR repeat: matches 144..47 of consensus" FT repeat_region 109234..109350 FT /note="MIR2 repeat: matches 1..132 of consensus" FT repeat_region 110908..111048 FT /note="MER4A2 repeat: matches 6..151 of consensus" FT repeat_region 111051..111361 FT /note="MER4A2 repeat: matches 212..502 of consensus" FT repeat_region 112264..112706 FT /note="LTR2 repeat: matches 449..1 of consensus" FT repeat_region 113122..113421 FT /note="AluSx repeat: matches 1..300 of consensus" FT repeat_region 113691..113746 FT /note="AluJ repeat: matches 299..244 of consensus" FT /note="incomplete repeat" FT repeat_region 113775..113885 FT /note="AluJo repeat: matches 182..293 of consensus" FT /note="incomplete repeat" FT repeat_region 113886..114691 FT /note="L1ME1 repeat: matches 865..93 of consensus" FT repeat_region 118091..118974 FT /note="L1PA16 repeat: matches 904..1 of consensus" FT repeat_region 118829..119520 FT /note="L1 repeat: matches 5390..4694 of consensus" FT repeat_region 119639..119939 FT /note="AluSq repeat: matches 1..301 of consensus" FT repeat_region 121847..122140 FT /note="AluSq repeat: matches 12..303 of consensus" FT repeat_region 122650..122950 FT /note="AluY repeat: matches 301..2 of consensus" FT repeat_region 122980..123444 FT /note="LTR12 repeat: matches 698..179 of consensus" FT repeat_region 123481..123622 FT /note="MER33 repeat: matches 156..310 of consensus" FT repeat_region 123901..124192 FT /note="AluSq repeat: matches 1..302 of consensus" FT repeat_region 126709..127006 FT /note="AluSc repeat: matches 299..2 of consensus" FT repeat_region 127330..127442 FT /note="MER6 repeat: matches 862..738 of consensus" FT repeat_region 127453..127510 FT /note="MER6 repeat: matches 809..866 of consensus" FT repeat_region 127538..127861 FT /note="L1MA9 repeat: matches 1029..716 of consensus" FT repeat_region 127890..128186 FT /note="AluY repeat: matches 301..1 of consensus" FT repeat_region 128547..128767 FT /note="AluSx repeat: matches 1..197 of consensus" FT /note="incomplete repeat" FT repeat_region 128706..129002 FT /rpt_family="Alu" FT repeat_region 129003..129309 FT /rpt_family="ERV1" FT repeat_region 129310..129413 FT /rpt_family="ERV1" FT repeat_region 129478..129524 FT /rpt_family="(TA)n" FT repeat_region 129529..129648 FT /rpt_family="L1" FT repeat_region 129940..130394 FT /rpt_family="L1" FT repeat_region 130393..130662 FT /rpt_family="L1" FT repeat_region 130663..131080 FT /rpt_family="MaLR" FT repeat_region 131081..131772 FT /rpt_family="L1" FT repeat_region 131779..133171 FT /rpt_family="L1" FT repeat_region 133172..133483 FT /rpt_family="ERV1" FT repeat_region 133487..134752 FT /rpt_family="ERV1" FT repeat_region 134845..135293 FT /rpt_family="ERV1" FT repeat_region 135268..135549 FT /rpt_family="ERV1" FT repeat_region 135607..136982 FT /rpt_family="ERV1" FT repeat_region 136983..137267 FT /rpt_family="Alu" FT repeat_region 137268..137742 FT /rpt_family="ERV1" FT repeat_region 137746..138086 FT /rpt_family="ERV1" FT repeat_region 138088..138709 FT /rpt_family="L1" FT repeat_region 138819..138968 FT /rpt_family="MaLR" FT repeat_region 138974..139237 FT /rpt_family="L1" FT repeat_region 139252..139537 FT /rpt_family="Alu" FT repeat_region 139596..139664 FT /rpt_family="Alu" FT repeat_region 139860..139884 FT /rpt_family="(TA)n" FT repeat_region 139890..140745 FT /rpt_family="L1" FT repeat_region 140746..140971 FT /rpt_family="Alu" FT repeat_region 140972..141391 FT /rpt_family="L1" FT repeat_region 141392..141663 FT /rpt_family="Alu" FT repeat_region 141664..142101 FT /rpt_family="L1" FT repeat_region 142111..142417 FT /rpt_family="Alu" FT repeat_region 142475..142912 FT /rpt_family="L1" FT repeat_region 143669..144140 FT /rpt_family="L1" FT repeat_region 144152..144244 FT /rpt_family="L1" FT repeat_region 144253..144541 FT /rpt_family="L1" FT repeat_region 144580..144601 FT /rpt_family="AT_rich" FT repeat_region 144673..144693 FT /rpt_family="(TG)n" FT repeat_region 144781..144874 FT /rpt_family="L1" FT repeat_region 144892..145187 FT /rpt_family="Alu" FT repeat_region 145245..145520 FT /rpt_family="Alu" FT repeat_region 145521..146488 FT /rpt_family="ERVK" FT repeat_region 146491..146532 FT /rpt_family="Alu" FT repeat_region 146576..147444 FT /rpt_family="L1" FT repeat_region 147447..147590 FT /rpt_family="L1" FT repeat_region 147734..148073 FT /rpt_family="MaLR" FT repeat_region 149622..149981 FT /rpt_family="MaLR" FT repeat_region 150281..150729 FT /rpt_family="L1" FT repeat_region 150722..150897 FT /rpt_family="L1" FT repeat_region 150898..151209 FT /rpt_family="Alu" FT repeat_region 151210..151397 FT /rpt_family="L1" FT repeat_region 151412..151914 FT /rpt_family="L1" FT repeat_region 152052..152262 FT /rpt_family="L1" FT repeat_region 152281..152469 FT /rpt_family="L1" FT repeat_region 152612..152815 FT /rpt_family="L1" FT repeat_region 152816..153125 FT /rpt_family="Alu" FT repeat_region 153126..153408 FT /rpt_family="L1" FT repeat_region 154006..154231 FT /rpt_family="L1" FT repeat_region 154326..154640 FT /rpt_family="Alu" FT repeat_region 156979..157259 FT /rpt_family="Alu" FT repeat_region 157627..157667 FT /rpt_family="AT_rich" FT repeat_region 157668..157858 FT /rpt_family="L1" FT repeat_region 157859..157908 FT /rpt_family="AT_rich" FT repeat_region 158138..158166 FT /rpt_family="AT_rich" FT repeat_region 159307..159600 FT /rpt_family="Alu" FT repeat_region 165875..166024 FT /rpt_family="L1" FT repeat_region 165994..166168 FT /rpt_family="L1" FT repeat_region 166234..166416 FT /rpt_family="MIR" FT repeat_region 166564..166862 FT /rpt_family="Alu" FT repeat_region 167259..167555 FT /rpt_family="ERV1" FT repeat_region 167567..168046 FT /rpt_family="ERVK" FT repeat_region 168379..168948 FT /rpt_family="ERV1" FT repeat_region 169076..169264 FT /rpt_family="ERV1" FT repeat_region 169642..169790 FT /rpt_family="Alu" FT repeat_region 170973..171435 FT /rpt_family="ERV1" FT repeat_region 171571..171652 FT /rpt_family="ERV1" FT repeat_region 171653..171867 FT /rpt_family="ERV1" FT repeat_region 171891..171930 FT /rpt_family="L1" FT repeat_region 171931..172227 FT /rpt_family="Alu" FT repeat_region 172228..173293 FT /rpt_family="L1" FT repeat_region 173744..173837 FT /rpt_family="GA-rich" FT repeat_region 174524..174813 FT /rpt_family="L1" FT repeat_region 174814..175094 FT /rpt_family="Alu" FT repeat_region 175095..175430 FT /rpt_family="L1" FT repeat_region 176194..176238 FT /rpt_family="(TTTA)n" FT repeat_region 176239..176521 FT /rpt_family="Alu" FT repeat_region 181004..181301 FT /rpt_family="Alu" FT repeat_region 182085..182105 FT /rpt_family="(CTGTG)n" FT repeat_region 182642..182848 FT /rpt_family="L1" FT repeat_region 182849..183015 FT /rpt_family="Alu" FT repeat_region 183066..183904 FT /rpt_family="L1" FT repeat_region 183938..184238 FT /rpt_family="Alu" FT repeat_region 184550..184832 FT /rpt_family="Alu" FT repeat_region 184934..185240 FT /rpt_family="Alu" FT repeat_region 185552..186333 FT /rpt_family="ERV1" FT repeat_region 186334..186638 FT /rpt_family="ERV1" FT repeat_region 186615..186652 FT /rpt_family="ERV1" FT repeat_region 186647..187030 FT /rpt_family="ERV1" FT repeat_region 187031..187054 FT /rpt_family="(TTTCC)n" FT repeat_region 187055..187265 FT /rpt_family="ERV1" FT repeat_region 190038..190732 FT /rpt_family="ERV1" FT repeat_region 190787..190863 FT /rpt_family="ERV1" FT repeat_region 191657..191724 FT /rpt_family="(TGGA)n" FT repeat_region 192621..192816 FT /rpt_family="MIR" FT repeat_region 192884..192999 FT /rpt_family="MIR" FT repeat_region 194028..194355 FT /rpt_family="Alu" FT repeat_region 195783..196145 FT /rpt_family="MaLR" FT repeat_region 197628..197936 FT /rpt_family="Alu" FT repeat_region 198055..198417 FT /rpt_family="MaLR" FT repeat_region 199852..200029 FT /rpt_family="(TG)n" FT repeat_region 200060..200228 FT /rpt_family="(TG)n" FT repeat_region 200241..200303 FT /rpt_family="(TG)n" FT repeat_region 200629..200689 FT /rpt_family="MIR" FT repeat_region 200839..200954 FT /rpt_family="MIR" FT repeat_region 201592..202555 FT /rpt_family="ERVK" FT repeat_region 202808..202832 FT /rpt_family="AT_rich" FT repeat_region 203297..203468 FT /rpt_family="MER1_type" FT repeat_region 203708..204022 FT /rpt_family="Alu" FT repeat_region 204459..204883 FT /rpt_family="MaLR" FT repeat_region 204893..205486 FT /rpt_family="ERV1" FT repeat_region 205691..205976 FT /rpt_family="MER1_type" FT repeat_region 206185..206922 FT /rpt_family="ERV1" FT repeat_region 206963..207098 FT /rpt_family="ERV1" FT repeat_region 207131..207441 FT /rpt_family="ERV1" FT repeat_region 207443..208017 FT /rpt_family="ERV1" FT repeat_region 208159..209684 FT /rpt_family="ERV1" FT misc_feature 210623..210903 FT /note="similar to EST T79074 (NID:g697583) yd69b10.r1" FT repeat_region 211678..211775 FT /rpt_family="MER1_type" FT misc_feature 211789..212115 FT /note="similar to EST AA521317 (NID:g2261860) aa79h09.s1" FT repeat_region 212110..212410 FT /rpt_family="Alu" FT misc_feature 212430..212567 FT /note="similar to EST AI092258 (NID:g3427231) oz97c10.x1" FT misc_feature 212439..212567 FT /note="similar to EST BG150239 (NID:g12662269)" FT /note="similar to EST BG149241 (NID:g12661271)" FT /note="similar to EST BB642289 (NID:g15401845)" FT /note="similar to EST BB617198 (NID:g15396286)" FT misc_feature 212440..212567 FT /note="similar to EST BG771727 (NID:g14082380)" FT /note="similar to EST BE258578 (NID:g9129069)" FT /note="similar to EST BG503551 (NID:g13465068)" FT misc_feature 212444..212567 FT /note="similar to EST BI668234 (NID:g15582467)" FT misc_feature 212450..212567 FT /note="similar to EST AW576720 (NID:g7251860)" FT misc_feature 212452..212567 FT /note="similar to EST BG754870 (NID:g14065523)" FT misc_feature 213075..213178 FT /note="similar to EST BF508129 (NID:g11591427)" FT /note="similar to EST BE883118 (NID:g10331894)" FT misc_feature 213083..213178 FT /note="similar to EST AW576720 (NID:g7251860)" FT /note="similar to EST BG771727 (NID:g14082380)" FT /note="similar to EST BG149241 (NID:g12661271)" FT /note="similar to EST BI668234 (NID:g15582467)" FT /note="similar to EST BG150239 (NID:g12662269)" FT /note="similar to EST BG754870 (NID:g14065523)" FT /note="similar to EST BG503551 (NID:g13465068)" FT misc_feature 213083..213360 FT /note="similar to EST BE258578 (NID:g9129069)" FT misc_feature 213083..213162 FT /note="similar to EST BB617198 (NID:g15396286)" FT misc_feature 213083..213182 FT /note="similar to EST BB642289 (NID:g15401845)" FT repeat_region 213364..213664 FT /rpt_family="Alu" FT repeat_region 214133..214319 FT /rpt_family="MER1_type" FT repeat_region 214232..214261 FT /rpt_family="AT_rich" FT misc_feature 214275..214392 FT /note="similar to EST AI668575 (NID:g4827883) yj94d10.x5" FT repeat_region 214451..214759 FT /rpt_family="Alu" FT repeat_region 214732..214759 FT /rpt_family="(A)n" FT repeat_region 214855..214933 FT /rpt_family="MER2_type" FT repeat_region 214934..215148 FT /rpt_family="Alu" FT repeat_region 215149..215262 FT /rpt_family="MER2_type" FT repeat_region 215294..216012 FT /rpt_family="L1" FT repeat_region 216023..217000 FT /rpt_family="L1" FT repeat_region 216887..216921 FT /rpt_family="AT_rich" FT repeat_region 217001..217133 FT /rpt_family="Alu" FT repeat_region 217134..217360 FT /rpt_family="L1" FT repeat_region 217423..218157 FT /rpt_family="L1" FT repeat_region 218156..218422 FT /rpt_family="L1" FT repeat_region 218423..218840 FT /rpt_family="MaLR" FT repeat_region 218841..218924 FT /rpt_family="L1" FT repeat_region 218925..219222 FT /rpt_family="Alu" FT repeat_region 219223..220274 FT /rpt_family="L1" FT repeat_region 220304..220405 FT /rpt_family="L1" FT repeat_region 220405..220532 FT /rpt_family="L1" FT repeat_region 220559..220726 FT /rpt_family="L1" FT repeat_region 220730..221034 FT /rpt_family="Alu" FT repeat_region 221038..221086 FT /rpt_family="L1" FT repeat_region 221110..221342 FT /rpt_family="L1" FT misc_feature 221312..221795 FT /note="similar to EST BF184624 (NID:g11063038)" FT misc_feature 221483..221962 FT /note="similar to EST AL553371 (NID:g12893142)" FT repeat_region 221548..221572 FT /rpt_family="AT_rich" FT repeat_region 221726..221766 FT /rpt_family="AT_rich" FT repeat_region 221755..222243 FT /rpt_family="L1" FT repeat_region 222244..222379 FT /rpt_family="Alu" FT repeat_region 222380..222676 FT /rpt_family="Alu" FT repeat_region 222677..222845 FT /rpt_family="Alu" FT repeat_region 222846..224272 FT /rpt_family="L1" FT repeat_region 224273..224568 FT /rpt_family="Alu" FT misc_feature 224451..224603 FT /note="similar to EST BI668234 (NID:g15582467)" FT repeat_region 224569..224775 FT /rpt_family="L1" FT repeat_region 225108..225139 FT /rpt_family="(T)n" FT repeat_region 225110..225416 FT /rpt_family="Alu" FT repeat_region 225620..225641 FT /rpt_family="(TAAA)n" FT misc_feature 225804..226203 FT /note="similar to EST AA700785 (NID:g2703950) zi66b12.s1" FT repeat_region 226307..226719 FT /rpt_family="ERV1" FT repeat_region 226784..227285 FT /rpt_family="ERV1" FT repeat_region 227337..227685 FT /rpt_family="ERV1" FT repeat_region 227710..227998 FT /rpt_family="Alu" FT repeat_region 228001..228562 FT /rpt_family="ERV1" FT repeat_region 228065..228089 FT /rpt_family="(TTG)n" FT misc_feature 228315..228827 FT /note="similar to EST BE673695 (NID:g10034236)" FT misc_feature 228399..228757 FT /note="similar to EST AA551515 (NID:g2321767) nh08f04.s1" FT repeat_region 228551..228629 FT /rpt_family="ERV1" FT repeat_region 228718..228849 FT /rpt_family="ERV1" FT repeat_region 228857..229795 FT /rpt_family="L1" FT repeat_region 228993..229021 FT /rpt_family="AT_rich" FT repeat_region 229800..229824 FT /rpt_family="(T)n" FT repeat_region 229819..230181 FT /rpt_family="MaLR" FT repeat_region 230183..230446 FT /rpt_family="L1" FT repeat_region 230476..230751 FT /rpt_family="Alu" FT repeat_region 230803..230876 FT /rpt_family="Alu" FT repeat_region 230946..231452 FT /rpt_family="L1" FT repeat_region 231407..231458 FT /rpt_family="T-rich" FT repeat_region 231503..231698 FT /rpt_family="L1" FT repeat_region 231721..232868 FT /rpt_family="L1" FT misc_feature 232682..232947 FT /note="similar to EST BE093007 (NID:g8483459)" FT misc_feature 232802..232947 FT /note="similar to EST R93192 (NID:g967358) yt69g03.s1" FT misc_feature 232807..232947 FT /note="similar to EST N77120 (NID:g1239698) yz85d12.r1" FT misc_feature 232967..233116 FT /note="similar to EST BE093007 (NID:g8483459)" FT misc_feature 232967..233158 FT /note="similar to EST N77120 (NID:g1239698) yz85d12.r1" FT misc_feature 232967..233140 FT /note="similar to EST R93192 (NID:g967358) yt69g03.s1" FT repeat_region 232975..233635 FT /rpt_family="L1" FT repeat_region 234012..234295 FT /rpt_family="Alu" FT repeat_region 234294..234314 FT /rpt_family="(CAA)n" FT repeat_region 234489..234797 FT /rpt_family="Alu" FT repeat_region 234775..234808 FT /rpt_family="AT_rich" FT repeat_region 234989..235990 FT /rpt_family="ERVK" FT repeat_region 235991..236176 FT /rpt_family="ERVK" FT repeat_region 238998..239032 FT /rpt_family="(T)n" FT repeat_region 239003..239096 FT /rpt_family="Alu" FT repeat_region 239097..239354 FT /rpt_family="ERVK" FT repeat_region 239370..239459 FT /rpt_family="ERVK" FT repeat_region 239460..239936 FT /rpt_family="L1" FT repeat_region 239980..240061 FT /rpt_family="L1" FT repeat_region 240060..240141 FT /rpt_family="L1" FT repeat_region 240259..240485 FT /rpt_family="L1" FT repeat_region 240489..240700 FT /rpt_family="Alu" FT repeat_region 240701..241790 FT /rpt_family="ERVK" FT repeat_region 241791..241878 FT /rpt_family="Alu" FT repeat_region 241879..242783 FT /rpt_family="L1" FT repeat_region 242788..242970 FT /rpt_family="L1" FT repeat_region 243030..243330 FT /rpt_family="Alu" FT repeat_region 243306..243330 FT /rpt_family="AT_rich" FT repeat_region 243615..244084 FT /rpt_family="L1" FT repeat_region 244087..244383 FT /rpt_family="L1" FT repeat_region 244412..244739 FT /rpt_family="L1" FT repeat_region 244740..245040 FT /rpt_family="Alu" FT repeat_region 245041..245112 FT /rpt_family="L1" FT repeat_region 245114..245136 FT /rpt_family="(CA)n" FT repeat_region 245357..245663 FT /rpt_family="L1" FT repeat_region 245848..246337 FT /rpt_family="L1" FT repeat_region 246347..246709 FT /rpt_family="L1" FT misc_feature 246405..246952 FT /note="similar to EST BF446286 (NID:g11511424)" FT misc_feature 247323..247487 FT /note="similar to EST BF675662 (NID:g11949557)" FT misc_feature 247340..247667 FT /note="similar to EST BE177799 (NID:g8656951)" FT misc_feature 247344..247647 FT /note="similar to EST AA805804 (NID:g2874554) nu74c08.s1" FT misc_feature 247347..247667 FT /note="similar to EST BI560594 (NID:g15447908)" FT /note="similar to EST BG721813 (NID:g14001000)" FT misc_feature 247348..247947 FT /note="similar to EST BI463333 (NID:g15253989)" FT misc_feature 247348..247895 FT /note="similar to EST BG718573 (NID:g13997760)" FT misc_feature 247349..247604 FT /note="similar to EST BG149241 (NID:g12661271)" FT misc_feature 247349..247542 FT /note="similar to EST BI668234 (NID:g15582467)" FT misc_feature 247349..247590 FT /note="similar to EST BG150239 (NID:g12662269)" FT misc_feature 247349..247647 FT /note="similar to EST BF508129 (NID:g11591427)" FT misc_feature 247349..247740 FT /note="similar to EST BG771727 (NID:g14082380)" FT misc_feature 247349..247916 FT /note="similar to EST BE883118 (NID:g10331894)" FT misc_feature 247349..247648 FT /note="similar to EST BG754870 (NID:g14065523)" FT misc_feature 247349..247665 FT /note="similar to EST AW576720 (NID:g7251860)" FT misc_feature 247352..247618 FT /note="similar to EST AV690782 (NID:g10292645)" FT /note="similar to EST AV694641 (NID:g10296504)" FT misc_feature 247352..247752 FT /note="similar to EST AL598687 (NID:g15161378)" FT misc_feature 247352..247671 FT /note="similar to EST AV692437 (NID:g10294300)" FT misc_feature 247352..247667 FT /note="similar to EST BI599433 (NID:g15492372)" FT /note="similar to EST BG718610 (NID:g13997797)" FT misc_feature 247362..247667 FT /note="similar to EST BG391074 (NID:g13284522)" FT misc_feature 247370..247804 FT /note="similar to EST AL571293 (NID:g12928444)" FT misc_feature 247392..247667 FT /note="similar to EST AL119535 (NID:g5925434)" FT misc_feature 247405..247618 FT /note="similar to EST BG289439 (NID:g13045285)" FT misc_feature 247411..247667 FT /note="similar to EST BE694258 (NID:g10081418)" FT misc_feature 247439..247715 FT /note="similar to EST AL598300 (NID:g15160991)" FT misc_feature 247926..248105 FT /note="similar to EST AV692437 (NID:g10294300)" FT misc_feature 247936..248468 FT /note="similar to EST BF056061 (NID:g10809957)" FT misc_feature 247950..248500 FT /note="similar to EST AA575639 (NID:g2350265) vh56g01.r1" FT misc_feature 247956..248575 FT /note="similar to EST BG289439 (NID:g13045285)" FT misc_feature 247963..248148 FT /note="similar to EST X85646 (NID:g886630)" FT misc_feature 248004..248416 FT /note="similar to EST BE700971 (NID:g10088713)" FT misc_feature 248048..248634 FT /note="similar to EST BG288840 (NID:g13044082)" FT misc_feature 248108..248577 FT /note="similar to EST AW020146 (NID:g5873676) df05a05.y1" FT misc_feature 248108..248718 FT /note="similar to EST AW291262 (NID:g6697898)" FT misc_feature 248111..248496 FT /note="similar to EST BB617198 (NID:g15396286)" FT misc_feature 248134..248420 FT /note="similar to EST AL571293 (NID:g12928444)" FT misc_feature 248134..248492 FT /note="similar to EST AL598300 (NID:g15160991)" FT misc_feature 248138..248384 FT /note="similar to EST AA614249 (NID:g2466383) np09g09.s1" FT misc_feature 248149..248399 FT /note="similar to EST BG754870 (NID:g14065523)" FT misc_feature 248180..248466 FT /note="similar to EST AW887346 (NID:g8049359)" FT misc_feature 248196..248500 FT /note="similar to EST BF675662 (NID:g11949557)" FT misc_feature 248211..248500 FT /note="similar to EST BF751655 (NID:g12078331)" FT misc_feature 248253..248602 FT /note="similar to EST BG721813 (NID:g14001000)" FT misc_feature 248253..248633 FT /note="similar to EST BI560594 (NID:g15447908)" FT misc_feature 248253..248576 FT /note="similar to EST BE177799 (NID:g8656951)" FT misc_feature 248253..248613 FT /note="similar to EST BE694258 (NID:g10081418)" FT misc_feature 248253..248599 FT /note="similar to EST BG391074 (NID:g13284522)" FT misc_feature 248253..248493 FT /note="similar to EST BG718610 (NID:g13997797)" FT misc_feature 248253..248566 FT /note="similar to EST BI599433 (NID:g15492372)" FT misc_feature 248254..248525 FT /note="similar to EST AW887417 (NID:g8049430)" FT misc_feature 248254..248509 FT /note="similar to EST AW887410 (NID:g8049423)" FT misc_feature 248289..248609 FT /note="similar to EST AV694641 (NID:g10296504)" FT misc_feature 248289..248605 FT /note="similar to EST AV690782 (NID:g10292645)" FT misc_feature 248296..248626 FT /note="similar to EST BB642289 (NID:g15401845)" FT misc_feature 248311..248626 FT /note="similar to EST BG624004 (NID:g13675375)" FT misc_feature 248318..248610 FT /note="similar to EST BE768441 (NID:g10222099)" FT misc_feature 248337..248500 FT /note="similar to EST AL119535 (NID:g5925434)" FT misc_feature 248648..248720 FT /note="similar to EST BF056061 (NID:g10809957)" FT /note="similar to EST AA614249 (NID:g2466383) np09g09.s1" FT repeat_region 248744..248835 FT /rpt_family="L1" FT repeat_region 248836..249136 FT /rpt_family="Alu" FT repeat_region 249137..249254 FT /rpt_family="L1" FT misc_feature 249195..249712 FT /note="similar to EST AW876304 (NID:g8014387)" FT misc_feature 249196..249783 FT /note="similar to EST AW876242 (NID:g8014307)" FT misc_feature 249419..250088 FT /note="similar to EST BG503950 (NID:g13465467)" FT misc_feature 249593..250186 FT /note="similar to EST BG564801 (NID:g13572453)" FT misc_feature 249924..250452 FT /note="similar to EST AA017091 (NID:g1479255) ze37h09.s1" FT misc_feature 250028..250218 FT /note="similar to EST BE619505 (NID:g9890443)" FT misc_feature 250213..250452 FT /note="similar to EST AI654212 (NID:g4738191) wb24f07.x1" FT repeat_region 250315..250671 FT /rpt_family="SVA" FT misc_feature 250675..250890 FT /note="similar to EST BE619505 (NID:g9890443)" FT misc_feature 250787..251592 FT /note="similar to EST BF965584 (NID:g12332799)" FT misc_feature 251178..251423 FT /note="similar to EST BG702736 (NID:g13974371)" FT repeat_region 251781..252199 FT /rpt_family="L1" FT repeat_region 252302..252590 FT /rpt_family="Alu" FT misc_feature 252424..253113 FT /note="similar to EST BG290372 (NID:g13047171)" FT repeat_region 252599..252791 FT /rpt_family="MIR" FT repeat_region 252919..253905 FT /rpt_family="ERVK" FT repeat_region 254263..254579 FT /rpt_family="ERV1" FT misc_feature 254324..254806 FT /note="similar to EST AI336023 (NID:g4072950) qt42g11.x1" FT misc_feature 254341..254784 FT /note="similar to EST H29997 (NID:g900907) yp44h05.r1" FT misc_feature 254553..254839 FT /note="similar to EST AV752332 (NID:g10910180)" FT repeat_region 254893..255472 FT /rpt_family="ERV1" FT misc_feature 255932..256133 FT /note="similar to EST BG702736 (NID:g13974371)" FT repeat_region 255961..255980 FT /rpt_family="(T)n" FT misc_feature 256713..257250 FT /note="similar to EST AI080623 (NID:g3416874) ox54b02.x1" FT misc_feature 257572..258059 FT /note="similar to EST AI143189 (NID:g3664998) qb72a10.x1" FT repeat_region 257705..258072 FT /rpt_family="ERV1" FT misc_feature 257805..258400 FT /note="similar to EST BE082843 (NID:g8473148)" FT misc_feature 258024..258137 FT /note="similar to EST BF680401 (NID:g11954296)" FT repeat_region 258294..258841 FT /rpt_family="ERV1" FT misc_feature 259213..259304 FT /note="similar to EST AA521021 (NID:g2261564) aa70f10.s1" FT misc_feature 259276..259737 FT /note="similar to EST BI039926 (NID:g14446552)" FT misc_feature 259453..259588 FT /note="similar to EST AA521021 (NID:g2261564) aa70f10.s1" FT misc_feature 259633..259778 FT /note="similar to EST AA521021 (NID:g2261564) aa70f10.s1" FT repeat_region 259783..260087 FT /rpt_family="Alu" FT repeat_region 260160..260182 FT /rpt_family="AT_rich" FT misc_feature 260560..260696 FT /note="similar to EST AL037864 (NID:g5407193)" FT repeat_region 260705..260768 FT /rpt_family="L1" FT repeat_region 260769..260812 FT /rpt_family="Alu" FT repeat_region 260813..261090 FT /rpt_family="Alu" FT repeat_region 261091..261283 FT /rpt_family="Alu" FT misc_feature 261262..261642 FT /note="similar to EST AL037864 (NID:g5407193)" FT repeat_region 261284..261410 FT /rpt_family="L1" FT repeat_region 261401..261429 FT /rpt_family="AT_rich" FT misc_feature 261435..261506 FT /note="similar to EST AI042041 (NID:g3281235) ox60b08.x1" FT misc_feature 261436..261631 FT /note="similar to EST AI539132 (NID:g4453267) tp73a05.x1" FT repeat_region 261616..261641 FT /rpt_family="AT_rich" FT repeat_region 261642..261933 FT /rpt_family="Alu" FT misc_feature 261924..262145 FT /note="similar to EST AI539132 (NID:g4453267) tp73a05.x1" FT misc_feature 261956..262388 FT /note="similar to EST AI761439 (NID:g5177106) wg65f05.x1" FT misc_feature 261961..262388 FT /note="similar to EST BE218003 (NID:g8905321) hv32h01.x1" FT misc_feature 262014..262384 FT /note="similar to EST AL571386 (NID:g12928631)" FT misc_feature 262124..262428 FT /note="similar to EST BF131117 (NID:g10970146)" FT misc_feature 262180..262384 FT /note="similar to EST AV732491 (NID:g10850036)" FT misc_feature 262226..262375 FT /note="similar to EST BG569463 (NID:g13577116)" FT misc_feature 262285..262368 FT /note="similar to EST BG502050 (NID:g13463567)" FT repeat_region 262386..262680 FT /rpt_family="Alu" FT misc_feature 262671..263302 FT /note="similar to EST BG502050 (NID:g13463567)" FT misc_feature 262672..263089 FT /note="similar to EST AW381146 (NID:g6885805)" FT misc_feature 262683..262887 FT /note="similar to EST BG569463 (NID:g13577116)" FT misc_feature 262685..262979 FT /note="similar to EST BF817664 (NID:g12154460)" FT misc_feature 262696..263279 FT /note="similar to EST BG390569 (NID:g13284017)" FT misc_feature 262701..262879 FT /note="similar to EST AV732491 (NID:g10850036)" FT misc_feature 262701..263305 FT /note="similar to EST AL571386 (NID:g12928631)" FT misc_feature 262727..263090 FT /note="similar to EST BF131117 (NID:g10970146)" FT misc_feature 262743..263325 FT /note="similar to EST BG527927 (NID:g13519464)" FT misc_feature 262769..262982 FT /note="similar to EST AV723147 (NID:g10826320)" FT misc_feature 262814..263279 FT /note="similar to EST AV707929 (NID:g10725194)" FT misc_feature 262902..263008 FT /note="similar to EST AI633988 (NID:g4685318) wa32d07.x1" FT misc_feature 262931..263288 FT /note="similar to EST AW191584 (NID:g7381834)" FT misc_feature 262952..263279 FT /note="similar to EST BG403073 (NID:g13296521)" FT misc_feature 263036..263279 FT /note="similar to EST AU132789 (NID:g10993328)" FT misc_feature 263038..263359 FT /note="similar to EST AI633988 (NID:g4685318) wa32d07.x1" FT misc_feature 263045..263279 FT /note="similar to EST BE897089 (NID:g10362197)" FT misc_feature 263047..263243 FT /note="similar to EST AV723147 (NID:g10826320)" FT misc_feature 263074..263234 FT /note="similar to EST BF716918 (NID:g12016190)" FT misc_feature 263076..263279 FT /note="similar to EST BG619418 (NID:g13670789)" FT misc_feature 263091..263279 FT /note="similar to EST BE161707 (NID:g8624428)" FT misc_feature 263106..263279 FT /note="similar to EST AA768909 (NID:g2820147) nz82h01.s1" FT misc_feature 263132..263279 FT /note="similar to EST AW044288 (NID:g5904817) wv67c09.x1" FT /note="similar to EST AI732980 (NID:g5054093) og79e08.x5" FT /note="similar to EST AW272732 (NID:g6659689) xu22a04.x1" FT misc_feature 263135..263279 FT /note="similar to EST AA205432 (NID:g1803422) zq66a11.s1" FT misc_feature 263175..263354 FT /note="similar to EST AW392975 (NID:g6897634)" FT misc_feature 263189..263279 FT /note="similar to EST BE842803 (NID:g10275181)" FT misc_feature 263203..263279 FT /note="similar to EST AI554749 (NID:g4487112) tn27h04.x1" FT repeat_region 263359..263658 FT /rpt_family="Alu" FT misc_feature 263655..263955 FT /note="similar to EST BG563867 (NID:g13571519)" FT misc_feature 263657..263955 FT /note="similar to EST BG569463 (NID:g13577116)" FT misc_feature 263670..263955 FT /note="similar to EST BF796887 (NID:g12101941)" FT misc_feature 263696..263777 FT /note="similar to EST BG982037 (NID:g14384772)" FT misc_feature 263802..263943 FT /note="similar to EST BI087543 (NID:g14505873)" FT misc_feature 263882..263955 FT /note="similar to EST AA351526 (NID:g2003846)" FT repeat_region 263969..264243 FT /rpt_family="Alu" FT repeat_region 264215..264243 FT /rpt_family="(A)n" FT misc_feature 264241..264642 FT /note="similar to EST AW384913 (NID:g6889572)" FT misc_feature 264254..264508 FT /note="similar to EST BF844274 (NID:g12199610)" FT misc_feature 264288..264746 FT /note="similar to EST AA018330 (NID:g1481604) ze41b02.r1" FT misc_feature 264531..264643 FT /note="similar to EST BG390569 (NID:g13284017)" FT misc_feature 264533..266241 FT /note="similar to EST AF150239 (NID:g5133675)" FT misc_feature 264537..265342 FT /note="similar to EST BG429909 (NID:g13336415)" FT misc_feature 264545..264726 FT /note="similar to EST AA205471 (NID:g1803461) zq66a11.r1" FT misc_feature 264557..265089 FT /note="similar to EST AW385501 (NID:g6890160)" FT misc_feature 264564..265268 FT /note="similar to EST BG741860 (NID:g14052513)" FT misc_feature 264571..265090 FT /note="similar to EST AW835596 (NID:g7929570)" FT misc_feature 264621..265490 FT /note="similar to EST BI760718 (NID:g15752296)" FT misc_feature 264632..264941 FT /note="similar to EST AL597650 (NID:g15159317)" FT misc_feature 264831..265211 FT /note="similar to EST AV714960 (NID:g10796477)" FT misc_feature 264864..265594 FT /note="similar to EST AA209235 (NID:g1807250) zq85f02.r1" FT misc_feature 264872..265726 FT /note="similar to EST BF979945 (NID:g12347160)" FT misc_feature 264895..265742 FT /note="similar to EST BI760646 (NID:g15752211)" FT misc_feature 264927..265768 FT /note="similar to EST BG287904 (NID:g13042206)" FT misc_feature 264953..265685 FT /note="similar to EST BG611334 (NID:g13662705)" FT misc_feature 264965..265664 FT /note="similar to EST BI248815 (NID:g14795578)" FT misc_feature 264985..265577 FT /note="similar to EST BE161630 (NID:g8624351)" FT misc_feature 264996..265740 FT /note="similar to EST BG529798 (NID:g13521335)" FT misc_feature 265014..265686 FT /note="similar to EST BF020339 (NID:g10751671) uw64e04.x1" FT misc_feature 265025..265730 FT /note="similar to EST BF345717 (NID:g11293312)" FT misc_feature 265026..265686 FT /note="similar to EST AL042522 (NID:g5421978)" FT misc_feature 265033..265839 FT /note="similar to EST BE734756 (NID:g10148748)" FT misc_feature 265037..265859 FT /note="similar to EST BE253942 (NID:g9124364)" FT misc_feature 265047..265824 FT /note="similar to EST BF137944 (NID:g10976984)" FT misc_feature 265047..265844 FT /note="similar to EST BG617080 (NID:g13668451)" FT misc_feature 265064..265880 FT /note="similar to EST BG470624 (NID:g13402899)" FT misc_feature 265070..265742 FT /note="similar to EST BE396253 (NID:g9341618)" FT misc_feature 265071..265495 FT /note="similar to EST BF044745 (NID:g10761800)" FT misc_feature 265073..265498 FT /note="similar to EST BG358060 (NID:g13270925)" FT misc_feature 265082..265833 FT /note="similar to EST AU123664 (NID:g10948380)" FT misc_feature 265106..265801 FT /note="similar to EST BF699661 (NID:g11985069)" FT misc_feature 265112..265685 FT /note="similar to EST AW543236 (NID:g7185653)" FT misc_feature 265113..265576 FT /note="similar to EST AW921454 (NID:g8087278)" FT misc_feature 265113..265716 FT /note="similar to EST BI669874 (NID:g15584107)" FT misc_feature 265114..265784 FT /note="similar to EST BF240985 (NID:g11154910)" FT misc_feature 265114..265889 FT /note="similar to EST BG027418 (NID:g12416023)" FT misc_feature 265117..265762 FT /note="similar to EST BE826200 (NID:g10258578)" FT misc_feature 265117..265750 FT /note="similar to EST AU132789 (NID:g10993328)" FT misc_feature 265117..265526 FT /note="similar to EST BE842803 (NID:g10275181)" FT misc_feature 265119..265889 FT /note="similar to EST AL042967 (NID:g5422398)" FT misc_feature 265121..265652 FT /note="similar to EST BG243357 (NID:g12753172)" FT misc_feature 265126..265690 FT /note="similar to EST AW749734 (NID:g7664666)" FT misc_feature 265144..265918 FT /note="similar to EST BG435048 (NID:g13341554)" FT misc_feature 265144..265888 FT /note="similar to EST AU123448 (NID:g10948164)" FT misc_feature 265146..265686 FT /note="similar to EST BF817669 (NID:g12154468)" FT misc_feature 265147..266003 FT /note="similar to EST BG619358 (NID:g13670729)" FT misc_feature 265150..265730 FT /note="similar to EST BE177809 (NID:g8656961)" FT misc_feature 265153..265760 FT /note="similar to EST AW949650 (NID:g8139282)" FT misc_feature 265156..265670 FT /note="similar to EST AI788680 (NID:g5336396) uk52f01.x1" FT misc_feature 265180..265634 FT /note="similar to EST BF906623 (NID:g12298081)" FT misc_feature 265196..265484 FT /note="similar to EST BG923538 (NID:g14304014)" FT misc_feature 265197..265911 FT /note="similar to EST AW976399 (NID:g8167626)" FT misc_feature 265197..265764 FT /note="similar to EST AW392960 (NID:g6897619)" FT misc_feature 265197..265763 FT /note="similar to EST AI680077 (NID:g4890259) tw64g09.x1" FT misc_feature 265197..265620 FT /note="similar to EST BG663504 (NID:g13885426)" FT misc_feature 265198..265775 FT /note="similar to EST BG403135 (NID:g13296583)" FT misc_feature 265198..265838 FT /note="similar to EST BE255702 (NID:g9126146)" FT misc_feature 265198..265745 FT /note="similar to EST BF018222 (NID:g10749554) uw91b05.x1" FT misc_feature 265198..265751 FT /note="similar to EST AI647807 (NID:g4726485) uk43d06.x1" FT misc_feature 265198..265639 FT /note="similar to EST BF749053 (NID:g12075729)" FT misc_feature 265201..265725 FT /note="similar to EST BG619418 (NID:g13670789)" FT misc_feature 265201..265859 FT /note="similar to EST BE254914 (NID:g9125347)" FT /note="similar to EST BE255873 (NID:g9126320)" FT misc_feature 265201..265731 FT /note="similar to EST BE897089 (NID:g10362197)" FT misc_feature 265201..265583 FT /note="similar to EST AI732980 (NID:g5054093) og79e08.x5" FT misc_feature 265202..265664 FT /note="similar to EST BF443692 (NID:g11503784)" FT misc_feature 265203..265593 FT /note="similar to EST AI280287 (NID:g3918520) qm68b12.x1" FT misc_feature 265203..265684 FT /note="similar to EST BF773250 (NID:g12121150)" FT misc_feature 265204..265883 FT /note="similar to EST BG433257 (NID:g13339763)" FT misc_feature 265204..265809 FT /note="similar to EST AW384427 (NID:g6889086)" FT misc_feature 265207..265936 FT /note="similar to EST BG285112 (NID:g13036723)" FT misc_feature 265207..265991 FT /note="similar to EST BG259401 (NID:g12769217)" FT misc_feature 265207..265859 FT /note="similar to EST BE257877 (NID:g9128358)" FT misc_feature 265210..266005 FT /note="similar to EST AU143734 (NID:g11005255)" FT misc_feature 265213..265918 FT /note="similar to EST BF700774 (NID:g11986182)" FT misc_feature 265218..265907 FT /note="similar to EST AI792344 (NID:g5340060) an30d02.y5" FT misc_feature 265225..265880 FT /note="similar to EST BG473092 (NID:g13405367)" FT misc_feature 265225..265938 FT /note="similar to EST AI733621 (NID:g5054734) an30d02.x5" FT misc_feature 265227..265961 FT /note="similar to EST AI566486 (NID:g4524938) tr60d09.x2" FT misc_feature 265228..265751 FT /note="similar to EST BE064551 (NID:g8409201)" FT misc_feature 265228..265880 FT /note="similar to EST AV704018 (NID:g10721339)" FT misc_feature 265229..265762 FT /note="similar to EST BF210050 (NID:g11103636)" FT misc_feature 265229..265374 FT /note="similar to EST AW384913 (NID:g6889572)" FT misc_feature 265229..265730 FT /note="similar to EST BG982037 (NID:g14384772)" FT misc_feature 265229..265907 FT /note="similar to EST BI087543 (NID:g14505873)" FT misc_feature 265230..265985 FT /note="similar to EST BG027032 (NID:g12415253)" FT misc_feature 265231..265379 FT /note="similar to EST BI048136 (NID:g14454758)" FT misc_feature 265234..265859 FT /note="similar to EST BE256052 (NID:g9126506)" FT misc_feature 265238..265752 FT /note="similar to EST AW875546 (NID:g8013423)" FT misc_feature 265239..265859 FT /note="similar to EST BE251990 (NID:g9122124)" FT misc_feature 265241..265340 FT /note="similar to EST BG569463 (NID:g13577116)" FT misc_feature 265243..265940 FT /note="similar to EST BF797755 (NID:g12102809)" FT misc_feature 265243..265884 FT /note="similar to EST BI093435 (NID:g14511765)" FT misc_feature 265251..265752 FT /note="similar to EST AW875560 (NID:g8013437)" FT misc_feature 265254..265895 FT /note="similar to EST BG818171 (NID:g14165758)" FT misc_feature 265264..265859 FT /note="similar to EST BE255732 (NID:g9126177)" FT misc_feature 265281..265731 FT /note="similar to EST AA476109 (NID:g2203960) vh17b10.r1" FT misc_feature 265281..266042 FT /note="similar to EST BG616121 (NID:g13667492)" FT misc_feature 265285..265809 FT /note="similar to EST AA768909 (NID:g2820147) nz82h01.s1" FT misc_feature 265285..265798 FT /note="similar to EST BG403073 (NID:g13296521)" FT misc_feature 265285..265739 FT /note="similar to EST BE161707 (NID:g8624428)" FT misc_feature 265285..265836 FT /note="similar to EST AI554749 (NID:g4487112) tn27h04.x1" FT misc_feature 265285..265762 FT /note="similar to EST AW272732 (NID:g6659689) xu22a04.x1" FT misc_feature 265297..265676 FT /note="similar to EST T05813 (NID:g316963)" FT misc_feature 265298..265778 FT /note="similar to EST AW859939 (NID:g7955632)" FT misc_feature 265309..265752 FT /note="similar to EST AI049550 (NID:g3298667) an30d02.x1" FT misc_feature 265312..265859 FT /note="similar to EST BE257993 (NID:g9128475)" FT misc_feature 265313..265637 FT /note="similar to EST AI042041 (NID:g3281235) ox60b08.x1" FT misc_feature 265318..265859 FT /note="similar to EST BE251753 (NID:g9121884)" FT misc_feature 265325..265703 FT /note="similar to EST AA205471 (NID:g1803461) zq66a11.r1" FT misc_feature 265334..265822 FT /note="similar to EST AA984704 (NID:g3163229) am90a04.s1" FT misc_feature 265364..265923 FT /note="similar to EST BF749575 (NID:g12076251)" FT misc_feature 265365..265716 FT /note="similar to EST AA351793 (NID:g2004111)" FT misc_feature 265365..265724 FT /note="similar to EST BF748343 (NID:g12075019)" FT misc_feature 265366..266209 FT /note="similar to EST AU133219 (NID:g10993758)" FT misc_feature 265369..265575 FT /note="similar to EST AV707929 (NID:g10725194)" FT misc_feature 265369..265806 FT /note="similar to EST AW392975 (NID:g6897634)" FT misc_feature 265391..265737 FT /note="similar to EST BF893899 (NID:g12285358)" FT misc_feature 265401..265656 FT /note="similar to EST BF921199 (NID:g12317087)" FT misc_feature 265402..265974 FT /note="similar to EST AI476267 (NID:g4329312) ti72g01.x1" FT misc_feature 265402..265918 FT /note="similar to EST AA480353 (NID:g2208504) ne33b10.s1" FT misc_feature 265402..265741 FT /note="similar to EST AW241205 (NID:g6574959) xa52g11.x1" FT misc_feature 265404..265989 FT /note="similar to EST BG388303 (NID:g13281749)" FT misc_feature 265404..265778 FT /note="similar to EST AA587596 (NID:g2397271) nd17a11.s1" FT /note="similar to EST AW105262 (NID:g6075997) xd46b11.x1" FT misc_feature 265408..265886 FT /note="similar to EST BE287831 (NID:g9167111)" FT misc_feature 265409..265880 FT /note="similar to EST BF796887 (NID:g12101941)" FT misc_feature 265409..265742 FT /note="similar to EST BG563867 (NID:g13571519)" FT misc_feature 265409..265757 FT /note="similar to EST BF716918 (NID:g12016190)" FT misc_feature 265409..265718 FT /note="similar to EST AA351526 (NID:g2003846)" FT misc_feature 265415..265926 FT /note="similar to EST BF921029 (NID:g12316917)" FT misc_feature 265422..266005 FT /note="similar to EST BE870310 (NID:g10319086)" FT misc_feature 265424..265715 FT /note="similar to EST AL589342 (NID:g13243114)" FT misc_feature 265455..265758 FT /note="similar to EST AW884543 (NID:g8046555)" FT misc_feature 265455..265836 FT /note="similar to EST BE878800 (NID:g10327576)" FT misc_feature 265472..265730 FT /note="similar to EST BI048136 (NID:g14454758)" FT misc_feature 265472..265664 FT /note="similar to EST BF817664 (NID:g12154460)" FT misc_feature 265499..265863 FT /note="similar to EST BG819130 (NID:g14166717)" FT misc_feature 265502..265718 FT /note="similar to EST AV723147 (NID:g10826320)" FT misc_feature 265537..265940 FT /note="similar to EST AW044288 (NID:g5904817) wv67c09.x1" FT misc_feature 265537..265982 FT /note="similar to EST AA205432 (NID:g1803422) zq66a11.s1" FT misc_feature 265547..265820 FT /note="similar to EST AV714960 (NID:g10796477)" FT misc_feature 265616..266005 FT /note="similar to EST BF376299 (NID:g11338324)" FT misc_feature 266028..266502 FT /note="similar to EST BG026620 (NID:g12414417)" FT misc_feature 266029..266263 FT /note="similar to EST BG819130 (NID:g14166717)" FT repeat_region 266505..266760 FT /rpt_family="L1" FT repeat_region 267394..267804 FT /rpt_family="L1" FT repeat_region 268025..268488 FT /rpt_family="L1" FT repeat_region 268102..268137 FT /rpt_family="AT_rich" FT repeat_region 268686..269067 FT /rpt_family="L1" FT repeat_region 269106..269392 FT /rpt_family="L1" FT repeat_region 269396..269822 FT /rpt_family="L1" FT repeat_region 269486..269521 FT /rpt_family="AT_rich" FT repeat_region 269788..269816 FT /rpt_family="AT_rich" FT repeat_region 270172..270358 FT /rpt_family="L1" FT repeat_region 270360..271467 FT /rpt_family="L1" FT repeat_region 271611..271633 FT /rpt_family="AT_rich" FT repeat_region 271659..271952 FT /rpt_family="L1" FT repeat_region 272075..272251 FT /rpt_family="L1" FT repeat_region 272252..272873 FT /rpt_family="ERVL" FT repeat_region 272874..272945 FT /rpt_family="L1" FT repeat_region 272946..273246 FT /rpt_family="Alu" FT repeat_region 273247..273490 FT /rpt_family="L1" FT repeat_region 274099..274382 FT /rpt_family="Alu" FT repeat_region 274410..274961 FT /rpt_family="L1" FT repeat_region 274940..275924 FT /rpt_family="L1" FT repeat_region 276079..276152 FT /rpt_family="Alu" FT repeat_region 276135..276165 FT /rpt_family="AT_rich" FT repeat_region 276206..276502 FT /rpt_family="Alu" FT repeat_region 276602..276760 FT /rpt_family="L1" FT repeat_region 276749..276769 FT /rpt_family="AT_rich" FT repeat_region 276790..277109 FT /rpt_family="MaLR" FT repeat_region 277117..277700 FT /rpt_family="L1" FT repeat_region 277701..277998 FT /rpt_family="Alu" FT repeat_region 277999..278357 FT /rpt_family="L1" FT repeat_region 278235..278259 FT /rpt_family="AT_rich" FT repeat_region 278382..278688 FT /rpt_family="Alu" FT repeat_region 278660..278723 FT /rpt_family="(A)n" FT repeat_region 278720..278849 FT /rpt_family="ERV1" FT repeat_region 278939..279022 FT /rpt_family="ERV1" FT repeat_region 279018..279536 FT /rpt_family="ERV1" FT repeat_region 279542..279749 FT /rpt_family="Alu" FT misc_feature 279743..279946 FT /note="similar to EST AL546296 (NID:g12879273)" FT repeat_region 279918..280143 FT /rpt_family="L1" FT repeat_region 280146..280456 FT /rpt_family="L1" FT repeat_region 280484..280604 FT /rpt_family="L1" FT misc_feature 280652..280981 FT /note="similar to EST AL546296 (NID:g12879273)" FT repeat_region 280660..280948 FT /rpt_family="Alu" FT repeat_region 281009..281302 FT /rpt_family="Alu" FT misc_feature 281049..281200 FT /note="similar to EST BG503551 (NID:g13465068)" FT repeat_region 281337..281430 FT /rpt_family="L1" FT repeat_region 281424..281449 FT /rpt_family="AT_rich" FT repeat_region 281441..281556 FT /rpt_family="Alu" FT repeat_region 281580..282494 FT /rpt_family="L1" FT repeat_region 282561..282663 FT /rpt_family="Alu" FT repeat_region 282716..282953 FT /rpt_family="MaLR" FT misc_feature 282947..283360 FT /note="similar to EST BG287422 (NID:g13041248)" FT misc_feature 282957..283206 FT /note="similar to EST F33235 (NID:g4818861)" FT misc_feature 282992..283520 FT /note="similar to EST BF967698 (NID:g12334913)" FT misc_feature 283034..283476 FT /note="similar to EST BG291062 (NID:g13048653)" FT misc_feature 283034..283520 FT /note="similar to EST BI254149 (NID:g14806278)" FT /note="similar to EST BE881760 (NID:g10330536)" FT misc_feature 283034..283519 FT /note="similar to EST AA502757 (NID:g2237724) ne43b02.s1" FT misc_feature 283034..283203 FT /note="similar to EST AA040348 (NID:g1516625) zk45e10.r1" FT misc_feature 283247..283520 FT /note="similar to EST AW372242 (NID:g6876896)" FT misc_feature 283257..283520 FT /note="similar to EST AL039324 (NID:g5408394)" FT repeat_region 283534..283705 FT /rpt_family="MaLR" FT repeat_region 283706..283976 FT /rpt_family="L1" FT repeat_region 283975..284753 FT /rpt_family="L1" FT repeat_region 284792..285031 FT /rpt_family="L1" FT repeat_region 285050..285146 FT /rpt_family="Alu" FT repeat_region 285170..286101 FT /rpt_family="L1" FT repeat_region 285244..285278 FT /rpt_family="AT_rich" FT repeat_region 286102..286363 FT /rpt_family="Alu" FT repeat_region 286364..286484 FT /rpt_family="L1" FT repeat_region 286499..286553 FT /rpt_family="L1" FT repeat_region 286554..286880 FT /rpt_family="Alu" FT repeat_region 286672..286707 FT /rpt_family="(A)n" FT repeat_region 286857..286880 FT /rpt_family="(A)n" FT repeat_region 286881..287641 FT /rpt_family="L1" FT repeat_region 287034..287111 FT /rpt_family="(TA)n" FT repeat_region 287605..287639 FT /rpt_family="AT_rich" FT repeat_region 287674..287799 FT /rpt_family="MER2_type" FT repeat_region 287800..288087 FT /rpt_family="Alu" FT misc_feature 287971..288229 FT /note="similar to EST BF964632 (NID:g12331758)" FT repeat_region 288088..288152 FT /rpt_family="MER2_type" FT misc_feature 288246..288582 FT /note="similar to EST BF701340 (NID:g11986748)" FT repeat_region 288389..288575 FT /rpt_family="MER1_type" FT misc_feature 289195..289912 FT /note="similar to EST AI122756 (NID:g3538522) qa48e03.x1" FT misc_feature 289223..289322 FT /note="similar to EST BG243357 (NID:g12753172)" FT /note="similar to EST BG923538 (NID:g14304014)" FT misc_feature 289224..289322 FT /note="similar to EST AL546296 (NID:g12879273)" FT misc_feature 289745..289945 FT /note="similar to EST BF964632 (NID:g12331758)" FT misc_feature 289756..289944 FT /note="similar to EST BF680401 (NID:g11954296)" FT misc_feature 289774..289946 FT /note="similar to EST BG243357 (NID:g12753172)" FT misc_feature 289786..289945 FT /note="similar to EST BG026620 (NID:g12414417)" FT misc_feature 289792..289935 FT /note="similar to EST AF150239 (NID:g5133675)" FT misc_feature 289803..289944 FT /note="similar to EST BF701340 (NID:g11986748)" FT misc_feature 289815..289944 FT /note="similar to EST AU138611 (NID:g11000132)" FT misc_feature 289818..289946 FT /note="similar to EST BG923538 (NID:g14304014)" FT misc_feature 289818..289945 FT /note="similar to EST AL546296 (NID:g12879273)" FT repeat_region 290254..290412 FT /rpt_family="MER1_type" FT repeat_region 290779..291077 FT /rpt_family="Alu" FT repeat_region 291397..291421 FT /rpt_family="(A)n" FT misc_feature 291419..291720 FT /note="similar to EST N20005 (NID:g1124672) yx31e01.s1" FT misc_feature 291861..292121 FT /note="similar to EST AI263148 (NID:g3871351) qw90c12.x1" FT misc_feature 291877..292359 FT /note="similar to EST AW020056 (NID:g5873586) df03e07.y1" FT misc_feature 291889..292359 FT /note="similar to EST BI491082 (NID:g15330426)" FT misc_feature 292029..292088 FT /note="similar to EST AV726004 (NID:g10831958)" FT misc_feature 292064..292390 FT /note="similar to EST AA496479 (NID:g2229800) zv37h05.r1" FT repeat_region 292070..292121 FT /rpt_family="L2" FT misc_feature 292145..292193 FT /note="similar to EST AV726004 (NID:g10831958)" FT misc_feature 292219..292468 FT /note="similar to EST AV726004 (NID:g10831958)" FT misc_feature 292413..292594 FT /note="similar to EST AA496479 (NID:g2229800) zv37h05.r1" FT misc_feature 292532..292881 FT /note="similar to EST BF757551 (NID:g12105555)" FT repeat_region 293011..293133 FT /rpt_family="ERV1" FT repeat_region 293161..293482 FT /rpt_family="(TA)n" FT repeat_region 293484..293792 FT /rpt_family="Alu" FT repeat_region 293652..293671 FT /rpt_family="(T)n" FT repeat_region 293802..293969 FT /rpt_family="ERV1" FT repeat_region 293970..294273 FT /rpt_family="Alu" FT repeat_region 294244..294280 FT /rpt_family="(A)n" FT repeat_region 294274..294552 FT /rpt_family="ERV1" FT repeat_region 294553..295662 FT /rpt_family="L1" FT repeat_region 295663..296562 FT /rpt_family="ERV1" FT repeat_region 296567..296624 FT /rpt_family="Alu" FT repeat_region 296625..297180 FT /rpt_family="ERV1" FT repeat_region 297185..297423 FT /rpt_family="Alu" FT repeat_region 297425..297527 FT /rpt_family="ERV1" FT repeat_region 297603..297676 FT /rpt_family="ERV1" FT repeat_region 297707..298220 FT /rpt_family="ERV1" FT repeat_region 298221..298569 FT /rpt_family="ERV1" FT repeat_region 298602..298725 FT /rpt_family="ERV1" FT repeat_region 298783..299469 FT /rpt_family="ERV1" FT misc_feature 299097..299252 FT /note="similar to EST BF701340 (NID:g11986748)" FT misc_feature 299097..299246 FT /note="similar to EST AU138611 (NID:g11000132)" FT /note="similar to EST BF680401 (NID:g11954296)" FT repeat_region 299689..299968 FT /rpt_family="MER1_type" FT misc_feature 299996..300237 FT /note="similar to EST BG010868 (NID:g12458550)" FT repeat_region 300172..300769 FT /rpt_family="ERV1" FT misc_feature 300771..301157 FT /note="similar to EST W90643 (NID:g1406538) zh76c04.r1" FT repeat_region 301031..301599 FT /rpt_family="ERV1" FT misc_feature 301465..301994 FT /note="similar to EST BF345586 (NID:g11293181)" FT misc_feature 301503..302080 FT /note="similar to EST BG338431 (NID:g13144869)" FT repeat_region 301795..302234 FT /rpt_family="MaLR" FT misc_feature 302094..302557 FT /note="similar to EST BG338431 (NID:g13144869)" FT misc_feature 302253..302709 FT /note="similar to EST AU144283 (NID:g11005804)" FT misc_feature 302268..302708 FT /note="similar to EST AA278523 (NID:g1919861) zs76b08.r1" FT misc_feature 302434..302891 FT /note="similar to EST AI703192 (NID:g4991092) wd92h04.x1" FT misc_feature 302476..302653 FT /note="similar to EST AA262062 (NID:g1898186) zs18f01.r1" FT repeat_region 302910..303080 FT /rpt_family="MER1_type" FT misc_feature 303093..303371 FT /note="similar to EST AW938547 (NID:g8113990)" FT repeat_region 303494..303554 FT /rpt_family="Alu" FT repeat_region 303640..303745 FT /rpt_family="L1" FT repeat_region 303940..303994 FT /rpt_family="T-rich" FT repeat_region 303973..304275 FT /rpt_family="Alu" FT repeat_region 304470..304524 FT /rpt_family="MER1_type" FT repeat_region 306117..306422 FT /rpt_family="Alu" FT repeat_region 306433..306732 FT /rpt_family="Alu" FT repeat_region 306950..307089 FT /rpt_family="Alu" FT repeat_region 307090..307381 FT /rpt_family="Alu" FT repeat_region 307382..307551 FT /rpt_family="Alu" FT repeat_region 307680..307783 FT /rpt_family="GA-rich" FT repeat_region 307819..308456 FT /rpt_family="L1" FT repeat_region 308454..309530 FT /rpt_family="MaLR" FT repeat_region 309531..309881 FT /rpt_family="MaLR" FT repeat_region 310180..310919 FT /rpt_family="L2" FT repeat_region 311816..311883 FT /rpt_family="(TCCA)n" FT repeat_region 312178..312198 FT /rpt_family="(T)n" FT repeat_region 312525..312645 FT /rpt_family="MIR" FT repeat_region 312900..313190 FT /rpt_family="Alu" FT repeat_region 313555..313871 FT /rpt_family="Alu" FT repeat_region 314475..314783 FT /rpt_family="Alu" FT repeat_region 314756..314783 FT /rpt_family="(A)n" FT repeat_region 314784..315085 FT /rpt_family="Alu" FT repeat_region 315066..315085 FT /rpt_family="(A)n" FT misc_feature 315545..315819 FT /note="similar to EST T05041 (NID:g316194)" FT repeat_region 315736..315838 FT /rpt_family="SVA" FT repeat_region 316076..316376 FT /rpt_family="Alu" FT repeat_region 316357..316376 FT /rpt_family="(A)n" FT repeat_region 316409..316703 FT /rpt_family="L1" FT misc_feature 316610..316915 FT /note="similar to EST AW611915 (NID:g7317101) hg90e05.x1" FT /note="similar to EST N53480 (NID:g1194646) yv42c12.s1" FT repeat_region 316669..316714 FT /rpt_family="AT_rich" FT misc_feature 316726..316915 FT /note="similar to EST BG568712 (NID:g13576365)" FT repeat_region 316919..317224 FT /rpt_family="Alu" FT misc_feature 317224..317524 FT /note="similar to EST BG568712 (NID:g13576365)" FT misc_feature 317224..317461 FT /note="similar to EST AW611915 (NID:g7317101) hg90e05.x1" FT misc_feature 317224..317411 FT /note="similar to EST N53480 (NID:g1194646) yv42c12.s1" FT misc_feature 317491..317702 FT /note="similar to EST AA521317 (NID:g2261860) aa79h09.s1" FT repeat_region 317538..317767 FT /rpt_family="Alu" FT repeat_region 318051..318265 FT /rpt_family="L1" FT repeat_region 318266..318557 FT /rpt_family="Alu" FT repeat_region 318558..318906 FT /rpt_family="L1" FT repeat_region 318907..319211 FT /rpt_family="Alu" FT repeat_region 319212..319759 FT /rpt_family="L1" FT repeat_region 319760..319788 FT /rpt_family="(T)n" FT repeat_region 320077..320171 FT /rpt_family="L1" FT repeat_region 320246..322478 FT /rpt_family="L1" FT repeat_region 322479..322967 FT /rpt_family="ERVK" FT repeat_region 322968..323003 FT /rpt_family="L1" FT repeat_region 323015..323300 FT /rpt_family="Alu" FT repeat_region 323300..323359 FT /rpt_family="(CATA)n" FT repeat_region 323363..324372 FT /rpt_family="ERVK" FT repeat_region 324384..324743 FT /rpt_family="L1" FT repeat_region 324485..324505 FT /rpt_family="AT_rich" FT repeat_region 324744..324766 FT /rpt_family="(T)n" FT repeat_region 325046..325313 FT /rpt_family="L1" FT repeat_region 325314..325611 FT /rpt_family="Alu" FT repeat_region 325612..325838 FT /rpt_family="L1" FT repeat_region 325781..325808 FT /rpt_family="AT_rich" FT repeat_region 325848..325876 FT /rpt_family="AT_rich" FT repeat_region 325940..326023 FT /rpt_family="L1" FT repeat_region 326162..326458 FT /rpt_family="Alu" FT repeat_region 326468..326707 FT /rpt_family="Alu" FT repeat_region 326767..326794 FT /rpt_family="AT_rich" FT repeat_region 326795..327053 FT /rpt_family="Alu" FT repeat_region 327282..327325 FT /rpt_family="AT_rich" FT repeat_region 327485..327520 FT /rpt_family="AT_rich" FT repeat_region 327521..327826 FT /rpt_family="Alu" FT repeat_region 327802..327825 FT /rpt_family="(CAAA)n" FT repeat_region 328243..328364 FT /rpt_family="MIR" FT repeat_region 328793..328860 FT /rpt_family="(TGGA)n" FT repeat_region 329758..329978 FT /rpt_family="MIR" FT repeat_region 330157..330715 FT /rpt_family="L1" FT misc_feature 330163..332394 FT /note="CpG_island (%GC=66.5, o/e=0.80, #CpGs=191)" FT repeat_region 331192..331321 FT /rpt_family="(TG)n" FT repeat_region 331372..332014 FT /rpt_family="ERV1" FT misc_feature 331599..331775 FT /note="similar to EST BI562208 (NID:g15449522)" FT /note="similar to EST BI561969 (NID:g15449283)" FT misc_feature 331601..331775 FT /note="similar to EST BG779893 (NID:g14050210)" FT misc_feature 331615..331775 FT /note="similar to EST BI560805 (NID:g15448119)" FT misc_feature 331633..331775 FT /note="similar to EST AW963294 (NID:g8153130)" FT misc_feature 331669..331775 FT /note="similar to EST BE787585 (NID:g10208783)" FT misc_feature 331690..331775 FT /note="similar to EST BG257405 (NID:g12767221)" FT misc_feature 331693..331775 FT /note="similar to EST BE781790 (NID:g10202988)" FT /note="similar to EST BF684277 (NID:g11969685)" FT misc_feature 331697..331775 FT /note="similar to EST BG717274 (NID:g13996461)" FT repeat_region 332155..332278 FT /rpt_family="ERV1" FT repeat_region 332311..332654 FT /rpt_family="ERV1" FT repeat_region 332655..333193 FT /rpt_family="ERV1" FT repeat_region 333330..334759 FT /rpt_family="ERV1" FT repeat_region 334856..335148 FT /rpt_family="Alu" FT misc_feature 335337..335796 FT /note="similar to EST AI335588 (NID:g4072515) qt36a09.x1" FT misc_feature 335553..335799 FT /note="similar to EST AW197712 (NID:g6476942) xn87c03.x1" FT misc_feature 335945..336314 FT /note="similar to EST BG696608 (NID:g13961924)" FT repeat_region 336281..336351 FT /rpt_family="MER1_type" FT repeat_region 336428..336525 FT /rpt_family="MER1_type" FT misc_feature 336536..336753 FT /note="similar to EST BI752757 (NID:g15744335)" FT /note="similar to EST AA633038 (NID:g2556452) nq10a12.s1" FT misc_feature 336543..336753 FT /note="similar to EST BG257674 (NID:g12767490)" FT misc_feature 336590..336753 FT /note="similar to EST AA805544 (NID:g2874294) oc18c08.s1" FT repeat_region 337233..337540 FT /rpt_family="Alu" FT repeat_region 337514..337540 FT /rpt_family="(A)n" FT misc_feature 337568..337697 FT /note="similar to EST BG722010 (NID:g14001197)" FT /note="similar to EST BG719693 (NID:g13998880)" FT misc_feature 337569..337697 FT /note="similar to EST BG715857 (NID:g13995044)" FT misc_feature 337570..337695 FT /note="similar to EST AI095103 (NID:g3434079) qa14h02.x1" FT misc_feature 337571..337697 FT /note="similar to EST AW963294 (NID:g8153130)" FT /note="similar to EST BG717274 (NID:g13996461)" FT /note="similar to EST BI561969 (NID:g15449283)" FT /note="similar to EST BE787585 (NID:g10208783)" FT /note="similar to EST BI560805 (NID:g15448119)" FT /note="similar to EST BG257405 (NID:g12767221)" FT /note="similar to EST BF684277 (NID:g11969685)" FT /note="similar to EST BG779893 (NID:g14050210)" FT /note="similar to EST BI562208 (NID:g15449522)" FT misc_feature 337586..337697 FT /note="similar to EST BE164637 (NID:g8627358)" FT misc_feature 337643..337697 FT /note="similar to EST BG624004 (NID:g13675375)" FT misc_feature 337809..338258 FT /note="similar to EST AI091022 (NID:g3430081) qa45e12.s1" FT repeat_region 338098..338120 FT /rpt_family="AT_rich" FT misc_feature 338124..338219 FT /note="similar to EST BG717274 (NID:g13996461)" FT /note="similar to EST BG722010 (NID:g14001197)" FT /note="similar to EST BI561969 (NID:g15449283)" FT /note="similar to EST BI560805 (NID:g15448119)" FT /note="similar to EST BE781790 (NID:g10202988)" FT /note="similar to EST BG257405 (NID:g12767221)" FT /note="similar to EST AI092258 (NID:g3427231) oz97c10.x1" FT /note="similar to EST BI562208 (NID:g15449522)" FT /note="similar to EST BE164637 (NID:g8627358)" FT /note="similar to EST BG719693 (NID:g13998880)" FT /note="similar to EST AW963294 (NID:g8153130)" FT misc_feature 338124..338213 FT /note="similar to EST BG624004 (NID:g13675375)" FT misc_feature 338124..338613 FT /note="similar to EST BF684277 (NID:g11969685)" FT misc_feature 338124..338203 FT /note="similar to EST BG715857 (NID:g13995044)" FT misc_feature 338124..338221 FT /note="similar to EST BG779893 (NID:g14050210)" FT misc_feature 338302..338565 FT /note="similar to EST AI095103 (NID:g3434079) qa14h02.x1" FT repeat_region 338303..338608 FT /rpt_family="Alu" FT misc_feature 338310..339034 FT /note="similar to EST BG400733 (NID:g13294181)" FT repeat_region 338582..338608 FT /rpt_family="AT_rich" FT misc_feature 338583..338857 FT /note="similar to EST BI016270 (NID:g14420341)" FT misc_feature 338852..339091 FT /note="similar to EST AA349226 (NID:g2001463)" FT repeat_region 339192..339291 FT /rpt_family="MER1_type" FT repeat_region 339292..339539 FT /rpt_family="Alu" FT repeat_region 339519..339539 FT /rpt_family="(A)n" FT misc_feature 339524..340011 FT /note="similar to EST AW978510 (NID:g8169777)" FT repeat_region 339540..339622 FT /rpt_family="MER1_type" FT misc_feature 339722..339961 FT /note="similar to EST AI668575 (NID:g4827883) yj94d10.x5" FT repeat_region 339882..340084 FT /rpt_family="MER2_type" FT misc_feature 339981..340131 FT /note="similar to EST AI668575 (NID:g4827883) yj94d10.x5" FT repeat_region 340116..340820 FT /rpt_family="L1" FT repeat_region 340615..340668 FT /rpt_family="(TATATG)n" FT repeat_region 340821..341124 FT /rpt_family="Alu" FT repeat_region 341129..341426 FT /rpt_family="Alu" FT repeat_region 341427..341510 FT /rpt_family="L1" FT repeat_region 341514..341640 FT /rpt_family="L1" FT repeat_region 341641..341932 FT /rpt_family="Alu" FT repeat_region 341933..342186 FT /rpt_family="L1" FT repeat_region 342221..342533 FT /rpt_family="Alu" FT repeat_region 342536..342941 FT /rpt_family="L1" FT repeat_region 342744..342866 FT /rpt_family="T-rich" FT repeat_region 342942..343069 FT /rpt_family="Alu" FT repeat_region 343070..343332 FT /rpt_family="L1" FT repeat_region 343381..343972 FT /rpt_family="L1" FT repeat_region 344080..344349 FT /rpt_family="L1" FT repeat_region 344351..344525 FT /rpt_family="MaLR" FT repeat_region 344523..344546 FT /rpt_family="AT_rich" FT repeat_region 344526..344836 FT /rpt_family="Alu" FT repeat_region 344837..345025 FT /rpt_family="MaLR" FT repeat_region 345026..345311 FT /rpt_family="Alu" FT repeat_region 345351..345724 FT /rpt_family="ERV1" FT repeat_region 345730..345894 FT /rpt_family="ERV1" FT repeat_region 345895..346183 FT /rpt_family="Alu" FT repeat_region 346184..346354 FT /rpt_family="ERV1" FT repeat_region 346392..346483 FT /rpt_family="ERV1" FT repeat_region 346498..346833 FT /rpt_family="ERV1" FT repeat_region 346835..346879 FT /rpt_family="ERV1" FT repeat_region 346880..347176 FT /rpt_family="Alu" FT repeat_region 347177..347255 FT /rpt_family="ERV1" FT repeat_region 347238..347257 FT /rpt_family="(TTA)n" FT repeat_region 347256..347550 FT /rpt_family="Alu" FT repeat_region 347551..348028 FT /rpt_family="ERV1" FT repeat_region 348187..348320 FT /rpt_family="ERV1" FT repeat_region 348324..348805 FT /rpt_family="L1" FT repeat_region 348451..348484 FT /rpt_family="AT_rich" FT repeat_region 348814..348971 FT /rpt_family="L1" FT repeat_region 348972..349294 FT /rpt_family="Alu" FT repeat_region 348973..348995 FT /rpt_family="(TTTA)n" FT repeat_region 349295..349488 FT /rpt_family="L1" FT repeat_region 349489..349739 FT /rpt_family="MaLR" FT repeat_region 349740..350038 FT /rpt_family="Alu" FT repeat_region 350039..350103 FT /rpt_family="MaLR" FT repeat_region 350104..350399 FT /rpt_family="Alu" FT repeat_region 350400..350475 FT /rpt_family="MaLR" FT repeat_region 350476..350711 FT /rpt_family="L1" FT repeat_region 350750..351042 FT /rpt_family="Alu" FT repeat_region 351129..351226 FT /rpt_family="Alu" FT repeat_region 351227..351483 FT /rpt_family="L1" FT repeat_region 351479..351513 FT /rpt_family="(T)n" FT repeat_region 351484..351806 FT /rpt_family="Alu" FT repeat_region 351807..351969 FT /rpt_family="L1" FT repeat_region 351970..351992 FT /rpt_family="(T)n" FT repeat_region 352275..352353 FT /rpt_family="L1" FT repeat_region 352354..352660 FT /rpt_family="Alu" FT repeat_region 352661..353319 FT /rpt_family="L1" FT repeat_region 353344..354040 FT /rpt_family="L1" FT misc_feature 353988..354501 FT /note="similar to EST AW590651 (NID:g7277789) hg47c02.x1" FT repeat_region 354590..354611 FT /rpt_family="AT_rich" FT repeat_region 354859..355174 FT /rpt_family="L1" FT repeat_region 357266..357560 FT /rpt_family="Alu" FT repeat_region 358398..359257 FT /rpt_family="L1" FT repeat_region 359264..360094 FT /rpt_family="L1" FT repeat_region 360095..360389 FT /rpt_family="Alu" FT repeat_region 360390..360458 FT /rpt_family="L1" FT repeat_region 360457..360481 FT /rpt_family="AT_rich" FT repeat_region 360460..360755 FT /rpt_family="Alu" FT repeat_region 360765..360950 FT /rpt_family="L1" FT repeat_region 360951..360971 FT /rpt_family="AT_rich" FT repeat_region 361309..361580 FT /rpt_family="Alu" FT repeat_region 361630..361705 FT /rpt_family="L1" FT repeat_region 361712..362033 FT /rpt_family="L1" FT repeat_region 362034..362329 FT /rpt_family="Alu" FT repeat_region 362330..362466 FT /rpt_family="L1" FT repeat_region 362347..362375 FT /rpt_family="AT_rich" FT repeat_region 362471..362760 FT /rpt_family="L1" FT repeat_region 362765..362956 FT /rpt_family="L1" FT repeat_region 362948..362978 FT /rpt_family="(CA)n" FT repeat_region 363157..363506 FT /rpt_family="L1" FT repeat_region 363527..363554 FT /rpt_family="(TA)n" FT repeat_region 363554..363852 FT /rpt_family="Alu" FT repeat_region 364052..364523 FT /rpt_family="L1" FT repeat_region 364524..364819 FT /rpt_family="Alu" FT repeat_region 364820..364863 FT /rpt_family="L1" FT repeat_region 364856..364953 FT /rpt_family="T-rich" FT gene 366453..369039 FT /gene="ZNF141" FT mRNA 366453..369039 FT /gene="ZNF141" FT CDS <366453..367651 FT /codon_start=3 FT /gene="ZNF141" FT /product="unknown" FT /note="Homo sapiens zinc finger protein 141 (clone pHZ-44) FT (ZNF141), mRNA.; H_NH0002H03.1 This gene was based on FT gi(4507992) Continued from H_NH0478C06.1" FT /protein_id="AAY41036.1" FT /translation="MCSHFTQDHWPVQGIEDSFHKLILRRYEKCGHDNLQLRKGCKSLN FT ECKLQKGGYNEFNECLSTTQSKILQCKASVKVVSKFSNSNKRKTRHTGEKHFKECGKSF FT QKFSHLTQHKVIHAGEKPYTCEECGKAFKWSLIFNEHKRIHTGEKPFTCEECGSIFTTS FT SHFAKHKIIHTGEKPYKCEECGKAFNRFTTLTKHKRIHAGEKPITCEECRKIFTSSSNF FT AKHKRIHTGEKPYKCEECGKAFNRSTTLTKHKRIHTGEKPYTCEECGKAFRQSSKLNEH FT KKVHTGERPYKCDECGKAFGRSRVLNEHKKIHTGEKPYKCEECGKAFRRSTDRSQHKKI FT HSADKPYKCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIHT" FT misc_feature 379900..380714 FT /note="CpG_island (%GC=63.6, o/e=0.73, #CpGs=56)" FT misc_feature 401050..401335 FT /note="CpG_island (%GC=61.9, o/e=0.82, #CpGs=23)" FT gene complement(419224..467918) FT /gene="FLJ14297" FT mRNA complement(join(419224..420762,466364..466490, FT 467770..467918)) FT /gene="FLJ14297" FT CDS complement(420282..420752) FT /codon_start=1 FT /gene="FLJ14297" FT /product="unknown" FT /note="Homo sapiens hypothetical protein FLJ14297 FT (FLJ14297), mRNA.; H_NH0002H03.2 This gene was based on FT gi(13435146)" FT /protein_id="AAY41037.1" FT /translation="MKYGNEIMNKDPVFRISPRSRGTHTNPEEPEEDVQAERVQAANAL FT TTPNLEEEPVITASCLHKEYYETKKVAFQQQRRKQPSEMFRFVLKSEVLGLLGHNGAGK FT STSIKMITGCTVPTAGVVVLQGNRASVRQQRDNSLKFLGTALRRTHCVPNLQ" FT misc_feature 467472..467839 FT /note="CpG_island (%GC=67.1, o/e=0.75, #CpGs=33)" FT misc_feature 490526..490793 FT /note="CpG_island (%GC=60.8, o/e=0.84, #CpGs=21)" FT misc_feature 491543..491778 FT /note="CpG_island (%GC=63.6, o/e=0.78, #CpGs=21)" FT misc_feature 492574..493379 FT /note="CpG_island (%GC=64.1, o/e=1.05, #CpGs=87)" FT gene 502721..502759 FT /gene="FLJ20265" FT mRNA 502721..502759 FT /gene="FLJ20265" FT /product="unknown" FT /note="Homo sapiens hypothetical protein FLJ20265, mRNA FT (cDNA clone MGC:4971 IMAGE:3460537), complete cds.; FT H_NH0002H03.3 This gene was based on gi(12654812) Continues FT as H_NH1263C18.1" FT repeat_region 507584..507833 FT /rpt_family="L1" FT repeat_region 507870..508231 FT /rpt_family="L1" FT repeat_region 508267..508406 FT /rpt_family="L1" FT repeat_region 510189..510364 FT /rpt_family="L2" FT repeat_region 510365..510670 FT /rpt_family="Alu" FT repeat_region 510671..510694 FT /rpt_family="L2" FT repeat_region 510816..511268 FT /rpt_family="L2" FT repeat_region 511289..511465 FT /rpt_family="L2" FT repeat_region 512101..512399 FT /rpt_family="Alu" FT repeat_region 512747..513146 FT /rpt_family="L2" FT repeat_region 513239..513417 FT /rpt_family="MIR" FT repeat_region 515119..515147 FT /rpt_family="AT_rich" FT repeat_region 518089..518466 FT /rpt_family="MaLR" FT repeat_region 518467..518746 FT /rpt_family="Alu" FT repeat_region 518747..518801 FT /rpt_family="MaLR" FT repeat_region 519756..519802 FT /rpt_family="L2" FT repeat_region 519844..519977 FT /rpt_family="MER2_type" FT repeat_region 520507..520632 FT /rpt_family="Alu" FT repeat_region 521282..521303 FT /rpt_family="AT_rich" FT repeat_region 523375..523395 FT /rpt_family="AT_rich" FT repeat_region 523466..523690 FT /rpt_family="MIR" FT repeat_region 525632..525737 FT /rpt_family="MIR" FT repeat_region 525975..526064 FT /rpt_family="MIR" FT repeat_region 528817..528904 FT /rpt_family="L2" FT repeat_region 528995..529044 FT /rpt_family="MIR" FT repeat_region 532240..532395 FT /rpt_family="MER1_type" FT repeat_region 532476..532583 FT /rpt_family="MER1_type" FT repeat_region 532630..532740 FT /rpt_family="L2" FT repeat_region 533511..533700 FT /rpt_family="MER1_type" FT repeat_region 533701..533970 FT /rpt_family="Alu" FT repeat_region 533971..534103 FT /rpt_family="MER1_type" FT repeat_region 534104..534398 FT /rpt_family="Alu" FT repeat_region 534399..534571 FT /rpt_family="MER1_type" FT repeat_region 534573..534796 FT /rpt_family="L1" FT repeat_region 534800..535044 FT /rpt_family="MER1_type" FT repeat_region 535054..535359 FT /rpt_family="Alu" FT repeat_region 535411..535849 FT /rpt_family="L1" FT repeat_region 535738..535960 FT /rpt_family="L1" FT repeat_region 540306..540475 FT /rpt_family="MIR" FT repeat_region 540497..540792 FT /rpt_family="Alu" FT repeat_region 541276..541572 FT /rpt_family="Alu" FT repeat_region 541614..541652 FT /rpt_family="(CA)n" FT repeat_region 541655..541785 FT /rpt_family="L1" FT repeat_region 541793..542175 FT /rpt_family="L1" FT repeat_region 542367..542668 FT /rpt_family="Alu" FT repeat_region 543473..543628 FT /rpt_family="L1" FT misc_feature 544160..545072 FT /note="CpG_island (%GC=67.3, o/e=0.70, #CpGs=66)" FT repeat_region 545220..545258 FT /rpt_family="(GGGAGA)n" FT repeat_region 545259..545281 FT /rpt_family="L1" FT repeat_region 545282..545637 FT /rpt_family="MER2_type" FT repeat_region 545638..547425 FT /rpt_family="L1" FT repeat_region 547461..547646 FT /rpt_family="L1" FT repeat_region 547631..547880 FT /rpt_family="L1" FT repeat_region 547891..548080 FT /rpt_family="ERVL" FT repeat_region 548338..548804 FT /rpt_family="ERVL" FT repeat_region 548805..548969 FT /rpt_family="(CA)n" FT unsure 548856..549422 FT /note="Unresolved tandem repeat." FT repeat_region 548987..549178 FT /rpt_family="(CCCA)n" FT repeat_region 549129..549291 FT /rpt_family="C-rich" FT repeat_region 549339..549454 FT /rpt_family="(CCCA)n" FT repeat_region 550578..550722 FT /rpt_family="L1" FT repeat_region 550724..551014 FT /rpt_family="Alu" FT repeat_region 551019..551412 FT /rpt_family="ERVL" FT repeat_region 551495..551623 FT /rpt_family="L1" FT repeat_region 551687..551795 FT /rpt_family="L1" FT repeat_region 551808..552106 FT /rpt_family="Alu" FT repeat_region 552411..552707 FT /rpt_family="Alu" FT repeat_region 552722..553039 FT /rpt_family="L1" FT repeat_region 553176..553220 FT /rpt_family="AT_rich" FT repeat_region 553428..553530 FT /rpt_family="ERV1" FT repeat_region 553663..553868 FT /rpt_family="(CCCCAG)n" FT repeat_region 555521..555903 FT /rpt_family="MaLR" FT unsure 559408..559673 FT /note="Sequence derived from one plasmid subclone." FT repeat_region 560457..560641 FT /rpt_family="(CACCC)n" FT repeat_region 562493..562783 FT /rpt_family="Alu" FT repeat_region 564149..564312 FT /rpt_family="(TG)n" FT repeat_region 564243..564419 FT /rpt_family="(CATG)n" FT repeat_region 564922..565278 FT /rpt_family="Alu" FT repeat_region 567863..567891 FT /rpt_family="(A)n" FT misc_feature 568514..571768 FT /note="CpG_island (%GC=73.9, o/e=0.90, #CpGs=368)" FT repeat_region 568969..569015 FT /rpt_family="(CCG)n" FT repeat_region 569024..569114 FT /rpt_family="GC_rich" FT repeat_region 569281..569353 FT /rpt_family="(CCGGG)n" FT repeat_region 569509..569582 FT /rpt_family="GC_rich" FT repeat_region 569886..569915 FT /rpt_family="(CCG)n" FT repeat_region 569926..569954 FT /rpt_family="GC_rich" FT repeat_region 569988..570052 FT /rpt_family="(CCG)n" FT repeat_region 570101..570207 FT /rpt_family="(CCCCG)n" FT repeat_region 570516..570780 FT /rpt_family="G-rich" FT repeat_region 570879..570950 FT /rpt_family="(TG)n" FT repeat_region 574205..574495 FT /rpt_family="Alu" FT repeat_region 574733..575335 FT /rpt_family="L1" FT repeat_region 575346..576617 FT /rpt_family="L1" FT repeat_region 576618..576922 FT /rpt_family="Alu" FT repeat_region 576923..577375 FT /rpt_family="L1" FT repeat_region 577376..577508 FT /rpt_family="Alu" FT repeat_region 577509..578674 FT /rpt_family="L1" FT repeat_region 578675..578971 FT /rpt_family="Alu" FT repeat_region 578972..579039 FT /rpt_family="L1" FT repeat_region 579040..579344 FT /rpt_family="Alu" FT repeat_region 579345..580213 FT /rpt_family="L1" FT repeat_region 580226..580549 FT /rpt_family="Alu" FT repeat_region 580561..580854 FT /rpt_family="Alu" FT repeat_region 580891..581062 FT /rpt_family="L1" FT repeat_region 581092..581222 FT /rpt_family="L1" FT repeat_region 581304..581393 FT /rpt_family="T-rich" FT repeat_region 582807..583357 FT /rpt_family="ERVL" FT repeat_region 583786..583865 FT /rpt_family="MaLR" FT repeat_region 583866..584176 FT /rpt_family="Alu" FT repeat_region 584177..584388 FT /rpt_family="MaLR" FT repeat_region 584429..584457 FT /rpt_family="MaLR" FT repeat_region 584474..585118 FT /rpt_family="AcHobo" FT repeat_region 585225..585520 FT /rpt_family="Alu" FT repeat_region 585612..585912 FT /rpt_family="Alu" FT repeat_region 585984..586020 FT /rpt_family="AT_rich" FT repeat_region 586100..586746 FT /rpt_family="SVA" FT repeat_region 586762..586869 FT /rpt_family="L2" FT repeat_region 587018..587087 FT /rpt_family="L2" FT repeat_region 587088..587212 FT /rpt_family="CT-rich" FT repeat_region 587740..588043 FT /rpt_family="Alu" FT repeat_region 591452..591642 FT /rpt_family="Alu" FT repeat_region 591645..593208 FT /rpt_family="L1" FT repeat_region 593209..593502 FT /rpt_family="Alu" FT repeat_region 593503..594538 FT /rpt_family="L1" FT repeat_region 594555..595089 FT /rpt_family="L2" FT repeat_region 595110..595404 FT /rpt_family="L2" FT repeat_region 596824..597133 FT /rpt_family="MaLR" FT repeat_region 597142..597161 FT /rpt_family="(TTTA)n" FT repeat_region 597164..597448 FT /rpt_family="Alu" FT repeat_region 597449..597492 FT /rpt_family="Alu" FT repeat_region 597493..597602 FT /rpt_family="MaLR" FT repeat_region 597603..597644 FT /rpt_family="L1" FT repeat_region 597653..598050 FT /rpt_family="L1" FT repeat_region 598081..598408 FT /rpt_family="MER2_type" FT repeat_region 598450..598744 FT /rpt_family="Alu" FT repeat_region 598813..599118 FT /rpt_family="Alu" FT repeat_region 599119..599793 FT /rpt_family="MER2_type" FT repeat_region 599808..600056 FT /rpt_family="MER1_type" FT repeat_region 600063..600659 FT /rpt_family="MER2_type" FT repeat_region 600660..600941 FT /rpt_family="Alu" FT repeat_region 600942..601107 FT /rpt_family="MER2_type" FT repeat_region 601108..601395 FT /rpt_family="Alu" FT repeat_region 601396..601704 FT /rpt_family="MER2_type" FT repeat_region 601705..602000 FT /rpt_family="Alu" FT repeat_region 602373..602916 FT /rpt_family="L1" FT repeat_region 603039..603163 FT /rpt_family="Alu" FT repeat_region 604134..604646 FT /rpt_family="MaLR" FT repeat_region 604648..604823 FT /rpt_family="ERVL" FT repeat_region 604840..604987 FT /rpt_family="ERVL" FT repeat_region 605450..605626 FT /rpt_family="Alu" FT repeat_region 607230..607590 FT /rpt_family="MaLR" FT repeat_region 607605..607953 FT /rpt_family="L1" FT repeat_region 607954..607983 FT /rpt_family="(TTTTG)n" FT repeat_region 607985..608270 FT /rpt_family="Alu" FT repeat_region 608271..609062 FT /rpt_family="L1" FT repeat_region 609063..609440 FT /rpt_family="MaLR" FT repeat_region 609441..609623 FT /rpt_family="L1" FT repeat_region 609624..609648 FT /rpt_family="(TTTTG)n" FT repeat_region 609649..610719 FT /rpt_family="L1" FT repeat_region 610904..611227 FT /rpt_family="L1" FT repeat_region 611273..611505 FT /rpt_family="ERVL" FT repeat_region 611506..611920 FT /rpt_family="ERVL" FT repeat_region 612046..612429 FT /rpt_family="MaLR" FT repeat_region 612566..612865 FT /rpt_family="Alu" FT repeat_region 612868..613135 FT /rpt_family="Alu" FT repeat_region 613136..613189 FT /rpt_family="Alu" FT repeat_region 613335..613645 FT /rpt_family="Alu" FT repeat_region 613848..613930 FT /rpt_family="Tip100" FT repeat_region 614435..614502 FT /rpt_family="Tip100" FT repeat_region 615066..615121 FT /rpt_family="L2" FT repeat_region 617022..617185 FT /rpt_family="ERVL" FT repeat_region 618245..618343 FT /rpt_family="(CACG)n" FT repeat_region 620922..621234 FT /rpt_family="Alu" FT repeat_region 621437..621533 FT /rpt_family="CT-rich" FT repeat_region 627768..627797 FT /rpt_family="G-rich" FT repeat_region 628652..628813 FT /rpt_family="(CCTG)n" FT repeat_region 628843..628947 FT /rpt_family="(CCTG)n" FT repeat_region 628977..629151 FT /rpt_family="(CCTG)n" FT repeat_region 629223..629377 FT /rpt_family="(CCTG)n" FT repeat_region 630762..631009 FT /rpt_family="L1" FT repeat_region 631010..631309 FT /rpt_family="Alu" FT repeat_region 631310..631827 FT /rpt_family="L1" FT repeat_region 631854..632099 FT /rpt_family="L1" FT repeat_region 632100..632411 FT /rpt_family="Alu" FT repeat_region 632412..632457 FT /rpt_family="L1" FT repeat_region 632459..632917 FT /rpt_family="ERVL" FT repeat_region 632918..633146 FT /rpt_family="Alu" FT repeat_region 633179..633477 FT /rpt_family="ERVL" FT repeat_region 633478..633802 FT /rpt_family="Alu" FT repeat_region 633815..633937 FT /rpt_family="Alu" FT repeat_region 633945..634046 FT /rpt_family="L1" FT repeat_region 634047..634340 FT /rpt_family="Alu" FT repeat_region 634341..635426 FT /rpt_family="L1" FT repeat_region 635427..635735 FT /rpt_family="Alu" FT repeat_region 635736..635978 FT /rpt_family="L1" FT repeat_region 635979..636294 FT /rpt_family="Alu" FT repeat_region 636295..636306 FT /rpt_family="L1" FT repeat_region 636307..636478 FT /rpt_family="Alu" FT repeat_region 636479..636542 FT /rpt_family="Alu" FT repeat_region 636543..636816 FT /rpt_family="L1" FT repeat_region 636817..637118 FT /rpt_family="Alu" FT repeat_region 637119..637705 FT /rpt_family="L1" FT repeat_region 637706..638001 FT /rpt_family="Alu" FT repeat_region 638002..638308 FT /rpt_family="L1" FT repeat_region 638309..638618 FT /rpt_family="Alu" FT repeat_region 638619..639079 FT /rpt_family="L1" FT repeat_region 639080..639383 FT /rpt_family="Alu" FT repeat_region 639384..640373 FT /rpt_family="L1" FT repeat_region 640553..640646 FT /rpt_family="L1" FT repeat_region 640647..640946 FT /rpt_family="Alu" FT repeat_region 640947..641231 FT /rpt_family="L1" FT repeat_region 641233..641535 FT /rpt_family="MaLR" FT repeat_region 641580..641885 FT /rpt_family="Alu" FT repeat_region 642967..643113 FT /rpt_family="AcHobo" FT repeat_region 644048..644130 FT /rpt_family="MER1_type" FT repeat_region 644881..645053 FT /rpt_family="(CGG)n" FT repeat_region 646128..646264 FT /rpt_family="L1" FT repeat_region 646416..646621 FT /rpt_family="MER2_type" FT repeat_region 646622..646769 FT /rpt_family="L1" FT repeat_region 648496..648558 FT /rpt_family="(TG)n" FT repeat_region 650187..650262 FT /rpt_family="Alu" FT misc_feature 650279..651114 FT /note="CpG_island (%GC=65.9, o/e=0.70, #CpGs=57)" FT repeat_region 653236..653400 FT /rpt_family="(TG)n" FT repeat_region 653455..653525 FT /rpt_family="(TG)n" FT repeat_region 653787..653962 FT /rpt_family="(TG)n" FT repeat_region 654606..654651 FT /rpt_family="(TGGA)n" FT repeat_region 654658..654692 FT /rpt_family="(GGAA)n" FT repeat_region 654729..654902 FT /rpt_family="(TGGA)n" FT repeat_region 654939..655002 FT /rpt_family="(TGGA)n" FT repeat_region 656527..656803 FT /rpt_family="Alu" FT misc_feature 656994..658162 FT /note="CpG_island (%GC=69.5, o/e=0.80, #CpGs=95)" FT repeat_region 658231..658346 FT /rpt_family="MIR" FT repeat_region 658349..658605 FT /rpt_family="Alu" FT repeat_region 662309..662475 FT /rpt_family="(CCCTA)n" FT repeat_region 662375..662535 FT /rpt_family="(CATGC)n" FT repeat_region 662498..662641 FT /rpt_family="(CCCTA)n" FT repeat_region 662667..662808 FT /rpt_family="(CCCTA)n" FT repeat_region 662834..662975 FT /rpt_family="(CCCTA)n" FT repeat_region 663095..663255 FT /rpt_family="(CCCTA)n" FT repeat_region 663260..663501 FT /rpt_family="(CACGC)n" FT repeat_region 663432..663594 FT /rpt_family="(CTATG)n" FT repeat_region 664023..664330 FT /rpt_family="Alu" FT repeat_region 665022..665311 FT /rpt_family="Alu" FT repeat_region 666383..666547 FT /rpt_family="Alu" FT repeat_region 666548..666836 FT /rpt_family="Alu" FT repeat_region 666837..666971 FT /rpt_family="Alu" FT misc_feature 667274..668726 FT /note="CpG_island (%GC=70.2, o/e=0.80, #CpGs=147)" FT repeat_region 667670..667692 FT /rpt_family="GC_rich" FT repeat_region 667799..667960 FT /rpt_family="G-rich" FT repeat_region 669454..669761 FT /rpt_family="MER1_type" FT repeat_region 671406..671449 FT /rpt_family="Tip100" FT repeat_region 671832..671944 FT /rpt_family="(CGTG)n" FT repeat_region 671958..671993 FT /rpt_family="(TG)n" FT repeat_region 673843..673931 FT /rpt_family="MER1_type" FT misc_feature 674844..676091 FT /note="CpG_island (%GC=74.7, o/e=0.80, #CpGs=126)" FT repeat_region 675387..675561 FT /rpt_family="(CCCCG)n" FT repeat_region 679058..679181 FT /rpt_family="(CA)n" FT repeat_region 679207..679494 FT /rpt_family="Alu" FT repeat_region 679900..679954 FT /rpt_family="L2" FT repeat_region 683011..683030 FT /rpt_family="(CCGGG)n" FT repeat_region 684600..684791 FT /rpt_family="L1" FT repeat_region 684794..685089 FT /rpt_family="Alu" FT repeat_region 685101..685413 FT /rpt_family="Alu" FT repeat_region 685414..685516 FT /rpt_family="ERV1" FT repeat_region 685518..685813 FT /rpt_family="Alu" FT repeat_region 685827..685930 FT /rpt_family="Tc2" FT repeat_region 686074..686384 FT /rpt_family="Alu" FT repeat_region 686482..686570 FT /rpt_family="Tc2" FT repeat_region 687446..687904 FT /rpt_family="ERV1" FT repeat_region 687906..688038 FT /rpt_family="Alu" FT repeat_region 688039..688088 FT /rpt_family="Alu" FT repeat_region 688089..688678 FT /rpt_family="ERV1" FT repeat_region 688679..688812 FT /rpt_family="Alu" FT repeat_region 688817..688839 FT /rpt_family="(TG)n" FT repeat_region 688921..688953 FT /rpt_family="(TG)n" FT repeat_region 688976..689079 FT /rpt_family="ERVL" FT repeat_region 689153..689454 FT /rpt_family="Alu" FT repeat_region 689607..689724 FT /rpt_family="Alu" FT repeat_region 689843..690144 FT /rpt_family="Alu" FT repeat_region 690146..690429 FT /rpt_family="Alu" FT repeat_region 690480..690529 FT /rpt_family="(TG)n" FT repeat_region 690646..690955 FT /rpt_family="Alu" FT repeat_region 690956..691232 FT /rpt_family="L1" FT repeat_region 691236..691479 FT /rpt_family="L1" FT repeat_region 691497..691780 FT /rpt_family="Alu" FT repeat_region 691970..692308 FT /rpt_family="Alu" FT repeat_region 692311..692349 FT /rpt_family="(CA)n" FT repeat_region 692965..693269 FT /rpt_family="Alu" FT repeat_region 693272..693553 FT /rpt_family="L1" FT repeat_region 693554..693595 FT /rpt_family="ERVL" FT repeat_region 693943..694186 FT /rpt_family="L1" FT repeat_region 694271..694494 FT /rpt_family="L1" FT repeat_region 694651..694917 FT /rpt_family="L1" FT repeat_region 695117..695136 FT /rpt_family="(TTTA)n" FT repeat_region 695139..695435 FT /rpt_family="Alu" FT repeat_region 695448..695480 FT /rpt_family="Alu" FT repeat_region 695481..695832 FT /rpt_family="Alu" FT repeat_region 695833..695936 FT /rpt_family="Alu" FT repeat_region 696172..696452 FT /rpt_family="L1" FT repeat_region 696579..696795 FT /rpt_family="L2" FT repeat_region 696854..697047 FT /rpt_family="L2" FT repeat_region 698746..699213 FT /rpt_family="(CCCTAA)n" FT misc_feature 699200..699951 FT /note="CpG_island (%GC=75.4, o/e=0.90, #CpGs=88)" FT repeat_region 699383..699537 FT /rpt_family="(CCCCG)n" FT repeat_region 702986..703155 FT /rpt_family="(TGAA)n" FT repeat_region 703198..703371 FT /rpt_family="(TGAA)n" FT repeat_region 703866..704283 FT /rpt_family="MaLR" FT repeat_region 705228..705545 FT /rpt_family="Alu" FT repeat_region 705594..705772 FT /rpt_family="Alu" FT repeat_region 706211..706534 FT /rpt_family="Alu" FT repeat_region 707403..707477 FT /rpt_family="L2" FT repeat_region 707780..708079 FT /rpt_family="MaLR" FT repeat_region 708560..708692 FT /rpt_family="MaLR" FT repeat_region 711184..711466 FT /rpt_family="Alu" FT repeat_region 712731..713041 FT /rpt_family="Alu" FT repeat_region 715462..715620 FT /rpt_family="(TGGG)n" FT repeat_region 718334..718604 FT /rpt_family="Alu" FT repeat_region 718605..718775 FT /rpt_family="Alu" FT repeat_region 719965..720063 FT /rpt_family="L1" FT repeat_region 720848..721012 FT /rpt_family="L1" FT repeat_region 721021..721328 FT /rpt_family="Alu" FT repeat_region 721340..721419 FT /rpt_family="L1" FT repeat_region 722062..722153 FT /rpt_family="MER2_type" FT repeat_region 722216..722398 FT /rpt_family="MER2_type" FT repeat_region 722401..722502 FT /rpt_family="L2" FT repeat_region 722534..722606 FT /rpt_family="MER1_type" FT repeat_region 722607..722918 FT /rpt_family="Alu" FT repeat_region 722922..723229 FT /rpt_family="Alu" FT repeat_region 723230..723347 FT /rpt_family="MER1_type" FT misc_feature 724336..726070 FT /note="CpG_island (%GC=69.9, o/e=0.80, #CpGs=128)" FT repeat_region 726079..726181 FT /rpt_family="(TTCCC)n" FT repeat_region 729054..729349 FT /rpt_family="Alu" FT repeat_region 729826..730136 FT /rpt_family="Alu" FT unsure 738471..741511 FT /note="Unresolved tandem repeat." FT unsure 819831..820553 FT /note="Unresolved tandem repeat." FT repeat_region 916797..917070 FT /rpt_family="L1" FT repeat_region 917175..917464 FT /rpt_family="Alu" FT repeat_region 917610..917631 FT /rpt_family="AT_rich" FT repeat_region 917667..917690 FT /rpt_family="L1" FT repeat_region 917691..917985 FT /rpt_family="Alu" FT repeat_region 917986..918320 FT /rpt_family="L1" FT repeat_region 918385..918520 FT /rpt_family="MaLR" FT repeat_region 918594..918668 FT /rpt_family="MaLR" FT repeat_region 918665..918738 FT /rpt_family="MaLR" FT repeat_region 918778..918873 FT /rpt_family="Alu" FT repeat_region 919350..919677 FT /rpt_family="MaLR" FT repeat_region 920170..920402 FT /rpt_family="MIR" FT repeat_region 920644..921087 FT /rpt_family="(CCCCG)n" FT repeat_region 921021..921192 FT /rpt_family="(CCGCT)n" FT repeat_region 921223..921404 FT /rpt_family="(CTCCG)n" FT repeat_region 921419..921589 FT /rpt_family="(CCGCT)n" FT repeat_region 921856..922145 FT /rpt_family="Alu" FT repeat_region 922172..922328 FT /rpt_family="Alu" FT repeat_region 922541..922849 FT /rpt_family="Alu" FT repeat_region 923361..923488 FT /rpt_family="Alu" FT repeat_region 923564..923879 FT /rpt_family="MER2_type" FT misc_feature 925581..926488 FT /note="CpG_island (%GC=71.7, o/e=1.00, #CpGs=114)" FT repeat_region 926984..927013 FT /rpt_family="MER1_type" FT repeat_region 927014..927290 FT /rpt_family="Alu" FT repeat_region 927291..927488 FT /rpt_family="MER1_type" FT repeat_region 927600..927669 FT /rpt_family="ERV1" FT repeat_region 927912..928847 FT /rpt_family="L2" FT repeat_region 929184..929857 FT /rpt_family="L1" FT repeat_region 929858..930113 FT /rpt_family="Alu" FT repeat_region 930114..930461 FT /rpt_family="L1" FT repeat_region 930462..930760 FT /rpt_family="Alu" FT repeat_region 930761..931069 FT /rpt_family="L1" FT repeat_region 931070..931364 FT /rpt_family="Alu" FT repeat_region 931365..932009 FT /rpt_family="L1" FT repeat_region 932010..932310 FT /rpt_family="Alu" FT repeat_region 932311..932803 FT /rpt_family="L1" FT repeat_region 932804..932901 FT /rpt_family="Alu" FT repeat_region 932902..933084 FT /rpt_family="L1" FT repeat_region 933087..933221 FT /rpt_family="Alu" FT repeat_region 933222..933522 FT /rpt_family="Alu" FT repeat_region 933528..933710 FT /rpt_family="L1" FT repeat_region 933743..933954 FT /rpt_family="L1" FT repeat_region 933955..934256 FT /rpt_family="Alu" FT repeat_region 934257..934513 FT /rpt_family="L1" FT repeat_region 934514..934837 FT /rpt_family="Alu" FT repeat_region 934838..934883 FT /rpt_family="L1" FT repeat_region 934884..935193 FT /rpt_family="Alu" FT repeat_region 935194..935221 FT /rpt_family="L1" FT repeat_region 935222..935523 FT /rpt_family="Alu" FT repeat_region 935524..935573 FT /rpt_family="L1" FT repeat_region 935576..935692 FT /rpt_family="Alu" FT repeat_region 935694..935842 FT /rpt_family="L1" FT repeat_region 935843..936152 FT /rpt_family="Alu" FT repeat_region 936153..936416 FT /rpt_family="L1" FT repeat_region 936420..936727 FT /rpt_family="Alu" FT repeat_region 936728..937033 FT /rpt_family="L1" FT repeat_region 937034..937339 FT /rpt_family="Alu" FT repeat_region 937340..937798 FT /rpt_family="L1" FT repeat_region 937799..938088 FT /rpt_family="Alu" FT repeat_region 938089..938242 FT /rpt_family="L1" FT repeat_region 938282..938544 FT /rpt_family="L1" FT repeat_region 938607..938909 FT /rpt_family="Alu" FT repeat_region 943662..943777 FT /rpt_family="MaLR" FT repeat_region 944610..944772 FT /rpt_family="(GTGTG)n" FT repeat_region 946263..946306 FT /rpt_family="(TG)n" FT repeat_region 946352..946380 FT /rpt_family="(TG)n" FT repeat_region 946417..946447 FT /rpt_family="(TG)n" FT repeat_region 946486..946508 FT /rpt_family="(TG)n" FT repeat_region 946545..946589 FT /rpt_family="(TG)n" FT repeat_region 947466..947766 FT /rpt_family="Alu" FT repeat_region 947771..948074 FT /rpt_family="Alu" FT repeat_region 948368..948759 FT /rpt_family="L1" FT repeat_region 948783..949023 FT /rpt_family="Alu" FT repeat_region 950002..950058 FT /rpt_family="(CCCCAG)n" FT repeat_region 950232..950531 FT /rpt_family="Alu" FT repeat_region 958709..958827 FT /rpt_family="MIR" FT misc_feature 961348..962155 FT /note="CpG_island (%GC=72.6, o/e=0.80, #CpGs=82)" FT repeat_region 963401..963698 FT /rpt_family="Alu" FT repeat_region 964304..964413 FT /rpt_family="L1" FT misc_feature 966733..968137 FT /note="CpG_island (%GC=77.0, o/e=0.80, #CpGs=177)" FT repeat_region 967092..967268 FT /rpt_family="GC_rich" FT repeat_region 967377..967442 FT /rpt_family="(CGGGG)n" FT repeat_region 969113..969145 FT /rpt_family="(TCTCCC)n" FT repeat_region 969152..970330 FT /rpt_family="SVA" FT misc_feature 969277..970140 FT /note="CpG_island (%GC=67.4, o/e=0.70, #CpGs=59)" FT repeat_region 970473..970615 FT /rpt_family="MaLR" FT repeat_region 970660..971005 FT /rpt_family="MaLR" FT repeat_region 971002..971120 FT /rpt_family="MER2_type" FT repeat_region 971483..971776 FT /rpt_family="Alu" FT repeat_region 971809..972051 FT /rpt_family="Alu" FT repeat_region 972054..972091 FT /rpt_family="Tip100" FT repeat_region 972092..972392 FT /rpt_family="Alu" FT repeat_region 972393..972703 FT /rpt_family="Alu" FT repeat_region 972704..973253 FT /rpt_family="Tip100" FT repeat_region 973686..973804 FT /rpt_family="ERVL" FT repeat_region 974030..974091 FT /rpt_family="ERVL" FT repeat_region 974092..974392 FT /rpt_family="Alu" FT repeat_region 974548..974624 FT /rpt_family="MER1_type" FT repeat_region 974696..974960 FT /rpt_family="ERVL" FT repeat_region 975038..975102 FT /rpt_family="ERVL" FT repeat_region 975118..975259 FT /rpt_family="Alu" FT repeat_region 975260..975279 FT /rpt_family="(CAAT)n" FT repeat_region 975280..975434 FT /rpt_family="Alu" FT repeat_region 975438..975604 FT /rpt_family="ERVL" FT repeat_region 975605..975906 FT /rpt_family="Alu" FT repeat_region 975907..976543 FT /rpt_family="ERVL" FT repeat_region 976629..976800 FT /rpt_family="MaLR" FT repeat_region 976997..977535 FT /rpt_family="ERV1" FT repeat_region 977614..977912 FT /rpt_family="Alu" FT repeat_region 977946..978024 FT /rpt_family="L1" FT repeat_region 978047..978342 FT /rpt_family="L1" FT repeat_region 978343..978620 FT /rpt_family="Alu" FT repeat_region 978621..978748 FT /rpt_family="L1" FT repeat_region 979278..979401 FT /rpt_family="L1" FT repeat_region 979702..980009 FT /rpt_family="Alu" FT repeat_region 980084..980384 FT /rpt_family="MER2_type" FT repeat_region 980433..980574 FT /rpt_family="Alu" FT repeat_region 980765..980785 FT /rpt_family="GC_rich" FT repeat_region 980926..980960 FT /rpt_family="GC_rich" FT repeat_region 987839..987878 FT /rpt_family="MIR" FT repeat_region 987946..988056 FT /rpt_family="Alu" FT repeat_region 988064..988230 FT /rpt_family="Alu" FT repeat_region 988231..988524 FT /rpt_family="Alu" FT repeat_region 988554..988722 FT /rpt_family="Alu" FT repeat_region 988735..988832 FT /rpt_family="Alu" FT repeat_region 988833..989130 FT /rpt_family="Alu" FT repeat_region 989131..989157 FT /rpt_family="Alu" FT repeat_region 991074..991233 FT /rpt_family="C-rich" FT repeat_region 992516..992751 FT /rpt_family="L2" FT repeat_region 992752..993019 FT /rpt_family="Alu" FT repeat_region 993020..993319 FT /rpt_family="L2" FT misc_feature 995483..997541 FT /note="CpG_island (%GC=74.8, o/e=0.80, #CpGs=226)" FT repeat_region 996949..997059 FT /rpt_family="(CGGGG)n" FT repeat_region 998276..998310 FT /rpt_family="AT_rich" FT repeat_region 999631..999916 FT /rpt_family="Alu" FT repeat_region 999917..1000210 FT /rpt_family="Alu" FT repeat_region 1000211..1000399 FT /rpt_family="L1" FT repeat_region 1000400..1000646 FT /rpt_family="Alu" FT repeat_region 1000647..1000808 FT /rpt_family="L1" FT repeat_region 1000824..1000972 FT /rpt_family="L1" FT repeat_region 1000973..1001261 FT /rpt_family="Alu" FT repeat_region 1001262..1001384 FT /rpt_family="L1" FT repeat_region 1001626..1001711 FT /rpt_family="L1" FT repeat_region 1001712..1001940 FT /rpt_family="Alu" FT repeat_region 1001941..1002150 FT /rpt_family="L1" FT repeat_region 1002151..1002438 FT /rpt_family="Alu" FT repeat_region 1002439..1002987 FT /rpt_family="L1" FT misc_feature 1003107..1006478 FT /note="CpG_island (%GC=75.8, o/e=0.90, #CpGs=392)" FT repeat_region 1003424..1003478 FT /rpt_family="(CGGGG)n" FT repeat_region 1003565..1003679 FT /rpt_family="C-rich" FT misc_feature 1005079..1005400 FT /note="Sequence derived from PCR product of project DNA." FT repeat_region 1005139..1005209 FT /rpt_family="G-rich" FT repeat_region 1005259..1005286 FT /rpt_family="GC_rich" FT repeat_region 1005442..1005623 FT /rpt_family="(CCCCG)n" FT repeat_region 1005627..1005768 FT /rpt_family="GC_rich" FT misc_feature 1005683..1005766 FT /note="Sequence derived from PCR product of project DNA." FT repeat_region 1005775..1005834 FT /rpt_family="G-rich" FT repeat_region 1005856..1005928 FT /rpt_family="GC_rich" FT repeat_region 1006289..1006321 FT /rpt_family="(CTG)n" FT repeat_region 1006330..1006350 FT /rpt_family="GC_rich" FT repeat_region 1006366..1006487 FT /rpt_family="(CCCCG)n" FT repeat_region 1011684..1011728 FT /rpt_family="L2" FT misc_feature 1014294..1014303 FT /note="Sequence derived from PCR product of project DNA." FT repeat_region 1014406..1015022 FT /rpt_family="G-rich" FT unsure 1014424..1015064 FT /note="Unresolved tandem repeat." FT misc_feature 1015894..1016743 FT /note="CpG_island (%GC=69.6, o/e=0.70, #CpGs=61)" FT repeat_region 1016804..1016851 FT /rpt_family="L1" FT misc_feature 1017525..1018938 FT /note="CpG_island (%GC=70.9, o/e=0.80, #CpGs=129)" FT repeat_region 1017911..1017985 FT /rpt_family="(CGGG)n" FT repeat_region 1019044..1019093 FT /rpt_family="(CA)n" FT repeat_region 1019287..1019310 FT /rpt_family="(CA)n" FT repeat_region 1019318..1019441 FT /rpt_family="(CACG)n" FT repeat_region 1019362..1019532 FT /rpt_family="(CA)n" FT repeat_region 1019655..1019842 FT /rpt_family="(CA)n" FT repeat_region 1019796..1019897 FT /rpt_family="(CACG)n" FT repeat_region 1020211..1020261 FT /rpt_family="C-rich" FT repeat_region 1027609..1027675 FT /rpt_family="MIR" FT repeat_region 1028542..1028842 FT /rpt_family="Alu" FT repeat_region 1029884..1029977 FT /rpt_family="C-rich" FT repeat_region 1032477..1032761 FT /rpt_family="Alu" FT repeat_region 1034273..1034345 FT /rpt_family="(TG)n" FT repeat_region 1035118..1035177 FT /rpt_family="(TG)n" FT repeat_region 1035221..1035247 FT /rpt_family="(CA)n" FT repeat_region 1036112..1036173 FT /rpt_family="(CA)n" FT repeat_region 1036209..1036387 FT /rpt_family="(CA)n" FT repeat_region 1036485..1036636 FT /rpt_family="(CA)n" FT repeat_region 1036650..1036709 FT /rpt_family="(CCCA)n" FT repeat_region 1036712..1036970 FT /rpt_family="(CA)n" FT repeat_region 1036990..1037158 FT /rpt_family="(CA)n" FT misc_feature 1039657..1041119 FT /note="CpG_island (%GC=69.2, o/e=0.80, #CpGs=100)" FT repeat_region 1039960..1040136 FT /rpt_family="C-rich" FT repeat_region 1040082..1040245 FT /rpt_family="(CCCTAG)n" FT repeat_region 1040371..1040517 FT /rpt_family="(CCCTAG)n" FT repeat_region 1042542..1042904 FT /rpt_family="MaLR" FT repeat_region 1043730..1043935 FT /rpt_family="Alu" FT repeat_region 1045442..1045489 FT /rpt_family="MaLR" FT repeat_region 1045512..1045864 FT /rpt_family="MaLR" FT repeat_region 1046462..1046584 FT /rpt_family="MER2_type" FT repeat_region 1046678..1046760 FT /rpt_family="MER2_type" FT repeat_region 1051246..1051458 FT /rpt_family="MER1_type" FT repeat_region 1051571..1051867 FT /rpt_family="Alu" FT repeat_region 1053167..1053304 FT /rpt_family="ERVL" FT repeat_region 1053416..1053512 FT /rpt_family="ERVL" FT repeat_region 1053601..1053912 FT /rpt_family="Alu" FT repeat_region 1054727..1054861 FT /rpt_family="L1" FT repeat_region 1054932..1055007 FT /rpt_family="L1" FT repeat_region 1055530..1055890 FT /rpt_family="L1" FT repeat_region 1055876..1057121 FT /rpt_family="L1" FT repeat_region 1057092..1057203 FT /rpt_family="L1" FT repeat_region 1057204..1057216 FT /rpt_family="Alu" FT repeat_region 1057217..1057512 FT /rpt_family="Alu" FT repeat_region 1057513..1057679 FT /rpt_family="Alu" FT repeat_region 1057685..1057859 FT /rpt_family="L1" FT repeat_region 1057863..1058200 FT /rpt_family="L1" FT repeat_region 1058203..1058368 FT /rpt_family="MaLR" FT repeat_region 1058441..1059097 FT /rpt_family="L1" FT repeat_region 1059260..1059539 FT /rpt_family="Alu" FT repeat_region 1059540..1059667 FT /rpt_family="Alu" FT repeat_region 1059670..1060009 FT /rpt_family="Alu" FT repeat_region 1060010..1060121 FT /rpt_family="L1" FT repeat_region 1060122..1060416 FT /rpt_family="Alu" FT repeat_region 1060417..1060863 FT /rpt_family="L1" FT repeat_region 1060882..1061022 FT /rpt_family="MaLR" FT repeat_region 1061023..1061324 FT /rpt_family="L1" FT repeat_region 1061307..1061370 FT /rpt_family="L1" FT repeat_region 1061371..1061677 FT /rpt_family="Alu" FT repeat_region 1061678..1062055 FT /rpt_family="L1" FT repeat_region 1062074..1062235 FT /rpt_family="L1" FT repeat_region 1062270..1062628 FT /rpt_family="L1" FT repeat_region 1062646..1062713 FT /rpt_family="L1" FT repeat_region 1062714..1063013 FT /rpt_family="Alu" FT repeat_region 1063014..1063317 FT /rpt_family="L1" FT repeat_region 1063388..1063725 FT /rpt_family="L1" FT repeat_region 1064532..1064728 FT /rpt_family="L1" FT repeat_region 1064733..1065111 FT /rpt_family="L1" FT repeat_region 1065195..1066371 FT /rpt_family="L1" FT repeat_region 1067551..1067744 FT /rpt_family="L2" FT repeat_region 1068626..1068816 FT /rpt_family="L2" FT repeat_region 1068993..1069056 FT /rpt_family="ERV1" FT repeat_region 1069057..1069444 FT /rpt_family="MaLR" FT repeat_region 1069445..1069471 FT /rpt_family="ERV1" FT repeat_region 1069472..1069749 FT /rpt_family="Alu" FT repeat_region 1069750..1069829 FT /rpt_family="ERV1" FT repeat_region 1070553..1070754 FT /rpt_family="MER1_type" FT repeat_region 1070758..1071060 FT /rpt_family="Alu" FT repeat_region 1071178..1071307 FT /rpt_family="Alu" FT repeat_region 1071872..1071939 FT /rpt_family="MIR" FT repeat_region 1073996..1074092 FT /rpt_family="MaLR" FT repeat_region 1074093..1074945 FT /rpt_family="ERVL" FT repeat_region 1074946..1075020 FT /rpt_family="MaLR" FT repeat_region 1075758..1075927 FT /rpt_family="Alu" FT repeat_region 1075931..1075966 FT /rpt_family="(GGAAA)n" FT repeat_region 1076400..1076592 FT /rpt_family="L2" FT repeat_region 1077149..1077463 FT /rpt_family="Alu" FT repeat_region 1077598..1077724 FT /rpt_family="L1" FT repeat_region 1077734..1078038 FT /rpt_family="Alu" FT repeat_region 1078089..1078167 FT /rpt_family="MER1_type" FT repeat_region 1078236..1078538 FT /rpt_family="Alu" FT repeat_region 1080351..1081074 FT /rpt_family="G-rich" FT repeat_region 1081097..1081281 FT /rpt_family="G-rich" FT repeat_region 1081441..1081794 FT /rpt_family="MaLR" FT repeat_region 1081799..1083402 FT /rpt_family="MaLR" FT repeat_region 1083403..1083761 FT /rpt_family="MaLR" FT repeat_region 1083766..1083844 FT /rpt_family="(CGGGA)n" FT repeat_region 1083792..1083966 FT /rpt_family="(GGATG)n" FT repeat_region 1086974..1087159 FT /rpt_family="MER1_type" FT repeat_region 1088657..1088839 FT /rpt_family="L1" FT repeat_region 1091111..1091377 FT /rpt_family="Alu" FT repeat_region 1091584..1091873 FT /rpt_family="Alu" FT repeat_region 1092390..1092621 FT /rpt_family="MIR" FT repeat_region 1092959..1093224 FT /rpt_family="L1" FT misc_feature 1106690..1107728 FT /note="CpG_island (%GC=73.9, o/e=0.79, #CpGs=97)" FT misc_feature 1137999..1139821 FT /note="CpG_island (%GC=55.2, o/e=1.24, #CpGs=131)" FT gene complement(1160723..1166597) FT /gene="SPON2" FT mRNA complement(join(1160723..1161444,1164190..1164364, FT 1164787..1164978,1165051..1165274,1165640..1165862, FT 1166332..1166597)) FT /gene="SPON2" FT misc_feature 1161128..1161682 FT /note="CpG_island (%GC=65.8, o/e=0.81, #CpGs=47)" FT CDS complement(join(1161260..1161444,1164190..1164364, FT 1164787..1164978,1165051..1165274,1165640..1165859)) FT /codon_start=1 FT /gene="SPON2" FT /product="unknown" FT /note="Homo sapiens spondin 2, extracellular matrix protein FT (SPON2), mRNA.; H_NH0020I20.1 This gene was based on FT gi(6912681)" FT /protein_id="AAY40988.1" FT /translation="MENPSPAAALGKALCALLLATLGAAGQPLGGESICSARALAKYSI FT TFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAW FT ALMKEIEAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFV FT GVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPA FT NSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVS FT LWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV" FT misc_feature 1164516..1166582 FT /note="CpG_island (%GC=71.2, o/e=0.77, #CpGs=202)" FT misc_feature 1188186..1189162 FT /note="CpG_island (%GC=73.2, o/e=0.66, #CpGs=84)" FT misc_feature 1202435..1203200 FT /note="CpG_island (%GC=59.0, o/e=0.75, #CpGs=53)" FT gene complement(1205248..1242782) FT /gene="CTBP1" FT mRNA complement(join(1205248..1206211,1206701..1206818, FT 1207266..1207393,1208131..1208261,1209779..1209993, FT 1219148..1219354,1221987..1222131,1231971..1232125, FT 1242704..1242782)) FT /gene="CTBP1" FT misc_feature 1205818..1206203 FT /note="CpG_island (%GC=69.7, o/e=0.74, #CpGs=29)" FT CDS complement(join(1206028..1206211,1206701..1206818, FT 1207266..1207393,1208131..1208261,1209779..1209993, FT 1219148..1219354,1221987..1222131,1231971..1232125, FT 1242704..1242743)) FT /codon_start=1 FT /gene="CTBP1" FT /product="unknown" FT /note="Homo sapiens, Similar to C-terminal binding protein FT 1, clone MGC:12707 IMAGE:4128336, mRNA, complete cds.; FT H_NH0020I20.2 This gene was based on gi(15079677)" FT /protein_id="AAY40989.1" FT /translation="MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPIL FT KDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDN FT IDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIR FT EVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVST FT LQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKE FT GRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAIT FT GRIPDSLKNCVNKDHLTAATHWASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEG FT IVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL" FT misc_feature 1209766..1210193 FT /note="CpG_island (%GC=65.7, o/e=0.70, #CpGs=35)" FT misc_feature 1218944..1219718 FT /note="CpG_island (%GC=68.5, o/e=0.83, #CpGs=67)" FT misc_feature 1221838..1222050 FT /note="CpG_island (%GC=60.6, o/e=1.00, #CpGs=16)" FT misc_feature 1222292..1222497 FT /note="CpG_island (%GC=67.0, o/e=0.60, #CpGs=15)" FT misc_feature 1224452..1224728 FT /note="CpG_island (%GC=59.9, o/e=0.90, #CpGs=27)" FT misc_feature 1229250..1229535 FT /note="CpG_island (%GC=64.0, o/e=0.79, #CpGs=22)" FT misc_feature 1231814..1232229 FT /note="CpG_island (%GC=68.5, o/e=0.73, #CpGs=32)" FT misc_feature 1233873..1234420 FT /note="CpG_island (%GC=72.3, o/e=2.43, #CpGs=56)" FT misc_feature 1241413..1244111 FT /note="CpG_island (%GC=74.4, o/e=0.90, #CpGs=350)" FT gene 1244763..1246357 FT /gene="MGC21675" FT mRNA 1244763..1246357 FT /gene="MGC21675" FT CDS 1245182..1245457 FT /codon_start=1 FT /gene="MGC21675" FT /product="unknown" FT /note="Homo sapiens hypothetical protein MGC21675 FT (MGC21675), mRNA.; H_NH0020I20.3 This gene was based on FT gi(16418362)" FT /protein_id="AAY40990.1" FT /translation="MTTALQGQRLAVCVPAHPPPCAWACPVPAHRSGSWRLPYTDGLSW FT ELLDSHLGGNARGMGIRSPRPASVATWAIFVHRVGQPSIGGKLSPL" FT misc_feature 1272617..1273066 FT /note="CpG_island (%GC=69.3, o/e=1.06, #CpGs=36)" FT misc_feature 1276448..1276773 FT /note="CpG_island (%GC=54.6, o/e=1.92, #CpGs=23)" FT misc_feature 1283251..1283473 FT /note="CpG_island (%GC=74.4, o/e=0.83, #CpGs=24)" FT misc_feature 1283251..1284331 FT /note="CpG_island (%GC=71.1, o/e=0.80, #CpGs=118)" FT repeat_region 1283828..1283900 FT /rpt_family="GC_rich" FT repeat_region 1284632..1284841 FT /rpt_family="MIR" FT repeat_region 1284953..1285081 FT /rpt_family="Alu" FT repeat_region 1286326..1286489 FT /rpt_family="MER1_type" FT repeat_region 1286673..1286919 FT /rpt_family="Alu" FT repeat_region 1287030..1287197 FT /rpt_family="Alu" FT repeat_region 1287469..1287577 FT /rpt_family="CR1" FT repeat_region 1288579..1288630 FT /rpt_family="(CGGGGG)n" FT repeat_region 1289171..1289355 FT /rpt_family="L2" FT repeat_region 1289436..1289621 FT /rpt_family="C-rich" FT repeat_region 1289676..1289852 FT /rpt_family="(CCCTG)n" FT repeat_region 1289907..1290064 FT /rpt_family="C-rich" FT repeat_region 1290453..1291038 FT /rpt_family="L2" FT repeat_region 1291341..1291544 FT /rpt_family="L2" FT repeat_region 1291990..1292095 FT /rpt_family="L2" FT repeat_region 1292288..1292459 FT /rpt_family="L2" FT repeat_region 1292465..1292656 FT /rpt_family="L2" FT repeat_region 1292657..1292966 FT /rpt_family="Alu" FT repeat_region 1292967..1293530 FT /rpt_family="L2" FT repeat_region 1293544..1293730 FT /rpt_family="L2" FT repeat_region 1293761..1293783 FT /rpt_family="AT_rich" FT repeat_region 1294436..1295198 FT /rpt_family="MER1_type" FT repeat_region 1295335..1295520 FT /rpt_family="Alu" FT repeat_region 1295623..1296080 FT /rpt_family="L1" FT repeat_region 1296081..1296160 FT /rpt_family="MaLR" FT repeat_region 1296171..1296271 FT /rpt_family="L1" FT repeat_region 1296272..1296567 FT /rpt_family="Alu" FT repeat_region 1296568..1296894 FT /rpt_family="L1" FT repeat_region 1296895..1297202 FT /rpt_family="Alu" FT repeat_region 1297203..1297598 FT /rpt_family="L1" FT repeat_region 1297664..1297753 FT /rpt_family="(CAGGG)n" FT repeat_region 1297940..1298077 FT /rpt_family="MER1_type" FT repeat_region 1298078..1298221 FT /rpt_family="Alu" FT repeat_region 1298233..1298526 FT /rpt_family="Alu" FT repeat_region 1298535..1298679 FT /rpt_family="MER1_type" FT repeat_region 1298994..1299076 FT /rpt_family="MER1_type" FT repeat_region 1299166..1299351 FT /rpt_family="L1" FT repeat_region 1299505..1299563 FT /rpt_family="(CGTG)n" FT repeat_region 1299565..1300016 FT /rpt_family="ERVL" FT repeat_region 1300026..1300122 FT /rpt_family="L1" FT repeat_region 1300123..1300321 FT /rpt_family="Alu" FT repeat_region 1300346..1300879 FT /rpt_family="L1" FT repeat_region 1300916..1301317 FT /rpt_family="L1" FT repeat_region 1301329..1301783 FT /rpt_family="ERVL" FT repeat_region 1301795..1302126 FT /rpt_family="MER2_type" FT repeat_region 1302127..1302242 FT /rpt_family="L1" FT repeat_region 1302265..1302727 FT /rpt_family="L1" FT repeat_region 1302991..1303071 FT /rpt_family="L1" FT repeat_region 1306212..1306515 FT /rpt_family="Alu" FT repeat_region 1306957..1307235 FT /rpt_family="L1" FT repeat_region 1307236..1307519 FT /rpt_family="Alu" FT repeat_region 1307520..1307582 FT /rpt_family="L1" FT repeat_region 1307583..1307827 FT /rpt_family="Alu" FT repeat_region 1307834..1308123 FT /rpt_family="Alu" FT repeat_region 1308124..1308598 FT /rpt_family="L1" FT repeat_region 1308685..1308785 FT /rpt_family="MER1_type" FT repeat_region 1308793..1308978 FT /rpt_family="L1" FT repeat_region 1310698..1310873 FT /rpt_family="(CCCCAG)n" FT repeat_region 1310848..1311093 FT /rpt_family="C-rich" FT repeat_region 1312858..1313153 FT /rpt_family="Alu" FT repeat_region 1313415..1313540 FT /rpt_family="Alu" FT repeat_region 1313607..1314606 FT /rpt_family="L1" FT repeat_region 1314607..1314903 FT /rpt_family="Alu" FT repeat_region 1314904..1315330 FT /rpt_family="L1" FT repeat_region 1315650..1315679 FT /rpt_family="(T)n" FT repeat_region 1316732..1317032 FT /rpt_family="Alu" FT repeat_region 1324135..1324402 FT /rpt_family="Alu" FT repeat_region 1326221..1326509 FT /rpt_family="Alu" FT repeat_region 1326842..1327142 FT /rpt_family="Alu" FT repeat_region 1327453..1327723 FT /rpt_family="C-rich" FT repeat_region 1327771..1327962 FT /rpt_family="C-rich" FT repeat_region 1330409..1330496 FT /rpt_family="L2" FT repeat_region 1331495..1331661 FT /rpt_family="(TCTCTG)n" FT misc_feature 1332342..1333676 FT /note="CpG_island (%GC=57.2, o/e=0.90, #CpGs=95)" FT repeat_region 1332451..1332613 FT /rpt_family="(CGGGG)n" FT repeat_region 1334913..1335003 FT /rpt_family="L1" FT repeat_region 1335151..1335521 FT /rpt_family="L1" FT repeat_region 1335522..1335780 FT /rpt_family="Alu" FT repeat_region 1335781..1336133 FT /rpt_family="L1" FT repeat_region 1336246..1336874 FT /rpt_family="L1" FT repeat_region 1336875..1337243 FT /rpt_family="MaLR" FT repeat_region 1337244..1337320 FT /rpt_family="L1" FT repeat_region 1337349..1337586 FT /rpt_family="Alu" FT repeat_region 1337589..1337997 FT /rpt_family="L1" FT repeat_region 1338057..1338357 FT /rpt_family="Alu" FT repeat_region 1338408..1338740 FT /rpt_family="L2" FT repeat_region 1338792..1339131 FT /rpt_family="L2" FT repeat_region 1339153..1339462 FT /rpt_family="Alu" FT repeat_region 1339555..1339757 FT /rpt_family="L2" FT repeat_region 1339936..1340071 FT /rpt_family="L1" FT misc_feature 1340029..1341471 FT /note="CpG_island (%GC=75.1, o/e=0.90, #CpGs=178)" FT repeat_region 1340072..1340095 FT /rpt_family="GC_rich" FT repeat_region 1340434..1340482 FT /rpt_family="GC_rich" FT repeat_region 1340590..1340616 FT /rpt_family="GC_rich" FT repeat_region 1341131..1341160 FT /rpt_family="GC_rich" FT repeat_region 1342961..1343169 FT /rpt_family="MER1_type" FT repeat_region 1344438..1344571 FT /rpt_family="Alu" FT repeat_region 1344680..1344859 FT /rpt_family="Alu" FT repeat_region 1344860..1345151 FT /rpt_family="Alu" FT repeat_region 1345162..1345476 FT /rpt_family="Alu" FT repeat_region 1346458..1346728 FT /rpt_family="Alu" FT repeat_region 1354133..1354276 FT /rpt_family="MIR" FT repeat_region 1355640..1355664 FT /rpt_family="AT_rich" FT repeat_region 1358904..1359010 FT /rpt_family="ERV1" FT repeat_region 1359025..1359108 FT /rpt_family="ERV1" FT repeat_region 1362410..1362545 FT /rpt_family="MaLR" FT repeat_region 1364042..1364073 FT /rpt_family="(TG)n" FT repeat_region 1364434..1364521 FT /rpt_family="MER1_type" FT repeat_region 1365045..1365079 FT /rpt_family="(TG)n" FT repeat_region 1365279..1365621 FT /rpt_family="MaLR" FT repeat_region 1365867..1366023 FT /rpt_family="L1" FT repeat_region 1366790..1366975 FT /rpt_family="L1" FT repeat_region 1366977..1367328 FT /rpt_family="ERVL" FT repeat_region 1372059..1372347 FT /rpt_family="Alu" FT repeat_region 1375475..1375748 FT /rpt_family="Alu" FT repeat_region 1380206..1380298 FT /rpt_family="L1" FT repeat_region 1380292..1380380 FT /rpt_family="L1" FT repeat_region 1380388..1380502 FT /rpt_family="L1" FT repeat_region 1380503..1380806 FT /rpt_family="Alu" FT repeat_region 1380807..1380859 FT /rpt_family="L1" FT repeat_region 1380860..1381163 FT /rpt_family="Alu" FT repeat_region 1381164..1382992 FT /rpt_family="L1" FT repeat_region 1382993..1383150 FT /rpt_family="Alu" FT repeat_region 1383151..1383466 FT /rpt_family="Alu" FT repeat_region 1383467..1383612 FT /rpt_family="Alu" FT repeat_region 1383613..1384086 FT /rpt_family="L1" FT repeat_region 1384087..1384371 FT /rpt_family="Alu" FT repeat_region 1384372..1384569 FT /rpt_family="L1" FT repeat_region 1384592..1384653 FT /rpt_family="L1" FT repeat_region 1384670..1384731 FT /rpt_family="L1" FT repeat_region 1385105..1387195 FT /rpt_family="L1" FT repeat_region 1387196..1387344 FT /rpt_family="Alu" FT repeat_region 1387346..1387424 FT /rpt_family="(TAGA)n" FT repeat_region 1387430..1388060 FT /rpt_family="L1" FT repeat_region 1388067..1388301 FT /rpt_family="L1" FT repeat_region 1390364..1390603 FT /rpt_family="MaLR" FT repeat_region 1392817..1392956 FT /rpt_family="L2" FT repeat_region 1393327..1393725 FT /rpt_family="MaLR" FT misc_feature 1396292..1401730 FT /note="CpG_island (%GC=69.2, o/e=0.87, #CpGs=600)" FT repeat_region 1396460..1396488 FT /rpt_family="GC_rich" FT repeat_region 1396917..1396976 FT /rpt_family="GC_rich" FT repeat_region 1397257..1397277 FT /rpt_family="GC_rich" FT repeat_region 1397396..1397554 FT /rpt_family="(CCG)n" FT repeat_region 1397699..1397817 FT /rpt_family="CT-rich" FT repeat_region 1399366..1399399 FT /rpt_family="GA-rich" FT repeat_region 1401846..1401867 FT /rpt_family="GC_rich" FT repeat_region 1401886..1401927 FT /rpt_family="(TCCCC)n" FT repeat_region 1403688..1403790 FT /rpt_family="MIR" FT misc_feature 1407447..1409224 FT /note="CpG_island (%GC=71.2, o/e=1.00, #CpGs=191)" FT repeat_region 1408017..1408185 FT /rpt_family="G-rich" FT repeat_region 1408197..1408337 FT /rpt_family="G-rich" FT repeat_region 1408349..1408521 FT /rpt_family="G-rich" FT repeat_region 1408742..1408777 FT /rpt_family="GC_rich" FT repeat_region 1411013..1411052 FT /rpt_family="MER1_type" FT repeat_region 1411053..1411353 FT /rpt_family="Alu" FT repeat_region 1411354..1411802 FT /rpt_family="MER1_type" FT repeat_region 1411895..1412143 FT /rpt_family="L1" FT repeat_region 1412210..1412246 FT /rpt_family="AT_rich" FT repeat_region 1412308..1412610 FT /rpt_family="Alu" FT repeat_region 1413177..1413482 FT /rpt_family="Alu" FT repeat_region 1414011..1414298 FT /rpt_family="Alu" FT repeat_region 1414318..1414501 FT /rpt_family="L1" FT repeat_region 1414500..1414723 FT /rpt_family="L1" FT repeat_region 1414730..1415100 FT /rpt_family="L1" FT repeat_region 1415101..1415409 FT /rpt_family="Alu" FT repeat_region 1415410..1415846 FT /rpt_family="L1" FT gap 1423147..1478646 FT /estimated_length=55500 FT unsure 1499222..1499390 FT /note="Sequence derived from one plasmid subclone." FT misc_feature 1516170..1517110 FT /note="Sequence derived from PCR product of project DNA." FT unsure 1522352..1522952 FT /note="Unresolved tandem repeat." FT misc_feature 1574668..1580563 FT /note="Sequence derived from PCR product of project DNA." FT misc_feature 1600677 FT /note="Sequence derived from PCR product of project DNA." FT misc_feature 1653621..1654404 FT /note="Sequence derived from PCR product of project DNA." FT repeat_region 1662334..1662626 FT /rpt_family="Alu" FT repeat_region 1662635..1662703 FT /rpt_family="L2" FT repeat_region 1663637..1663755 FT /rpt_family="L1" FT repeat_region 1663774..1663929 FT /rpt_family="Alu" FT repeat_region 1663930..1664230 FT /rpt_family="Alu" FT repeat_region 1664207..1664230 FT /rpt_family="(A)n" FT repeat_region 1664231..1664393 FT /rpt_family="Alu" FT repeat_region 1664398..1664639 FT /rpt_family="L1" FT repeat_region 1664640..1664930 FT /rpt_family="Alu" FT repeat_region 1664931..1665234 FT /rpt_family="L1" FT repeat_region 1665266..1665390 FT /rpt_family="MER1_type" FT repeat_region 1665414..1665552 FT /rpt_family="Alu" FT misc_feature 1665756..1666437 FT /note="match to EST N73375 (NID:g1230483)" FT repeat_region 1665848..1666052 FT /rpt_family="L1" FT repeat_region 1666423..1666734 FT /rpt_family="Alu" FT repeat_region 1666710..1666750 FT /rpt_family="AT_rich" FT repeat_region 1666760..1667066 FT /rpt_family="Alu" FT repeat_region 1667045..1667068 FT /rpt_family="AT_rich" FT repeat_region 1667073..1667238 FT /rpt_family="Alu" FT repeat_region 1667556..1667705 FT /rpt_family="L1" FT repeat_region 1668125..1668176 FT /rpt_family="L1" FT repeat_region 1668447..1668574 FT /rpt_family="Alu" FT repeat_region 1668575..1668875 FT /rpt_family="Alu" FT repeat_region 1668876..1669044 FT /rpt_family="Alu" FT repeat_region 1669874..1670166 FT /rpt_family="Alu" FT misc_feature 1670394..1670632 FT /note="similar to Homo sapiens EST BI464729 FT (NID:g15255372)" FT repeat_region 1670811..1670966 FT /rpt_family="L1" FT repeat_region 1671338..1671609 FT /rpt_family="L1" FT repeat_region 1672583..1672920 FT /rpt_family="(CCCCAG)n" FT repeat_region 1672949..1673299 FT /rpt_family="(CCCCAG)n" FT repeat_region 1673625..1673693 FT /rpt_family="L1" FT repeat_region 1673934..1674113 FT /rpt_family="(CCCA)n" FT repeat_region 1674152..1674433 FT /rpt_family="L1" FT repeat_region 1674482..1674514 FT /rpt_family="(T)n" FT repeat_region 1674487..1674798 FT /rpt_family="Alu" FT repeat_region 1674803..1674936 FT /rpt_family="L1" FT repeat_region 1675179..1675468 FT /rpt_family="Alu" FT repeat_region 1675758..1676114 FT /rpt_family="MaLR" FT repeat_region 1676115..1676410 FT /rpt_family="Alu" FT repeat_region 1676411..1676516 FT /rpt_family="MaLR" FT repeat_region 1676777..1676837 FT /rpt_family="L2" FT repeat_region 1677842..1678229 FT /rpt_family="MaLR" FT repeat_region 1678604..1678759 FT /rpt_family="L1" FT repeat_region 1679470..1679689 FT /rpt_family="Alu" FT repeat_region 1679691..1679818 FT /rpt_family="L1" FT repeat_region 1679819..1680081 FT /rpt_family="Alu" FT repeat_region 1680082..1680266 FT /rpt_family="L1" FT repeat_region 1680267..1680558 FT /rpt_family="Alu" FT repeat_region 1680559..1680913 FT /rpt_family="L1" FT repeat_region 1680914..1681133 FT /rpt_family="Alu" FT repeat_region 1681114..1681133 FT /rpt_family="(A)n" FT repeat_region 1681134..1681434 FT /rpt_family="Alu" FT repeat_region 1681412..1681434 FT /rpt_family="(A)n" FT repeat_region 1681435..1681488 FT /rpt_family="L1" FT repeat_region 1681494..1681765 FT /rpt_family="Alu" FT repeat_region 1681768..1682072 FT /rpt_family="Alu" FT repeat_region 1682047..1682072 FT /rpt_family="(A)n" FT repeat_region 1682079..1682171 FT /rpt_family="L1" FT repeat_region 1682175..1682814 FT /rpt_family="L1" FT repeat_region 1682831..1683169 FT /rpt_family="Alu" FT repeat_region 1683249..1683528 FT /rpt_family="Alu" FT repeat_region 1683646..1683877 FT /rpt_family="MIR" FT repeat_region 1683968..1684008 FT /rpt_family="AT_rich" FT repeat_region 1683980..1684286 FT /rpt_family="Alu" FT misc_feature 1685142..1685558 FT /note="match to EST AA411289 (NID:g2068830) zv24c06.r1" FT repeat_region 1685149..1685256 FT /rpt_family="HY1" FT misc_feature 1685406..1686743 FT /note="CpG_island (%GC=74.5, o/e=0.90, #CpGs=183)" FT misc_feature 1685427..1685973 FT /note="match to EST AI357640 (NID:g4109261) qy15b06.x1" FT misc_feature 1685663..1685972 FT /note="match to EST AW206136 (NID:g6505610)" FT misc_feature 1685685..1685724 FT /note="similar to Homo sapiens EST BI464729 FT (NID:g15255372)" FT repeat_region 1686055..1686173 FT /rpt_family="(CCG)n" FT repeat_region 1687771..1688076 FT /rpt_family="Alu" FT repeat_region 1688050..1688074 FT /rpt_family="(A)n" FT repeat_region 1688347..1688447 FT /rpt_family="MIR" FT repeat_region 1688724..1688972 FT /rpt_family="L1" FT repeat_region 1688980..1689286 FT /rpt_family="Alu" FT misc_feature 1689031..1689034 FT /note="match to EST AW603137 (NID:g7307878)" FT repeat_region 1689444..1689526 FT /rpt_family="L1" FT misc_feature 1689527..1689547 FT /note="match to EST BI860397 (NID:g16001131)" FT repeat_region 1689527..1689835 FT /rpt_family="Alu" FT repeat_region 1689533..1689555 FT /rpt_family="(T)n" FT repeat_region 1689838..1689874 FT /rpt_family="L1" FT repeat_region 1689875..1690043 FT /rpt_family="Alu" FT repeat_region 1690044..1690341 FT /rpt_family="Alu" FT repeat_region 1690046..1690068 FT /rpt_family="(TTTA)n" FT repeat_region 1690342..1690352 FT /rpt_family="Alu" FT repeat_region 1690350..1690371 FT /rpt_family="AT_rich" FT repeat_region 1690353..1690649 FT /rpt_family="Alu" FT repeat_region 1690650..1690793 FT /rpt_family="Alu" FT repeat_region 1690794..1691066 FT /rpt_family="L1" FT repeat_region 1691067..1691093 FT /rpt_family="(T)n" FT misc_feature 1691068..1691083 FT /note="match to EST BI860397 (NID:g16001131)" FT misc_feature 1691070..1691101 FT /note="match to EST BG288323 (NID:g13043044)" FT repeat_region 1691373..1691680 FT /rpt_family="L1" FT misc_feature 1691680..1691694 FT /note="match to EST AW951941 (NID:g8141620)" FT repeat_region 1691681..1691977 FT /rpt_family="Alu" FT repeat_region 1691983..1692282 FT /rpt_family="Alu" FT misc_feature 1691986..1692010 FT /note="match to EST BI860397 (NID:g16001131)" FT repeat_region 1692283..1692428 FT /rpt_family="L1" FT repeat_region 1692536..1692566 FT /rpt_family="(CA)n" FT repeat_region 1692622..1692962 FT /rpt_family="MaLR" FT repeat_region 1693001..1693245 FT /rpt_family="Alu" FT repeat_region 1693269..1693378 FT /rpt_family="MaLR" FT misc_feature 1693449..1693618 FT /note="match to EST AA319921 (NID:g1972249)" FT misc_feature 1693522..1693524 FT /note="match to EST T54821 (NID:g656682) yb43f05.r1" FT misc_feature 1693957..1693959 FT /note="match to EST AL531182 (NID:g12794675)" FT repeat_region 1694089..1694393 FT /rpt_family="Alu" FT misc_feature 1694313..1694314 FT /note="match to EST AI468862 (NID:g4330952) ti43b02.x1" FT repeat_region 1694367..1694390 FT /rpt_family="AT_rich" FT misc_feature 1694522..1695389 FT /note="match to EST AL531182 (NID:g12794675)" FT misc_feature 1694528..1694721 FT /note="match to EST AI468862 (NID:g4330952) ti43b02.x1" FT misc_feature 1694528..1694932 FT /note="match to EST AA629558 (NID:g2552169) ad46a04.s1" FT misc_feature 1694530..1694831 FT /note="match to EST BI092401 (NID:g14510731)" FT misc_feature 1694530..1695118 FT /note="match to EST BG288323 (NID:g13043044)" FT misc_feature 1694537..1695066 FT /note="similar to Sus scrofa EST BF703678 (NID:g11989086)" FT misc_feature 1694542..1695033 FT /note="similar to Mus musculus EST AV004238 FT (NID:g16356046)" FT misc_feature 1694552..1695133 FT /note="match to EST AW949647 (NID:g8139279)" FT misc_feature 1694599..1695440 FT /note="match to EST AL558284 (NID:g12902659)" FT misc_feature 1694604..1695107 FT /note="similar to Homo sapiens EST AL521544 FT (NID:g12785037)" FT misc_feature 1694677..1695440 FT /note="match to EST BI086325 (NID:g14504655)" FT misc_feature 1694709..1695054 FT /note="match to EST BE813180 (NID:g10245414)" FT misc_feature 1694789..1695140 FT /note="match to EST BE549971 (NID:g9791663)" FT misc_feature 1694811..1694888 FT /note="similar to Homo sapiens EST AL581605 FT (NID:g12948774)" FT misc_feature 1694848..1695307 FT /note="similar to Homo sapiens EST AW577315 (NID:g7252364)" FT misc_feature 1694851..1695038 FT /note="similar to Mus musculus EST BI731488 FT (NID:g15708501)" FT misc_feature 1694864..1695405 FT /note="match to EST BI755565 (NID:g15747143)" FT misc_feature 1694880..1695440 FT /note="match to EST BF530862 (NID:g11618225)" FT misc_feature 1694895..1695305 FT /note="match to EST AW875337 (NID:g8013150)" FT misc_feature 1694900..1695440 FT /note="similar to Homo sapiens EST AL581344 FT (NID:g12948248)" FT misc_feature 1694943..1695440 FT /note="match to EST BF335190 (NID:g11305938)" FT misc_feature 1694978..1695440 FT /note="similar to Homo sapiens EST AL581605 FT (NID:g12948774)" FT misc_feature 1695022..1695440 FT /note="match to EST BI334022 (NID:g15018666)" FT misc_feature 1695040..1695044 FT /note="similar to Homo sapiens EST AA009664 (NID:g1470487) FT zi03c11.s1" FT /note="match to EST N68644 (NID:g1224805) za21a03.s1" FT misc_feature 1695066..1695440 FT /note="similar to Mus musculus EST BI731488 FT (NID:g15708501)" FT misc_feature 1695086..1695438 FT /note="similar to Mus musculus EST AV004238 FT (NID:g16356046)" FT misc_feature 1695093..1695440 FT /note="match to EST T86876 (NID:g715228) yd86b09.r1" FT misc_feature 1695105..1695431 FT /note="similar to Mus musculus EST BG147925 (NID:g12651333) FT uu73g04.y1" FT misc_feature 1695115..1695440 FT /note="similar to Sus scrofa EST BI184378 (NID:g14658787)" FT misc_feature 1695147..1695440 FT /note="match to EST BI089184 (NID:g14507514)" FT misc_feature 1695167..1695440 FT /note="match to EST BG827757 (NID:g14175344)" FT misc_feature 1695187..1695431 FT /note="similar to Mus musculus EST AA794973 (NID:g2857928) FT vr07g10.r1" FT misc_feature 1695200..1695440 FT /note="similar to Mus musculus EST BG085411 FT (NID:g12567975)" FT /note="match to EST AW603137 (NID:g7307878)" FT misc_feature 1695231..1695440 FT /note="match to EST AA441968 (NID:g2153846) zw62g01.r1" FT misc_feature 1695253..1695440 FT /note="similar to Homo sapiens EST AL521544 FT (NID:g12785037)" FT misc_feature 1695268..1695440 FT /note="similar to Mus musculus EST BE290541 (NID:g9171653)" FT misc_feature 1695293..1695440 FT /note="match to EST AL539461 (NID:g12868694)" FT misc_feature 1695303..1695421 FT /note="similar to Homo sapiens EST AV752050 FT (NID:g10909898)" FT misc_feature 1695364..1695440 FT /note="match to EST BG114977 (NID:g12608483)" FT misc_feature 1695399..1695440 FT /note="similar to Mus musculus EST BI689071 FT (NID:g15651700)" FT misc_feature 1695498..1695501 FT /note="match to EST BI092401 (NID:g14510731)" FT repeat_region 1695814..1696108 FT /rpt_family="Alu" FT misc_feature 1695892..1695893 FT /note="match to EST AW875337 (NID:g8013150)" FT repeat_region 1696115..1696415 FT /rpt_family="Alu" FT misc_feature 1696273..1696277 FT /note="match to EST N85001 (NID:g1260626)" FT misc_feature 1696457..1696460 FT /note="match to EST BI463028 (NID:g15253684)" FT misc_feature 1696494..1696565 FT /note="similar to Mus musculus EST BG147925 (NID:g12651333) FT uu73g04.y1" FT /note="similar to Mus musculus EST AA794973 (NID:g2857928) FT vr07g10.r1" FT misc_feature 1696501..1696567 FT /note="similar to Homo sapiens EST AL521544 FT (NID:g12785037)" FT /note="match to EST BG114977 (NID:g12608483)" FT /note="match to EST BF530862 (NID:g11618225)" FT /note="match to EST BI334022 (NID:g15018666)" FT /note="match to EST BI089184 (NID:g14507514)" FT /note="match to EST BG827757 (NID:g14175344)" FT /note="similar to Homo sapiens EST AL581605 FT (NID:g12948774)" FT /note="match to EST AL539461 (NID:g12868694)" FT /note="similar to Homo sapiens EST BI088191 FT (NID:g14506521)" FT /note="match to EST N85001 (NID:g1260626)" FT /note="match to EST AA441968 (NID:g2153846) zw62g01.r1" FT misc_feature 1696501..1696553 FT /note="match to EST T86876 (NID:g715228) yd86b09.r1" FT misc_feature 1696501..1696532 FT /note="match to EST AW603137 (NID:g7307878)" FT misc_feature 1696501..1696541 FT /note="similar to Mus musculus EST BI689071 FT (NID:g15651700)" FT /note="similar to Mus musculus EST BE290541 (NID:g9171653)" FT /note="similar to Mus musculus EST BG085411 FT (NID:g12567975)" FT /note="similar to Sus scrofa EST BI184378 (NID:g14658787)" FT misc_feature 1696501..1696569 FT /note="similar to Homo sapiens EST AL581344 FT (NID:g12948248)" FT misc_feature 1696501..1696537 FT /note="similar to Mus musculus EST BI731488 FT (NID:g15708501)" FT misc_feature 1696501..1696524 FT /note="match to EST BF335190 (NID:g11305938)" FT misc_feature 1696501..1696552 FT /note="match to EST AL558284 (NID:g12902659)" FT misc_feature 1696523..1696567 FT /note="match to EST AU131010 (NID:g10991364)" FT misc_feature 1696611..1696614 FT /note="match to EST BI086325 (NID:g14504655)" FT misc_feature 1696615..1697119 FT /note="match to EST BI054197 (NID:g14461727)" FT misc_feature 1696647..1696844 FT /note="similar to Homo sapiens EST BE072107 (NID:g8417800)" FT repeat_region 1697245..1697529 FT /rpt_family="Alu" FT misc_feature 1697490..1697983 FT /note="match to EST T54821 (NID:g656682) yb43f05.r1" FT repeat_region 1697648..1697692 FT /rpt_family="(CAAAAA)n" FT misc_feature 1697888..1698078 FT /note="similar to Mus musculus EST BG085411 FT (NID:g12567975)" FT /note="similar to Sus scrofa EST BI184378 (NID:g14658787)" FT /note="similar to Mus musculus EST BI731488 FT (NID:g15708501)" FT /note="similar to Mus musculus EST BI689071 FT (NID:g15651700)" FT /note="similar to Mus musculus EST BE290541 (NID:g9171653)" FT misc_feature 1697905..1698059 FT /note="similar to Mus musculus EST BG147925 (NID:g12651333) FT uu73g04.y1" FT misc_feature 1697905..1698079 FT /note="similar to Mus musculus EST AA794973 (NID:g2857928) FT vr07g10.r1" FT misc_feature 1697929..1698078 FT /note="match to EST AA441968 (NID:g2153846) zw62g01.r1" FT /note="match to EST BI089184 (NID:g14507514)" FT /note="match to EST BI334022 (NID:g15018666)" FT /note="similar to Mus musculus EST BG977078 FT (NID:g14364715)" FT /note="match to EST BG827757 (NID:g14175344)" FT /note="match to EST AU131010 (NID:g10991364)" FT /note="similar to Mus musculus EST BI852086 FT (NID:g15992833)" FT /note="similar to Mus musculus EST AA210416 (NID:g1807646) FT mo85d06.r1" FT /note="match to EST BG114977 (NID:g12608483)" FT /note="match to EST AL539461 (NID:g12868694)" FT /note="match to EST AA355320 (NID:g2007660)" FT misc_feature 1697929..1697992 FT /note="similar to Homo sapiens EST AL581605 FT (NID:g12948774)" FT misc_feature 1697929..1697967 FT /note="similar to Homo sapiens EST AL521544 FT (NID:g12785037)" FT misc_feature 1697929..1698045 FT /note="match to EST N85001 (NID:g1260626)" FT misc_feature 1697929..1698026 FT /note="match to EST BF530862 (NID:g11618225)" FT misc_feature 1697929..1698065 FT /note="similar to Homo sapiens EST BI088191 FT (NID:g14506521)" FT misc_feature 1697945..1698078 FT /note="match to EST BI463028 (NID:g15253684)" FT misc_feature 1698019..1698078 FT /note="similar to Bos taurus EST BF044147 (NID:g10761202)" FT misc_feature 1698137 FT /note="match to EST N85001 (NID:g1260626)" FT repeat_region 1698190..1698320 FT /rpt_family="Alu" FT repeat_region 1698343..1698642 FT /rpt_family="Alu" FT repeat_region 1698656..1698914 FT /rpt_family="Alu" FT repeat_region 1698886..1698914 FT /rpt_family="(A)n" FT repeat_region 1698915..1699218 FT /rpt_family="Alu" FT repeat_region 1699195..1699219 FT /rpt_family="AT_rich" FT repeat_region 1699251..1699275 FT /rpt_family="AT_rich" FT repeat_region 1699286..1699575 FT /rpt_family="Alu" FT repeat_region 1699585..1699806 FT /rpt_family="Alu" FT repeat_region 1699807..1700067 FT /rpt_family="Alu" FT repeat_region 1700068..1700147 FT /rpt_family="Alu" FT repeat_region 1700193..1700218 FT /rpt_family="(A)n" FT repeat_region 1700219..1700509 FT /rpt_family="Alu" FT repeat_region 1700521..1700804 FT /rpt_family="Alu" FT misc_feature 1700558..1700562 FT /note="similar to Homo sapiens EST AA009663 (NID:g1470486) FT zi03c11.r1" FT misc_feature 1701009..1701492 FT /note="match to EST BI021252 (NID:g14427882)" FT misc_feature 1701283..1701428 FT /note="similar to Homo sapiens EST BG614662 FT (NID:g13666033)" FT misc_feature 1701291..1701428 FT /note="match to EST BG114977 (NID:g12608483)" FT /note="similar to Mus musculus EST AA210416 (NID:g1807646) FT mo85d06.r1" FT /note="similar to Mus musculus EST BE290541 (NID:g9171653)" FT /note="match to EST BI089184 (NID:g14507514)" FT /note="match to EST BG827757 (NID:g14175344)" FT /note="match to EST AL539461 (NID:g12868694)" FT /note="similar to Mus musculus EST BI852086 FT (NID:g15992833)" FT /note="match to EST BI463028 (NID:g15253684)" FT /note="similar to Mus musculus EST BG077521 FT (NID:g12560089)" FT /note="similar to Sus scrofa EST BI184378 (NID:g14658787)" FT /note="similar to Bos taurus EST BF044147 (NID:g10761202)" FT /note="similar to Mus musculus EST BI689071 FT (NID:g15651700)" FT /note="similar to Mus musculus EST AA080003 (NID:g1618876) FT mj98h02.r1" FT /note="match to EST AA355320 (NID:g2007660)" FT /note="match to EST AU131010 (NID:g10991364)" FT misc_feature 1701291..1701415 FT /note="similar to Mus musculus EST BG085411 FT (NID:g12567975)" FT misc_feature 1701291..1701448 FT /note="similar to Mus musculus EST BG977078 FT (NID:g14364715)" FT misc_feature 1701291..1701346 FT /note="similar to Mus musculus EST BI731488 FT (NID:g15708501)" FT misc_feature 1701291..1701329 FT /note="match to EST AA441968 (NID:g2153846) zw62g01.r1" FT misc_feature 1701291..1701351 FT /note="match to EST BI334022 (NID:g15018666)" FT misc_feature 1701333..1701428 FT /note="match to EST AU136277 (NID:g10996816)" FT misc_feature 1701695..1702196 FT /note="match to EST BF433573 (NID:g11445745)" FT misc_feature 1701738..1701797 FT /note="match to EST BI463028 (NID:g15253684)" FT /note="similar to Mus musculus EST BG077521 FT (NID:g12560089)" FT /note="match to EST BI089184 (NID:g14507514)" FT /note="similar to Homo sapiens EST BG614662 FT (NID:g13666033)" FT /note="similar to Mus musculus EST AA080003 (NID:g1618876) FT mj98h02.r1" FT /note="similar to Mus musculus EST BE290541 (NID:g9171653)" FT /note="similar to Mus musculus EST AA210416 (NID:g1807646) FT mo85d06.r1" FT /note="similar to Mus musculus EST BI689071 FT (NID:g15651700)" FT /note="match to EST AU131010 (NID:g10991364)" FT /note="match to EST AU136277 (NID:g10996816)" FT /note="match to EST AA355320 (NID:g2007660)" FT /note="similar to Mus musculus EST BI852086 FT (NID:g15992833)" FT /note="similar to Bos taurus EST BF044147 (NID:g10761202)" FT /note="match to EST BG114977 (NID:g12608483)" FT /note="match to EST AL539461 (NID:g12868694)" FT misc_feature 1701738..1701788 FT /note="match to EST BG827757 (NID:g14175344)" FT misc_feature 1701738..1701799 FT /note="similar to Sus scrofa EST BI184378 (NID:g14658787)" FT misc_feature 1701767..1701797 FT /note="match to EST AL540113 (NID:g12869971)" FT repeat_region 1701914..1702291 FT /rpt_family="MER1_type" FT repeat_region 1702292..1702589 FT /rpt_family="Alu" FT misc_feature 1702516..1702517 FT /note="match to EST BG827757 (NID:g14175344)" FT repeat_region 1702590..1702650 FT /rpt_family="MER1_type" FT repeat_region 1702697..1702794 FT /rpt_family="MER105" FT repeat_region 1702860..1702890 FT /rpt_family="(T)n" FT repeat_region 1702861..1703168 FT /rpt_family="Alu" FT repeat_region 1703352..1703657 FT /rpt_family="Alu" FT repeat_region 1704692..1704984 FT /rpt_family="Alu" FT repeat_region 1704962..1704984 FT /rpt_family="(A)n" FT repeat_region 1705074..1705244 FT /rpt_family="MER1_type" FT misc_feature 1705318..1705427 FT /note="similar to Mus musculus EST BB841601 FT (NID:g17042332)" FT misc_feature 1705323..1705342 FT /note="match to EST AA355320 (NID:g2007660)" FT misc_feature 1705323..1705427 FT /note="match to EST BI463028 (NID:g15253684)" FT /note="match to EST AU131010 (NID:g10991364)" FT /note="similar to Bos taurus EST BF044147 (NID:g10761202)" FT /note="match to EST AL539461 (NID:g12868694)" FT /note="match to EST BG114977 (NID:g12608483)" FT /note="match to EST AU136277 (NID:g10996816)" FT /note="match to EST AL540113 (NID:g12869971)" FT /note="similar to Mus musculus EST BI852086 FT (NID:g15992833)" FT /note="similar to Mus musculus EST BG077521 FT (NID:g12560089)" FT misc_feature 1705323..1705381 FT /note="similar to Mus musculus EST BE290541 (NID:g9171653)" FT misc_feature 1705323..1705429 FT /note="similar to Mus musculus EST AA210416 (NID:g1807646) FT mo85d06.r1" FT misc_feature 1705323..1705347 FT /note="match to EST BI089184 (NID:g14507514)" FT misc_feature 1705375..1705427 FT /note="similar to Homo sapiens EST BI088191 FT (NID:g14506521)" FT repeat_region 1705515..1705655 FT /rpt_family="Alu" FT misc_feature 1705651..1706002 FT /note="similar to Homo sapiens EST AU139092 FT (NID:g11000613)" FT misc_feature 1705651..1706268 FT /note="similar to Homo sapiens EST BI254202 FT (NID:g14806383)" FT misc_feature 1705761..1706325 FT /note="similar to Homo sapiens EST BG548298 FT (NID:g13546963)" FT misc_feature 1706073..1706501 FT /note="similar to Homo sapiens EST W78714 (NID:g1389281) FT zh50g08.r1" FT misc_feature 1706078..1706642 FT /note="similar to Homo sapiens EST BI752539 FT (NID:g15744117)" FT misc_feature 1706181..1706648 FT /note="similar to Homo sapiens EST AA009663 (NID:g1470486) FT zi03c11.r1" FT misc_feature 1706305..1706642 FT /note="similar to Homo sapiens EST AA412381 (NID:g2070951) FT zt99d04.r1" FT misc_feature 1706546..1706642 FT /note="similar to Homo sapiens EST AW900476 (NID:g8064681)" FT misc_feature 1706577..1706652 FT /note="similar to Homo sapiens EST BG436253 FT (NID:g13342759)" FT repeat_region 1706651..1706951 FT /rpt_family="Alu" FT misc_feature 1706953..1707254 FT /note="similar to Homo sapiens EST R69207 (NID:g842724) FT yi39f07.r1" FT misc_feature 1706959..1707245 FT /note="similar to Homo sapiens EST AW900476 (NID:g8064681)" FT misc_feature 1706959..1707029 FT /note="similar to Homo sapiens EST AA412381 (NID:g2070951) FT zt99d04.r1" FT misc_feature 1706959..1707045 FT /note="similar to Homo sapiens EST BI752539 FT (NID:g15744117)" FT misc_feature 1706968..1707529 FT /note="similar to Homo sapiens EST BG436253 FT (NID:g13342759)" FT misc_feature 1706975..1707254 FT /note="similar to Homo sapiens EST BE088857 (NID:g8479269)" FT misc_feature 1706995..1707548 FT /note="similar to Homo sapiens EST AI655289 (NID:g4739268) FT tt12e08.x1" FT misc_feature 1707013..1707559 FT /note="similar to Homo sapiens EST BI255523 FT (NID:g14809025)" FT misc_feature 1707069..1707515 FT /note="similar to Homo sapiens EST R68844 (NID:g842361) FT yi37a03.r1" FT misc_feature 1707106..1707545 FT /note="similar to Homo sapiens EST AA009664 (NID:g1470487) FT zi03c11.s1" FT misc_feature 1707208..1707543 FT /note="similar to Homo sapiens EST BG621381 FT (NID:g13672752)" FT misc_feature 1707213..1707543 FT /note="similar to Homo sapiens EST AA770482 (NID:g2821720) FT ah74a03.s1" FT misc_feature 1707265..1707548 FT /note="similar to Homo sapiens EST R67400 (NID:g840038) FT yi35h03.s1" FT repeat_region 1707553..1707718 FT /rpt_family="Alu" FT repeat_region 1707729..1708022 FT /rpt_family="Alu" FT misc_feature 1707996..1707998 FT /note="similar to Homo sapiens EST AW900476 (NID:g8064681)" FT repeat_region 1708259..1708575 FT /rpt_family="Alu" FT repeat_region 1708580..1708664 FT /rpt_family="Alu" FT repeat_region 1708665..1708982 FT /rpt_family="Alu" FT misc_feature 1708949..1708982 FT /note="similar to Homo sapiens EST BG621381 FT (NID:g13672752)" FT repeat_region 1708953..1709024 FT /rpt_family="(A)n" FT repeat_region 1709023..1709239 FT /rpt_family="Alu" FT repeat_region 1709207..1709243 FT /rpt_family="AT_rich" FT repeat_region 1709392..1709530 FT /rpt_family="Alu" FT misc_feature 1709498..1709502 FT /note="similar to Homo sapiens EST R67400 (NID:g840038) FT yi35h03.s1" FT repeat_region 1709531..1709830 FT /rpt_family="Alu" FT repeat_region 1709831..1709983 FT /rpt_family="Alu" FT repeat_region 1710565..1710708 FT /rpt_family="L2" FT misc_feature 1710723..1710727 FT /note="similar to Homo sapiens EST AL581605 FT (NID:g12948774)" FT repeat_region 1710787..1710983 FT /rpt_family="Alu" FT repeat_region 1710984..1711337 FT /rpt_family="ERVK" FT repeat_region 1711338..1711633 FT /rpt_family="Alu" FT misc_feature 1711341..1711354 FT /note="match to EST BG981753 (NID:g14384488)" FT repeat_region 1711634..1711764 FT /rpt_family="ERVK" FT repeat_region 1711793..1711904 FT /rpt_family="Alu" FT repeat_region 1711908..1712154 FT /rpt_family="L2" FT repeat_region 1712155..1712494 FT /rpt_family="ERV1" FT repeat_region 1712495..1712802 FT /rpt_family="Alu" FT repeat_region 1712779..1712802 FT /rpt_family="(A)n" FT repeat_region 1712803..1712899 FT /rpt_family="ERV1" FT repeat_region 1712900..1713017 FT /rpt_family="L2" FT misc_feature 1712963..1713448 FT /note="match to EST BF515579 (NID:g11600758)" FT misc_feature 1713268..1714980 FT /note="CpG_island (%GC=71.7, o/e=0.90, #CpGs=207)" FT misc_feature 1713601..1713717 FT /note="match to EST AU131010 (NID:g10991364)" FT /note="similar to Homo sapiens EST BG614662 FT (NID:g13666033)" FT /note="match to EST AL540113 (NID:g12869971)" FT /note="similar to Homo sapiens EST BI088191 FT (NID:g14506521)" FT /note="similar to Bos taurus EST BF044147 (NID:g10761202)" FT /note="similar to Mus musculus EST BI689071 FT (NID:g15651700)" FT /note="similar to Mus musculus EST BB841601 FT (NID:g17042332)" FT /note="similar to Mus musculus EST BG077521 FT (NID:g12560089)" FT /note="match to EST BI463028 (NID:g15253684)" FT /note="similar to Mus musculus EST BI852086 FT (NID:g15992833)" FT /note="match to EST AU136277 (NID:g10996816)" FT /note="similar to Mus musculus EST AA080003 (NID:g1618876) FT mj98h02.r1" FT /note="match to EST AL539461 (NID:g12868694)" FT misc_feature 1713601..1713687 FT /note="match to EST BG114977 (NID:g12608483)" FT misc_feature 1713608..1713717 FT /note="match to EST AU098556 (NID:g13549685)" FT misc_feature 1713857..1714046 FT /note="match to EST AU098556 (NID:g13549685)" FT /note="match to EST AU131010 (NID:g10991364)" FT misc_feature 1713857..1713946 FT /note="similar to Mus musculus EST AA080003 (NID:g1618876) FT mj98h02.r1" FT /note="similar to Mus musculus EST BG077521 FT (NID:g12560089)" FT /note="similar to Mus musculus EST BI852086 FT (NID:g15992833)" FT /note="similar to Mus musculus EST BB841601 FT (NID:g17042332)" FT /note="similar to Mus musculus EST BI689071 FT (NID:g15651700)" FT misc_feature 1713857..1714044 FT /note="match to EST BI463028 (NID:g15253684)" FT /note="match to EST AU136277 (NID:g10996816)" FT /note="similar to Homo sapiens EST BG614662 FT (NID:g13666033)" FT misc_feature 1713857..1714025 FT /note="match to EST AL539461 (NID:g12868694)" FT misc_feature 1713857..1713933 FT /note="similar to Bos taurus EST BF044147 (NID:g10761202)" FT misc_feature 1713857..1714026 FT /note="match to EST AL540113 (NID:g12869971)" FT misc_feature 1713857..1713976 FT /note="similar to Homo sapiens EST BI088191 FT (NID:g14506521)" FT repeat_region 1713906..1714002 FT /rpt_family="(CAGGG)n" FT misc_feature 1713990 FT /note="similar to Homo sapiens EST BF971068 FT (NID:g12338283)" FT repeat_region 1714076..1714116 FT /rpt_family="GC_rich" FT misc_feature 1714092..1714093 FT /note="similar to Homo sapiens EST BG614662 FT (NID:g13666033)" FT misc_feature 1714158..1714361 FT /note="similar to Homo sapiens EST BF971068 FT (NID:g12338283)" FT repeat_region 1714315..1714336 FT /rpt_family="GC_rich" FT repeat_region 1714638..1714701 FT /rpt_family="MaLR" FT repeat_region 1715320..1715341 FT /rpt_family="ERV1" FT repeat_region 1715342..1715628 FT /rpt_family="Alu" FT repeat_region 1715629..1715680 FT /rpt_family="ERV1" FT repeat_region 1715680..1715847 FT /rpt_family="ERV1" FT repeat_region 1715849..1715986 FT /rpt_family="Alu" FT repeat_region 1715987..1716281 FT /rpt_family="Alu" FT repeat_region 1716287..1716692 FT /rpt_family="ERV1" FT misc_feature 1716587..1716590 FT /note="match to EST AA125767 (NID:g1687757) zl22b06.r1" FT repeat_region 1716699..1716798 FT /rpt_family="Alu" FT repeat_region 1716883..1716937 FT /rpt_family="L2" FT misc_feature 1717504..1717509 FT /note="match to EST BG751815 (NID:g14062468)" FT misc_feature 1717673..1717826 FT /note="match to EST AA587758 (NID:g2401933) nm95e10.s1" FT misc_feature 1717675..1717950 FT /note="match to EST AW951941 (NID:g8141620)" FT misc_feature 1717678..1718165 FT /note="match to EST BG118610 (NID:g12612116)" FT misc_feature 1717680..1718227 FT /note="match to EST BE646231 (NID:g9970542)" FT misc_feature 1717680..1718338 FT /note="similar to Homo sapiens EST BF530664 FT (NID:g11618027)" FT misc_feature 1717680..1718001 FT /note="match to EST AA737762 (NID:g2768519) nx09e03.s1" FT misc_feature 1717680..1717910 FT /note="match to EST AI151168 (NID:g3679637) qc87h02.x1" FT misc_feature 1717682..1717887 FT /note="match to EST AI769472 (NID:g5235981) wj14d10.x1" FT misc_feature 1717714..1718752 FT /note="match to EST AL566420 (NID:g12918762)" FT misc_feature 1717731..1718517 FT /note="match to EST BE613061 (NID:g9894658)" FT misc_feature 1717830..1718554 FT /note="match to EST BG333602 (NID:g13140040)" FT misc_feature 1717881..1718638 FT /note="match to EST BF525494 (NID:g11612855)" FT misc_feature 1717929..1718261 FT /note="match to EST T52717 (NID:g654577) ya72g12.r1" FT misc_feature 1718011..1718935 FT /note="match to EST BI769370 (NID:g15760948)" FT misc_feature 1718084..1718772 FT /note="match to EST BI488818 (NID:g15328046)" FT misc_feature 1718248..1719017 FT /note="match to EST BG911514 (NID:g14291990)" FT misc_feature 1718263..1718270 FT /note="match to EST BI226265 (NID:g14679709)" FT misc_feature 1718527..1719155 FT /note="match to EST BI862355 (NID:g16003102)" FT misc_feature 1718666..1719155 FT /note="match to EST BE792210 (NID:g10213408)" FT misc_feature 1718668..1718781 FT /note="match to EST AI151168 (NID:g3679637) qc87h02.x1" FT misc_feature 1718691..1719095 FT /note="match to EST AI769472 (NID:g5235981) wj14d10.x1" FT misc_feature 1718796..1719155 FT /note="match to EST BF316305 (NID:g11264652)" FT misc_feature 1718848..1719155 FT /note="match to EST AL555494 (NID:g12897278)" FT misc_feature 1718881..1719143 FT /note="similar to Sus scrofa EST BG894452 (NID:g14304693)" FT misc_feature 1718906..1719155 FT /note="similar to Mus musculus EST AI154696 (NID:g3683165) FT ud37f11.r1" FT misc_feature 1718923..1719155 FT /note="match to EST AA125767 (NID:g1687757) zl22b06.r1" FT misc_feature 1718923..1718924 FT /note="match to EST AL536645 (NID:g12800138)" FT misc_feature 1718925..1719155 FT /note="similar to Mus musculus EST AW762533 (NID:g7694461) FT ur63h11.y1" FT misc_feature 1718967..1719926 FT /note="match to EST AL536645 (NID:g12800138)" FT misc_feature 1718994..1719155 FT /note="match to EST BG754473 (NID:g14065126)" FT misc_feature 1719037..1719155 FT /note="match to EST BI820666 (NID:g15932216)" FT misc_feature 1719114..1719155 FT /note="match to EST AA587758 (NID:g2401933) nm95e10.s1" FT misc_feature 1719243..1719514 FT /note="match to EST BF316305 (NID:g11264652)" FT misc_feature 1719243..1719402 FT /note="match to EST BI862355 (NID:g16003102)" FT /note="match to EST BI820666 (NID:g15932216)" FT /note="similar to Mus musculus EST AW762533 (NID:g7694461) FT ur63h11.y1" FT /note="match to EST BG754473 (NID:g14065126)" FT /note="match to EST AA587758 (NID:g2401933) nm95e10.s1" FT misc_feature 1719243..1719303 FT /note="similar to Mus musculus EST AI154696 (NID:g3683165) FT ud37f11.r1" FT misc_feature 1719304..1719402 FT /note="similar to Rattus sp. EST AW143302 (NID:g6163201)" FT misc_feature 1719336..1719402 FT /note="match to EST BI821105 (NID:g15932655)" FT misc_feature 1719582..1719594 FT /note="match to EST AA355718 (NID:g2008038)" FT misc_feature 1719879..1720006 FT /note="similar to Mus musculus EST AW762533 (NID:g7694461) FT ur63h11.y1" FT misc_feature 1719879..1719902 FT /note="match to EST AA587758 (NID:g2401933) nm95e10.s1" FT misc_feature 1719879..1720353 FT /note="match to EST BI821105 (NID:g15932655)" FT /note="match to EST AL555494 (NID:g12897278)" FT /note="match to EST BI820666 (NID:g15932216)" FT misc_feature 1719879..1720354 FT /note="similar to Rattus sp. EST AW143302 (NID:g6163201)" FT misc_feature 1719879..1720285 FT /note="match to EST BG754473 (NID:g14065126)" FT misc_feature 1719879..1720200 FT /note="match to EST BE792210 (NID:g10213408)" FT misc_feature 1719879..1720011 FT /note="match to EST AA125767 (NID:g1687757) zl22b06.r1" FT /note="match to EST BI862355 (NID:g16003102)" FT misc_feature 1719882..1720353 FT /note="similar to Mus musculus EST BI220293 FT (NID:g14673737)" FT misc_feature 1719903..1720353 FT /note="match to EST BI598778 (NID:g15491717)" FT misc_feature 1719903..1720110 FT /note="match to EST F08271 (NID:g677791)" FT misc_feature 1719917..1720159 FT /note="match to EST BF804891 (NID:g12133880)" FT misc_feature 1719937..1720353 FT /note="match to EST BI598008 (NID:g15490947)" FT misc_feature 1719938..1720353 FT /note="match to EST BF058254 (NID:g10812150)" FT misc_feature 1720133..1720353 FT /note="match to EST BI599939 (NID:g15492878)" FT misc_feature 1720141 FT /note="match to EST BE397874 (NID:g9343239)" FT misc_feature 1720153..1720353 FT /note="similar to Homo sapiens EST BG323251 FT (NID:g13129688)" FT misc_feature 1720176..1720353 FT /note="match to EST AI573144 (NID:g4536518) tr70b03.x1" FT misc_feature 1720206..1720353 FT /note="match to EST BE397874 (NID:g9343239)" FT misc_feature 1720462 FT /note="similar to Homo sapiens EST AL561014 FT (NID:g12908030)" FT repeat_region 1720764..1720880 FT /rpt_family="L1" FT repeat_region 1720999..1721268 FT /rpt_family="Alu" FT misc_feature 1721060..1721065 FT /note="match to EST AW408640 (NID:g6927697)" FT misc_feature 1722135..1722643 FT /note="match to EST BF436307 (NID:g11448622)" FT misc_feature 1722180..1723850 FT /note="CpG_island (%GC=74.1, o/e=0.80, #CpGs=203)" FT misc_feature 1722337..1722575 FT /note="similar to Mus musculus EST BB872796 FT (NID:g17119006)" FT misc_feature 1722344..1723085 FT /note="match to EST BF312852 (NID:g11260743)" FT misc_feature 1722354 FT /note="similar to Homo sapiens EST BI546209 FT (NID:g15433521)" FT misc_feature 1722360..1722900 FT /note="match to EST BE397874 (NID:g9343239)" FT misc_feature 1722360..1722389 FT /note="match to EST BI820666 (NID:g15932216)" FT misc_feature 1722360..1722633 FT /note="match to EST AI573144 (NID:g4536518) tr70b03.x1" FT misc_feature 1722360..1722568 FT /note="similar to Mus musculus EST BI220293 FT (NID:g14673737)" FT misc_feature 1722360..1722548 FT /note="match to EST BI821105 (NID:g15932655)" FT misc_feature 1722360..1722825 FT /note="similar to Homo sapiens EST BG323251 FT (NID:g13129688)" FT misc_feature 1722360..1722985 FT /note="match to EST BI599939 (NID:g15492878)" FT misc_feature 1722360..1722684 FT /note="match to EST BI598778 (NID:g15491717)" FT misc_feature 1722360..1722749 FT /note="match to EST BI598008 (NID:g15490947)" FT misc_feature 1722360..1722488 FT /note="match to EST AL555494 (NID:g12897278)" FT misc_feature 1722380..1723063 FT /note="match to EST BG723098 (NID:g14002285)" FT misc_feature 1722383..1723035 FT /note="similar to Homo sapiens EST BI546209 FT (NID:g15433521)" FT repeat_region 1722594..1722614 FT /rpt_family="GC_rich" FT misc_feature 1722642..1722661 FT /note="match to EST BF058254 (NID:g10812150)" FT repeat_region 1722651..1722681 FT /rpt_family="GC_rich" FT misc_feature 1722654..1723105 FT /note="match to EST AW070301 (NID:g6025299) xa06h06.x1" FT misc_feature 1722668..1723063 FT /note="similar to Homo sapiens EST BE314319 (NID:g9135301)" FT misc_feature 1722692..1723058 FT /note="similar to Homo sapiens EST BE314328 (NID:g9135317)" FT repeat_region 1722699..1722723 FT /rpt_family="GC_rich" FT repeat_region 1722741..1722765 FT /rpt_family="GC_rich" FT repeat_region 1722783..1722807 FT /rpt_family="GC_rich" FT misc_feature 1723225..1723370 FT /note="match to EST AU100207 (NID:g13551336)" FT misc_feature 1723245..1723370 FT /note="match to EST BG752778 (NID:g14063431)" FT misc_feature 1723256..1723370 FT /note="match to EST BE208601 (NID:g8751999) ba11c09.y1" FT misc_feature 1723268..1723370 FT /note="match to EST BG757178 (NID:g14067831)" FT misc_feature 1723275..1723346 FT /note="similar to Homo sapiens EST AL561014 FT (NID:g12908030)" FT misc_feature 1723302..1723370 FT /note="match to EST AW408640 (NID:g6927697)" FT repeat_region 1723423..1723469 FT /rpt_family="(CCCCG)n" FT misc_feature 1723525..1723526 FT /note="match to EST BG723098 (NID:g14002285)" FT misc_feature 1723644..1723648 FT /note="match to EST AA737762 (NID:g2768519) nx09e03.s1" FT repeat_region 1724087..1724128 FT /rpt_family="L2" FT misc_feature 1725148..1725310 FT /note="match to EST AW408640 (NID:g6927697)" FT /note="match to EST BG757178 (NID:g14067831)" FT /note="match to EST BE208601 (NID:g8751999) ba11c09.y1" FT /note="match to EST BG752778 (NID:g14063431)" FT misc_feature 1725148..1725302 FT /note="match to EST AU100207 (NID:g13551336)" FT misc_feature 1725244..1725310 FT /note="match to EST BG751815 (NID:g14062468)" FT misc_feature 1725249..1725310 FT /note="match to EST BM152636 (NID:g17177064)" FT misc_feature 1725265..1725310 FT /note="match to EST AV761182 (NID:g10919030)" FT misc_feature 1725266..1725310 FT /note="match to EST BI837799 (NID:g15949349)" FT misc_feature 1725455..1725601 FT /note="match to EST AV761182 (NID:g10919030)" FT misc_feature 1725455..1725597 FT /note="match to EST BI837799 (NID:g15949349)" FT /note="match to EST BM152636 (NID:g17177064)" FT /note="match to EST BG751815 (NID:g14062468)" FT /note="match to EST AW408640 (NID:g6927697)" FT /note="match to EST BG757178 (NID:g14067831)" FT /note="match to EST BE208601 (NID:g8751999) ba11c09.y1" FT /note="match to EST BG752778 (NID:g14063431)" FT misc_feature 1725466..1725597 FT /note="match to EST AA074024 (NID:g1613964) zm75f06.s1" FT misc_feature 1725523..1725597 FT /note="match to EST BG758217 (NID:g14068870)" FT repeat_region 1725696..1725997 FT /rpt_family="Alu" FT misc_feature 1725909..1725912 FT /note="match to EST BE513696 (NID:g9720908)" FT repeat_region 1726107..1726132 FT /rpt_family="(T)n" FT misc_feature 1726134..1726645 FT /note="match to EST AV763130 (NID:g10920978)" FT repeat_region 1726500..1726654 FT /rpt_family="Alu" FT repeat_region 1726655..1726676 FT /rpt_family="(T)n" FT misc_feature 1727844..1727848 FT /note="similar to Homo sapiens EST BE314319 (NID:g9135301)" FT misc_feature 1728061..1728065 FT /note="similar to Homo sapiens EST AL118906 (NID:g5924805)" FT misc_feature 1728239..1728519 FT /note="match to EST BF371686 (NID:g11333711)" FT repeat_region 1728475..1728574 FT /rpt_family="ERVL" FT repeat_region 1728575..1728885 FT /rpt_family="Alu" FT repeat_region 1728886..1728979 FT /rpt_family="ERVL" FT repeat_region 1729193..1729380 FT /rpt_family="ERVL" FT misc_feature 1729201..1729207 FT /note="match to EST BE094732 (NID:g8485185)" FT misc_feature 1729332..1730187 FT /note="match to EST BI818435 (NID:g15929301)" FT misc_feature 1729388..1729392 FT /note="match to EST BG754473 (NID:g14065126)" FT misc_feature 1729435..1730277 FT /note="match to EST BG758217 (NID:g14068870)" FT misc_feature 1729435..1729761 FT /note="match to EST AA074024 (NID:g1613964) zm75f06.s1" FT misc_feature 1729435..1730092 FT /note="match to EST BI837799 (NID:g15949349)" FT misc_feature 1729435..1729448 FT /note="match to EST BM152636 (NID:g17177064)" FT misc_feature 1729435..1729853 FT /note="match to EST BG751815 (NID:g14062468)" FT misc_feature 1729435..1729453 FT /note="match to EST AW408640 (NID:g6927697)" FT misc_feature 1729435..1729911 FT /note="match to EST BG757178 (NID:g14067831)" FT misc_feature 1729435..1729487 FT /note="match to EST BE208601 (NID:g8751999) ba11c09.y1" FT misc_feature 1729435..1729749 FT /note="match to EST BG752778 (NID:g14063431)" FT misc_feature 1729462..1730169 FT /note="match to EST BG121145 (NID:g12614654)" FT misc_feature 1729560..1730430 FT /note="match to EST BE793460 (NID:g10214658)" FT misc_feature 1729628..1730086 FT /note="match to EST AI460042 (NID:g4312923) ap34b03.x1" FT misc_feature 1729800..1730472 FT /note="match to EST BG911981 (NID:g14292457)" FT misc_feature 1729804..1730286 FT /note="similar to Homo sapiens EST BE540350 (NID:g9768995)" FT misc_feature 1729836..1730519 FT /note="match to EST BI226459 (NID:g14679903)" FT misc_feature 1729848..1729849 FT /note="match to EST BF684535 (NID:g11969943)" FT /note="match to EST BM010394 (NID:g16524748)" FT /note="match to EST BM010646 (NID:g16525000)" FT misc_feature 1729858..1730514 FT /note="match to EST BE559863 (NID:g9803582)" FT misc_feature 1729959..1730247 FT /note="match to EST AW516785 (NID:g7154951) xq04b09.x1" FT misc_feature 1730080..1730246 FT /note="match to EST AV761182 (NID:g10919030)" FT misc_feature 1730103..1730507 FT /note="match to EST BM010394 (NID:g16524748)" FT misc_feature 1730103..1730324 FT /note="match to EST BM010646 (NID:g16525000)" FT misc_feature 1730120..1730514 FT /note="match to EST BG261353 (NID:g12771169)" FT misc_feature 1730131..1730514 FT /note="match to EST BG283560 (NID:g13033626)" FT misc_feature 1730135..1730514 FT /note="match to EST BG388772 (NID:g13282218)" FT misc_feature 1730154..1730514 FT /note="match to EST BG283230 (NID:g13032906)" FT misc_feature 1730172..1730514 FT /note="match to EST AA074193 (NID:g1614061) zm76g01.s1" FT misc_feature 1730179 FT /note="match to EST BI837799 (NID:g15949349)" FT misc_feature 1730326..1730518 FT /note="match to EST BE552327 (NID:g9794019) hy06b09.x1" FT misc_feature 1730362..1730514 FT /note="match to EST AW674350 (NID:g7539585) ba63c04.y1" FT misc_feature 1730384..1730514 FT /note="match to EST BF896407 (NID:g12287866)" FT misc_feature 1730399..1730514 FT /note="match to EST BI226265 (NID:g14679709)" FT misc_feature 1730410..1730514 FT /note="match to EST BF684535 (NID:g11969943)" FT misc_feature 1730414..1730514 FT /note="match to EST BE513696 (NID:g9720908)" FT misc_feature 1730490..1730514 FT /note="match to EST BG114596 (NID:g12608102)" FT misc_feature 1730546..1730974 FT /note="match to EST AW821224 (NID:g7914218)" FT misc_feature 1730567..1730772 FT /note="similar to Homo sapiens EST BF896092 FT (NID:g12287551)" FT misc_feature 1730570..1730785 FT /note="match to EST BF894949 (NID:g12286408)" FT misc_feature 1730571..1731177 FT /note="match to EST AW364743 (NID:g6869497)" FT misc_feature 1730625..1731068 FT /note="match to EST AI090599 (NID:g3429658) qa70f10.x1" FT misc_feature 1730642 FT /note="match to EST BG751815 (NID:g14062468)" FT repeat_region 1730991..1731758 FT /rpt_family="ERVK" FT misc_feature 1731043..1731133 FT /note="match to EST BE559863 (NID:g9803582)" FT misc_feature 1731045..1731211 FT /note="match to EST BE552327 (NID:g9794019) hy06b09.x1" FT misc_feature 1731278..1731279 FT /note="match to EST BE559863 (NID:g9803582)" FT repeat_region 1731759..1732062 FT /rpt_family="Alu" FT repeat_region 1732063..1732269 FT /rpt_family="ERVK" FT misc_feature 1732554..1732555 FT /note="match to EST BE394164 (NID:g9339529)" FT misc_feature 1732610..1732689 FT /note="match to EST AA098912 (NID:g1644964) zn45h08.r1" FT misc_feature 1732614..1732617 FT /note="match to EST BG420184 (NID:g13326690)" FT misc_feature 1732614..1732681 FT /note="match to EST AA074193 (NID:g1614061) zm76g01.s1" FT misc_feature 1732614..1732689 FT /note="match to EST BF896407 (NID:g12287866)" FT /note="match to EST BE394164 (NID:g9339529)" FT /note="match to EST BG114596 (NID:g12608102)" FT /note="match to EST BE513696 (NID:g9720908)" FT /note="match to EST BF684535 (NID:g11969943)" FT /note="match to EST BI226265 (NID:g14679709)" FT /note="match to EST AW674350 (NID:g7539585) ba63c04.y1" FT /note="match to EST BG283230 (NID:g13032906)" FT /note="match to EST BG388772 (NID:g13282218)" FT /note="match to EST BG283560 (NID:g13033626)" FT /note="match to EST BG261353 (NID:g12771169)" FT misc_feature 1732899..1733031 FT /note="match to EST BF896407 (NID:g12287866)" FT misc_feature 1732899..1732958 FT /note="match to EST BG283560 (NID:g13033626)" FT misc_feature 1732899..1733028 FT /note="match to EST AA098912 (NID:g1644964) zn45h08.r1" FT /note="match to EST BE394164 (NID:g9339529)" FT /note="match to EST BG114596 (NID:g12608102)" FT /note="match to EST BE513696 (NID:g9720908)" FT /note="match to EST BF684535 (NID:g11969943)" FT /note="match to EST BI226265 (NID:g14679709)" FT /note="match to EST AW674350 (NID:g7539585) ba63c04.y1" FT /note="match to EST BG283230 (NID:g13032906)" FT /note="match to EST BG388772 (NID:g13282218)" FT /note="match to EST BG261353 (NID:g12771169)" FT misc_feature 1732902..1733028 FT /note="match to EST AA355718 (NID:g2008038)" FT misc_feature 1732909..1733028 FT /note="match to EST AL522602 (NID:g12786095)" FT misc_feature 1732974..1733028 FT /note="match to EST BG420184 (NID:g13326690)" FT misc_feature 1733242..1733778 FT /note="match to EST BF906274 (NID:g12297733)" FT repeat_region 1733368..1733659 FT /rpt_family="Alu" FT misc_feature 1733506..1733816 FT /note="match to EST BF907603 (NID:g12299074)" FT repeat_region 1734432..1735012 FT /rpt_family="L1" FT repeat_region 1735101..1735398 FT /rpt_family="Alu" FT repeat_region 1735423..1735727 FT /rpt_family="Alu" FT repeat_region 1735919..1736213 FT /rpt_family="Alu" FT repeat_region 1736235..1736331 FT /rpt_family="Alu" FT repeat_region 1736333..1736400 FT /rpt_family="L1" FT repeat_region 1736403..1736631 FT /rpt_family="Alu" FT repeat_region 1736701..1736831 FT /rpt_family="MER1_type" FT misc_feature 1737000..1737057 FT /note="match to EST BG114596 (NID:g12608102)" FT misc_feature 1737000..1737023 FT /note="match to EST BG388772 (NID:g13282218)" FT misc_feature 1737000..1737052 FT /note="match to EST AA098912 (NID:g1644964) zn45h08.r1" FT /note="match to EST BG420184 (NID:g13326690)" FT /note="match to EST AL522602 (NID:g12786095)" FT /note="match to EST AA355718 (NID:g2008038)" FT /note="match to EST BE394164 (NID:g9339529)" FT /note="match to EST BE513696 (NID:g9720908)" FT /note="match to EST BF684535 (NID:g11969943)" FT /note="match to EST BI226265 (NID:g14679709)" FT /note="match to EST AW674350 (NID:g7539585) ba63c04.y1" FT /note="match to EST BG261353 (NID:g12771169)" FT misc_feature 1737009..1737023 FT /note="similar to Homo sapiens EST AL561014 FT (NID:g12908030)" FT misc_feature 1737020..1737052 FT /note="match to EST BG283560 (NID:g13033626)" FT misc_feature 1737458..1737510 FT /note="match to EST AA355718 (NID:g2008038)" FT misc_feature 1737458..1737561 FT /note="match to EST AA098912 (NID:g1644964) zn45h08.r1" FT /note="match to EST BG420184 (NID:g13326690)" FT /note="match to EST AL522602 (NID:g12786095)" FT /note="match to EST BE394164 (NID:g9339529)" FT /note="match to EST BE513696 (NID:g9720908)" FT /note="match to EST BF684535 (NID:g11969943)" FT /note="match to EST BI226265 (NID:g14679709)" FT /note="match to EST AW674350 (NID:g7539585) ba63c04.y1" FT misc_feature 1737458..1737574 FT /note="match to EST BG283560 (NID:g13033626)" FT misc_feature 1737458..1737518 FT /note="match to EST BG261353 (NID:g12771169)" FT misc_feature 1737464..1737561 FT /note="match to EST BI771998 (NID:g15763576)" FT misc_feature 1737516..1737561 FT /note="match to EST AL582320 (NID:g12950187)" FT misc_feature 1737519..1737561 FT /note="match to EST BF896315 (NID:g12287774)" FT misc_feature 1737523..1737561 FT /note="match to EST BG576811 (NID:g13584464)" FT misc_feature 1737533..1737551 FT /note="similar to Homo sapiens EST AL561014 FT (NID:g12908030)" FT repeat_region 1737869..1738179 FT /rpt_family="Alu" FT repeat_region 1738150..1738180 FT /rpt_family="(A)n" FT repeat_region 1738182..1738353 FT /rpt_family="MER1_type" FT repeat_region 1738354..1738655 FT /rpt_family="Alu" FT misc_feature 1738963..1739055 FT /note="match to EST BM040833 (NID:g16770100)" FT misc_feature 1738964..1739055 FT /note="match to EST AL525469 (NID:g12788962)" FT misc_feature 1738968..1739055 FT /note="match to EST AL582320 (NID:g12950187)" FT /note="match to EST BF896315 (NID:g12287774)" FT /note="match to EST AA098912 (NID:g1644964) zn45h08.r1" FT /note="match to EST BG576811 (NID:g13584464)" FT /note="match to EST BI771998 (NID:g15763576)" FT /note="match to EST BG420184 (NID:g13326690)" FT /note="match to EST AL522602 (NID:g12786095)" FT /note="match to EST BE394164 (NID:g9339529)" FT /note="match to EST BE513696 (NID:g9720908)" FT /note="match to EST BF684535 (NID:g11969943)" FT /note="match to EST BI226265 (NID:g14679709)" FT misc_feature 1738968..1739038 FT /note="match to EST AW674350 (NID:g7539585) ba63c04.y1" FT misc_feature 1738999..1739055 FT /note="match to EST BG324498 (NID:g13130935)" FT misc_feature 1739002..1739055 FT /note="match to EST AA357042 (NID:g2009381)" FT misc_feature 1739016..1739055 FT /note="similar to Homo sapiens EST AL561014 FT (NID:g12908030)" FT misc_feature 1739268..1739440 FT /note="match to EST BF684535 (NID:g11969943)" FT misc_feature 1739313..1739429 FT /note="similar to Homo sapiens EST BE774178 FT (NID:g10227742)" FT misc_feature 1739325..1739347 FT /note="match to EST AA098912 (NID:g1644964) zn45h08.r1" FT misc_feature 1739325..1739435 FT /note="match to EST BE513696 (NID:g9720908)" FT misc_feature 1739325..1739429 FT /note="match to EST AL525469 (NID:g12788962)" FT /note="match to EST AL582320 (NID:g12950187)" FT /note="match to EST BF896315 (NID:g12287774)" FT /note="match to EST AA357042 (NID:g2009381)" FT /note="match to EST BG324498 (NID:g13130935)" FT /note="match to EST BM040833 (NID:g16770100)" FT /note="match to EST BG576811 (NID:g13584464)" FT /note="match to EST BI771998 (NID:g15763576)" FT /note="match to EST BG420184 (NID:g13326690)" FT /note="match to EST AL522602 (NID:g12786095)" FT /note="match to EST BE394164 (NID:g9339529)" FT /note="match to EST BI226265 (NID:g14679709)" FT misc_feature 1739325..1739384 FT /note="similar to Homo sapiens EST AL561014 FT (NID:g12908030)" FT misc_feature 1739333..1739429 FT /note="similar to Mus musculus EST AV308949 FT (NID:g16394120)" FT misc_feature 1739369 FT /note="match to EST BE094726 (NID:g8485179)" FT misc_feature 1739383..1739429 FT /note="match to EST BE094726 (NID:g8485179)" FT misc_feature 1739387..1739429 FT /note="match to EST BI869396 (NID:g16043069)" FT misc_feature 1739408..1739429 FT /note="match to EST BE094732 (NID:g8485185)" FT misc_feature 1739775..1740479 FT /note="match to EST BI018865 (NID:g14425495)" FT repeat_region 1740261..1740753 FT /rpt_family="ERV1" FT repeat_region 1740754..1741052 FT /rpt_family="Alu" FT repeat_region 1741053..1741112 FT /rpt_family="ERV1" FT misc_feature 1741122..1741264 FT /note="similar to Homo sapiens EST AA389653 (NID:g2042704)" FT misc_feature 1741372..1741376 FT /note="match to EST AL566420 (NID:g12918762)" FT misc_feature 1741420..1741505 FT /note="match to EST AW392771 (NID:g6897430)" FT misc_feature 1741426..1741510 FT /note="match to EST BF896315 (NID:g12287774)" FT misc_feature 1741429..1741505 FT /note="match to EST AL525469 (NID:g12788962)" FT /note="match to EST AL582320 (NID:g12950187)" FT /note="match to EST BE094726 (NID:g8485179)" FT /note="match to EST BE094732 (NID:g8485185)" FT /note="match to EST BI869396 (NID:g16043069)" FT /note="similar to Mus musculus EST AV308949 FT (NID:g16394120)" FT /note="match to EST AA357042 (NID:g2009381)" FT /note="match to EST BG324498 (NID:g13130935)" FT /note="match to EST BM040833 (NID:g16770100)" FT /note="match to EST BG576811 (NID:g13584464)" FT /note="match to EST BI771998 (NID:g15763576)" FT /note="match to EST BG420184 (NID:g13326690)" FT /note="match to EST AL522602 (NID:g12786095)" FT misc_feature 1741429..1741510 FT /note="similar to Homo sapiens EST BE774178 FT (NID:g10227742)" FT /note="match to EST BE394164 (NID:g9339529)" FT /note="match to EST BI226265 (NID:g14679709)" FT misc_feature 1741447..1741505 FT /note="match to EST BG744979 (NID:g14055632)" FT misc_feature 1741453..1741505 FT /note="match to EST AA215687 (NID:g1815459) zr97h01.r1" FT repeat_region 1741528..1741624 FT /rpt_family="C-rich" FT misc_feature 1741682..1741729 FT /note="match to EST BF876465 (NID:g12266595)" FT misc_feature 1741686..1741729 FT /note="match to EST BG576811 (NID:g13584464)" FT /note="match to EST AW392771 (NID:g6897430)" FT /note="match to EST BM040833 (NID:g16770100)" FT /note="match to EST AL522602 (NID:g12786095)" FT /note="match to EST BG420184 (NID:g13326690)" FT /note="match to EST AL525469 (NID:g12788962)" FT /note="match to EST AL582320 (NID:g12950187)" FT /note="match to EST BG744979 (NID:g14055632)" FT /note="match to EST AA215687 (NID:g1815459) zr97h01.r1" FT /note="match to EST BE094732 (NID:g8485185)" FT /note="match to EST BI869396 (NID:g16043069)" FT /note="match to EST BG324498 (NID:g13130935)" FT /note="match to EST BI771998 (NID:g15763576)" FT misc_feature 1741686..1741735 FT /note="match to EST BE094726 (NID:g8485179)" FT misc_feature 1741686..1741755 FT /note="similar to Mus musculus EST AV308949 FT (NID:g16394120)" FT misc_feature 1741686..1741699 FT /note="match to EST AA357042 (NID:g2009381)" FT misc_feature 1741690..1741729 FT /note="match to EST BM041737 (NID:g16771004)" FT /note="match to EST BF875023 (NID:g12265153)" FT misc_feature 1741886..1741922 FT /note="match to EST AA283654 (NID:g1927792) zt16g09.r1" FT misc_feature 1741992..1742365 FT /note="match to EST AA283654 (NID:g1927792) zt16g09.r1" FT misc_feature 1742538..1743031 FT /note="match to EST BF516152 (NID:g11601331)" FT misc_feature 1742553..1742713 FT /note="match to EST AL525469 (NID:g12788962)" FT /note="match to EST AL582320 (NID:g12950187)" FT /note="match to EST BG744979 (NID:g14055632)" FT /note="match to EST BM041737 (NID:g16771004)" FT /note="match to EST BF875023 (NID:g12265153)" FT /note="match to EST BF876465 (NID:g12266595)" FT /note="match to EST AA215687 (NID:g1815459) zr97h01.r1" FT /note="match to EST BE094732 (NID:g8485185)" FT /note="match to EST AW392771 (NID:g6897430)" FT /note="match to EST BI869396 (NID:g16043069)" FT /note="match to EST BG324498 (NID:g13130935)" FT /note="match to EST BM040833 (NID:g16770100)" FT /note="match to EST BG576811 (NID:g13584464)" FT /note="match to EST BI771998 (NID:g15763576)" FT /note="match to EST BG420184 (NID:g13326690)" FT /note="match to EST AL522602 (NID:g12786095)" FT misc_feature 1742558..1742713 FT /note="match to EST AA280070 (NID:g1921544) zs93e09.r1" FT misc_feature 1742567..1742713 FT /note="similar to Mus musculus EST AV308949 FT (NID:g16394120)" FT misc_feature 1742611..1742713 FT /note="match to EST AW514948 (NID:g7153030) xv01a08.x1" FT misc_feature 1742655..1742713 FT /note="similar to Rattus norvegicus EST AW253829 FT (NID:g6597420)" FT repeat_region 1743680..1743848 FT /rpt_family="Alu" FT misc_feature 1743833..1743849 FT /note="similar to Homo sapiens EST BI255523 FT (NID:g14809025)" FT misc_feature 1744069..1744635 FT /note="match to EST AL041345 (NID:g5420696)" FT repeat_region 1744262..1744275 FT /rpt_family="Alu" FT repeat_region 1744276..1744545 FT /rpt_family="Alu" FT repeat_region 1744546..1744714 FT /rpt_family="Alu" FT repeat_region 1744722..1744999 FT /rpt_family="Alu" FT repeat_region 1745002..1745307 FT /rpt_family="Alu" FT misc_feature 1746202..1746351 FT /note="similar to EST BM313828 (NID:g18048173) ih07b11.x1" FT misc_feature 1746245..1746352 FT /note="match to EST BF876465 (NID:g12266595)" FT misc_feature 1746245..1746341 FT /note="match to EST AA215687 (NID:g1815459) zr97h01.r1" FT misc_feature 1746245..1746345 FT /note="match to EST AW392771 (NID:g6897430)" FT misc_feature 1746245..1746264 FT /note="match to EST BI771998 (NID:g15763576)" FT misc_feature 1746245..1746263 FT /note="match to EST BG420184 (NID:g13326690)" FT misc_feature 1746245..1746351 FT /note="similar to EST BM314107 (NID:g18048452) ih07b11.y1" FT /note="match to EST AW514948 (NID:g7153030) xv01a08.x1" FT /note="match to EST AL525469 (NID:g12788962)" FT /note="match to EST AL582320 (NID:g12950187)" FT /note="match to EST BG744979 (NID:g14055632)" FT /note="match to EST BM041737 (NID:g16771004)" FT /note="similar to Rattus norvegicus EST AW253829 FT (NID:g6597420)" FT /note="match to EST AA280070 (NID:g1921544) zs93e09.r1" FT /note="match to EST BF875023 (NID:g12265153)" FT /note="match to EST BE094732 (NID:g8485185)" FT /note="match to EST BI869396 (NID:g16043069)" FT /note="similar to Mus musculus EST AV308949 FT (NID:g16394120)" FT /note="match to EST BG324498 (NID:g13130935)" FT /note="match to EST BM040833 (NID:g16770100)" FT /note="match to EST BG576811 (NID:g13584464)" FT /note="match to EST AL522602 (NID:g12786095)" FT misc_feature 1746253..1746351 FT /note="match to EST AW410479 (NID:g6936020) fh06e02.y1" FT misc_feature 1746304..1746351 FT /note="match to EST BG261135 (NID:g12770951)" FT misc_feature 1746308..1746898 FT /note="match to EST AI990642 (NID:g5837523) ws22g06.x1" FT misc_feature 1746336..1746351 FT /note="match to EST AI436171 (NID:g4308318) th73c10.x1" FT misc_feature 1746439..1746898 FT /note="similar to EST BM314107 (NID:g18048452) ih07b11.y1" FT misc_feature 1746439..1746803 FT /note="similar to EST BM313828 (NID:g18048173) ih07b11.x1" FT misc_feature 1746439..1746547 FT /note="match to EST BF875023 (NID:g12265153)" FT misc_feature 1746439..1746477 FT /note="match to EST BE094732 (NID:g8485185)" FT misc_feature 1746439..1746505 FT /note="match to EST BM040833 (NID:g16770100)" FT misc_feature 1746439..1746559 FT /note="match to EST AW410479 (NID:g6936020) fh06e02.y1" FT /note="match to EST AI436171 (NID:g4308318) th73c10.x1" FT /note="match to EST AW514948 (NID:g7153030) xv01a08.x1" FT /note="match to EST AL525469 (NID:g12788962)" FT /note="match to EST AL582320 (NID:g12950187)" FT /note="match to EST BG744979 (NID:g14055632)" FT /note="match to EST BM041737 (NID:g16771004)" FT /note="similar to Rattus norvegicus EST AW253829 FT (NID:g6597420)" FT /note="match to EST BG261135 (NID:g12770951)" FT /note="match to EST AA280070 (NID:g1921544) zs93e09.r1" FT /note="match to EST BI869396 (NID:g16043069)" FT /note="similar to Mus musculus EST AV308949 FT (NID:g16394120)" FT /note="match to EST BG324498 (NID:g13130935)" FT /note="match to EST BG576811 (NID:g13584464)" FT misc_feature 1746439..1746486 FT /note="match to EST AL522602 (NID:g12786095)" FT misc_feature 1746500..1746559 FT /note="match to EST AW516785 (NID:g7154951) xq04b09.x1" FT misc_feature 1746515..1746562 FT /note="match to EST AV761182 (NID:g10919030)" FT misc_feature 1746673..1746898 FT /note="match to EST AW338116 (NID:g6834742) xw66h12.x1" FT misc_feature 1746675..1746905 FT /note="match to EST AW410479 (NID:g6936020) fh06e02.y1" FT /note="match to EST AI436171 (NID:g4308318) th73c10.x1" FT misc_feature 1746675..1746896 FT /note="match to EST AW514948 (NID:g7153030) xv01a08.x1" FT misc_feature 1746675..1746869 FT /note="match to EST AL582320 (NID:g12950187)" FT misc_feature 1746675..1746825 FT /note="match to EST BG744979 (NID:g14055632)" FT misc_feature 1746675..1746842 FT /note="match to EST BM041737 (NID:g16771004)" FT misc_feature 1746675..1746865 FT /note="similar to Rattus norvegicus EST AW253829 FT (NID:g6597420)" FT misc_feature 1746675..1746900 FT /note="match to EST BG261135 (NID:g12770951)" FT misc_feature 1746675..1746862 FT /note="match to EST AL525469 (NID:g12788962)" FT /note="match to EST AA280070 (NID:g1921544) zs93e09.r1" FT misc_feature 1746675..1746901 FT /note="match to EST BI869396 (NID:g16043069)" FT misc_feature 1746675..1746860 FT /note="match to EST AW516785 (NID:g7154951) xq04b09.x1" FT /note="similar to Mus musculus EST AV308949 FT (NID:g16394120)" FT misc_feature 1746675..1746805 FT /note="match to EST BG324498 (NID:g13130935)" FT misc_feature 1746675..1746760 FT /note="match to EST BG576811 (NID:g13584464)" FT misc_feature 1746691..1746896 FT /note="match to EST F18009 (NID:g4837390)" FT misc_feature 1746742..1746900 FT /note="match to EST BE552327 (NID:g9794019) hy06b09.x1" FT repeat_region 1747157..1747191 FT /rpt_family="(T)n" FT repeat_region 1747162..1747359 FT /rpt_family="Alu" FT repeat_region 1749418..1749481 FT /rpt_family="MaLR" FT repeat_region 1749505..1749600 FT /rpt_family="MaLR" FT repeat_region 1750730..1750972 FT /rpt_family="C-rich" FT repeat_region 1751011..1751190 FT /rpt_family="C-rich" FT repeat_region 1752602..1752689 FT /rpt_family="L2" FT misc_feature 1753382..1753851 FT /note="match to EST BM145640 (NID:g17163842)" FT misc_feature 1754934..1755086 FT /note="match to EST BF954033 (NID:g12371308)" FT misc_feature 1754942 FT /note="match to EST AI436171 (NID:g4308318) th73c10.x1" FT misc_feature 1757045..1757056 FT /note="match to EST BM040833 (NID:g16770100)" FT misc_feature 1758763..1759198 FT /note="similar to EST BM194048 (NID:g17652733)" FT repeat_region 1759438..1759506 FT /rpt_family="C-rich" FT misc_feature 1761788..1762090 FT /note="similar to Homo sapiens EST BE149959 (NID:g8612680)" FT repeat_region 1763108..1763298 FT /rpt_family="(CCCA)n" FT repeat_region 1763167..1763300 FT /rpt_family="(CCCCG)n" FT repeat_region 1765216..1765238 FT /rpt_family="GC_rich" FT repeat_region 1765328..1765350 FT /rpt_family="GC_rich" FT repeat_region 1765547..1765569 FT /rpt_family="GC_rich" FT repeat_region 1765973..1766270 FT /rpt_family="Alu" FT misc_feature 1768564..1769792 FT /note="CpG_island (%GC=77.2, o/e=0.80, #CpGs=131)" FT repeat_region 1768839..1768896 FT /rpt_family="GC_rich" FT repeat_region 1769078..1769186 FT /rpt_family="C-rich" FT misc_feature 1769183..1769189 FT /note="match to EST BI598778 (NID:g15491717)" FT repeat_region 1769237..1769339 FT /rpt_family="GC_rich" FT repeat_region 1769442..1769517 FT /rpt_family="C-rich" FT misc_feature 1769510..1769515 FT /note="match to EST BI463028 (NID:g15253684)" FT repeat_region 1769639..1769731 FT /rpt_family="C-rich" FT repeat_region 1770028..1770161 FT /rpt_family="MIR" FT misc_feature 1771570..1771574 FT /note="match to EST BF954033 (NID:g12371308)" FT repeat_region 1776819..1776925 FT /rpt_family="Alu" FT repeat_region 1776926..1777215 FT /rpt_family="Alu" FT repeat_region 1777216..1777245 FT /rpt_family="Alu" FT misc_feature 1778005..1778418 FT /note="match to EST AA593324 (NID:g2409086) nn57d11.s1" FT repeat_region 1778202..1778314 FT /rpt_family="L2" FT misc_feature 1780625..1780630 FT /note="match to EST AA283654 (NID:g1927792) zt16g09.r1" FT repeat_region 1781557..1781671 FT /rpt_family="L2" FT repeat_region 1782289..1782405 FT /rpt_family="Alu" FT repeat_region 1783030..1783336 FT /rpt_family="Alu" FT repeat_region 1783309..1783337 FT /rpt_family="AT_rich" FT repeat_region 1783380..1783514 FT /rpt_family="Alu" FT repeat_region 1783515..1783812 FT /rpt_family="Alu" FT misc_feature 1783799..1783806 FT /note="match to EST BE552327 (NID:g9794019) hy06b09.x1" FT repeat_region 1783813..1783988 FT /rpt_family="Alu" FT repeat_region 1785192..1785265 FT /rpt_family="G-rich" FT repeat_region 1789272..1789342 FT /rpt_family="MIR" FT repeat_region 1789834..1790061 FT /rpt_family="MER121" FT repeat_region 1789838..1789858 FT /rpt_family="AT_rich" FT repeat_region 1790723..1790842 FT /rpt_family="Alu" FT repeat_region 1792291..1792720 FT /rpt_family="MaLR" FT repeat_region 1792846..1792965 FT /rpt_family="ERVL" FT misc_feature 1793131..1793140 FT /note="similar to Homo sapiens EST BE314328 (NID:g9135317)" FT repeat_region 1793329..1793621 FT /rpt_family="Alu" FT repeat_region 1793596..1793619 FT /rpt_family="(A)n" FT misc_feature 1794443..1797181 FT /note="CpG_island (%GC=76.3, o/e=0.90, #CpGs=359)" FT repeat_region 1794568..1794699 FT /rpt_family="L2" FT repeat_region 1794765..1794801 FT /rpt_family="GC_rich" FT repeat_region 1794850..1794880 FT /rpt_family="GC_rich" FT repeat_region 1794932..1794974 FT /rpt_family="(CGGGG)n" FT repeat_region 1795289..1795311 FT /rpt_family="GC_rich" FT repeat_region 1795367..1795491 FT /rpt_family="(CGGGG)n" FT repeat_region 1795568..1795612 FT /rpt_family="GC_rich" FT misc_feature 1795606..1795770 FT /note="match to EST AL119671 (NID:g5925570)" FT repeat_region 1795640..1795661 FT /rpt_family="GC_rich" FT misc_feature 1796010..1796015 FT /note="match to EST AL522602 (NID:g12786095)" FT misc_feature 1796582..1796947 FT /note="similar to Mus musculus EST BB871094 FT (NID:g17117304)" FT repeat_region 1796726..1796755 FT /rpt_family="GC_rich" FT repeat_region 1796779..1796804 FT /rpt_family="GC_rich" FT repeat_region 1797142..1797182 FT /rpt_family="GC_rich" FT repeat_region 1797945..1798035 FT /rpt_family="MIR" FT repeat_region 1800571..1800852 FT /rpt_family="MER1_type" FT misc_feature 1800978..1801258 FT /note="similar to Mus musculus EST AW457206 (NID:g7027423)" FT misc_feature 1800978..1801250 FT /note="similar to Mus musculus EST BI665779 FT (NID:g15580012)" FT misc_feature 1800981..1801014 FT /note="match to EST AL119671 (NID:g5925570)" FT misc_feature 1801100..1801250 FT /note="similar to Mus musculus EST AA118470 (NID:g1675498) FT mo38d01.r1" FT misc_feature 1801226..1801250 FT /note="match to EST R85021 (NID:g943427) yo40h08.r1" FT misc_feature 1801471..1801527 FT /note="similar to Mus musculus EST BI455791 FT (NID:g15246447)" FT misc_feature 1801474..1801539 FT /note="match to EST R85021 (NID:g943427) yo40h08.r1" FT misc_feature 1801474..1801527 FT /note="similar to Mus musculus EST AA118470 (NID:g1675498) FT mo38d01.r1" FT /note="similar to Mus musculus EST BI665779 FT (NID:g15580012)" FT misc_feature 1803094..1803263 FT /note="similar to Mus musculus EST BI455791 FT (NID:g15246447)" FT /note="match to EST R85021 (NID:g943427) yo40h08.r1" FT /note="similar to Mus musculus EST AA118470 (NID:g1675498) FT mo38d01.r1" FT /note="similar to Mus musculus EST BI665779 FT (NID:g15580012)" FT misc_feature 1803151..1803263 FT /note="similar to Mus musculus EST BE281650 (NID:g9156678)" FT misc_feature 1803171..1803263 FT /note="similar to Homo sapiens EST BI017994 FT (NID:g14422065)" FT misc_feature 1803346..1803470 FT /note="similar to Homo sapiens EST BF204629 FT (NID:g11098215)" FT misc_feature 1803347..1803384 FT /note="match to EST R85021 (NID:g943427) yo40h08.r1" FT misc_feature 1803347..1803463 FT /note="similar to Mus musculus EST AA118470 (NID:g1675498) FT mo38d01.r1" FT misc_feature 1803347..1803470 FT /note="similar to Mus musculus EST BE281650 (NID:g9156678)" FT /note="similar to Homo sapiens EST BI017994 FT (NID:g14422065)" FT /note="similar to Mus musculus EST BI455791 FT (NID:g15246447)" FT /note="similar to Mus musculus EST BI665779 FT (NID:g15580012)" FT misc_feature 1803356..1803470 FT /note="match to EST AL043614 (NID:g5423001)" FT misc_feature 1803362..1803470 FT /note="similar to Bos taurus EST BE478454 (NID:g9597987)" FT repeat_region 1803492..1803535 FT /rpt_family="G-rich" FT misc_feature 1803544..1803745 FT /note="similar to Mus musculus EST AA118470 (NID:g1675498) FT mo38d01.r1" FT misc_feature 1803562..1803609 FT /note="similar to Homo sapiens EST BI017994 FT (NID:g14422065)" FT misc_feature 1803562..1803692 FT /note="similar to Homo sapiens EST BF204629 FT (NID:g11098215)" FT misc_feature 1803562..1803752 FT /note="similar to Bos taurus EST BE478454 (NID:g9597987)" FT /note="match to EST AL043614 (NID:g5423001)" FT /note="similar to Mus musculus EST BE281650 (NID:g9156678)" FT /note="similar to Mus musculus EST BI455791 FT (NID:g15246447)" FT misc_feature 1804641..1804879 FT /note="match to EST AL043614 (NID:g5423001)" FT misc_feature 1804641..1804790 FT /note="similar to Mus musculus EST BE281650 (NID:g9156678)" FT misc_feature 1804662..1804846 FT /note="match to EST AW869335 (NID:g8003388)" FT misc_feature 1804670..1804790 FT /note="match to EST AW629787 (NID:g7376577) hh70h01.y1" FT misc_feature 1805408..1805563 FT /note="similar to Mus musculus EST BB316581 (NID:g9023616)" FT misc_feature 1805417..1805563 FT /note="similar to Rattus norvegicus EST BF522210 FT (NID:g11630177)" FT misc_feature 1805419..1805513 FT /note="similar to Bos taurus EST BE478454 (NID:g9597987)" FT misc_feature 1805419..1805561 FT /note="similar to Mus musculus EST BI455791 FT (NID:g15246447)" FT misc_feature 1805494..1805525 FT /note="similar to Homo sapiens EST BF204629 FT (NID:g11098215)" FT misc_feature 1806057..1806247 FT /note="similar to Rattus norvegicus EST BF522210 FT (NID:g11630177)" FT misc_feature 1806057..1806125 FT /note="similar to Mus musculus EST BB316581 (NID:g9023616)" FT misc_feature 1806126..1806247 FT /note="match to EST BF762956 (NID:g12110856)" FT misc_feature 1806181..1806247 FT /note="match to EST BI016570 (NID:g14420641)" FT misc_feature 1806542..1806696 FT /note="match to EST AL048843 (NID:g4728152)" FT misc_feature 1806548..1806696 FT /note="match to EST BI016570 (NID:g14420641)" FT /note="match to EST BF762956 (NID:g12110856)" FT misc_feature 1806551..1806588 FT /note="similar to Rattus norvegicus EST BF522210 FT (NID:g11630177)" FT misc_feature 1807066..1807203 FT /note="similar to Bos taurus EST BG692877 (NID:g13934697)" FT /note="similar to Bos taurus EST AV603101 (NID:g9725427)" FT misc_feature 1807082..1807203 FT /note="match to EST BI016570 (NID:g14420641)" FT /note="similar to Mus musculus EST BI854357 FT (NID:g15995104)" FT /note="match to EST AL048843 (NID:g4728152)" FT /note="match to EST BF762956 (NID:g12110856)" FT misc_feature 1807084..1807203 FT /note="similar to Mus musculus EST BI654665 FT (NID:g15568901)" FT misc_feature 1807115..1807203 FT /note="similar to EST BI991354 (NID:g17962375)" FT misc_feature 1807166..1807203 FT /note="match to EST BE466386 (NID:g9512248) hz21a08.x1" FT /note="match to EST BG291951 (NID:g13050273)" FT misc_feature 1807171..1807203 FT /note="similar to Mus musculus EST BG916058 FT (NID:g14296534)" FT misc_feature 1807278..1807396 FT /note="similar to Homo sapiens EST AW388675 (NID:g6893334)" FT misc_feature 1807281..1807396 FT /note="similar to Homo sapiens EST BE869674 FT (NID:g10318359)" FT /note="similar to Homo sapiens EST BI489689 FT (NID:g15328917)" FT /note="similar to Homo sapiens EST BI869774 FT (NID:g16043447)" FT misc_feature 1807284..1807396 FT /note="similar to Mus musculus EST BG974925 FT (NID:g14362562)" FT /note="similar to Mus musculus EST BG861716 FT (NID:g14212254)" FT misc_feature 1807286..1807377 FT /note="match to EST BE466386 (NID:g9512248) hz21a08.x1" FT misc_feature 1807286..1807357 FT /note="match to EST BI016570 (NID:g14420641)" FT misc_feature 1807286..1807396 FT /note="similar to Mus musculus EST BI654665 FT (NID:g15568901)" FT /note="similar to Mus musculus EST BI854357 FT (NID:g15995104)" FT /note="similar to EST BI991354 (NID:g17962375)" FT /note="similar to Mus musculus EST BG916058 FT (NID:g14296534)" FT /note="match to EST BG291951 (NID:g13050273)" FT /note="similar to Bos taurus EST BG692877 (NID:g13934697)" FT /note="similar to Bos taurus EST AV603101 (NID:g9725427)" FT /note="match to EST AL048843 (NID:g4728152)" FT misc_feature 1807286..1807349 FT /note="match to EST BF762956 (NID:g12110856)" FT misc_feature 1807288..1807396 FT /note="similar to Homo sapiens EST BI061627 FT (NID:g14469154)" FT misc_feature 1807303..1807396 FT /note="similar to Homo sapiens EST BG177791 FT (NID:g12684494)" FT misc_feature 1807307..1807396 FT /note="similar to Homo sapiens EST AU140272 FT (NID:g11001793)" FT /note="similar to Homo sapiens EST BF971242 FT (NID:g12338457)" FT /note="similar to Homo sapiens EST AU117120 FT (NID:g10932064)" FT misc_feature 1807314..1807396 FT /note="similar to Homo sapiens EST BE207666 (NID:g8751064) FT bb63c11.y1" FT misc_feature 1807340..1807377 FT /note="match to EST R84974 (NID:g943380) yo40h08.s1" FT misc_feature 1807342..1807396 FT /note="similar to Homo sapiens EST AL118906 (NID:g5924805)" FT misc_feature 1807475..1807667 FT /note="similar to Mus musculus EST BF579962 FT (NID:g11653674)" FT misc_feature 1807477..1807666 FT /note="similar to Mus musculus EST BG974925 FT (NID:g14362562)" FT misc_feature 1807477..1807519 FT /note="similar to Homo sapiens EST AW388675 (NID:g6893334)" FT misc_feature 1807477..1807527 FT /note="similar to Homo sapiens EST AL118906 (NID:g5924805)" FT /note="similar to Homo sapiens EST AU140272 FT (NID:g11001793)" FT /note="similar to Homo sapiens EST BF971242 FT (NID:g12338457)" FT /note="similar to Homo sapiens EST AU117120 FT (NID:g10932064)" FT misc_feature 1807477..1807537 FT /note="similar to Homo sapiens EST BE207666 (NID:g8751064) FT bb63c11.y1" FT /note="similar to Homo sapiens EST BG177791 FT (NID:g12684494)" FT /note="similar to Homo sapiens EST BI061627 FT (NID:g14469154)" FT /note="similar to Homo sapiens EST BE869674 FT (NID:g10318359)" FT /note="similar to Homo sapiens EST BI489689 FT (NID:g15328917)" FT misc_feature 1807477..1807667 FT /note="similar to Mus musculus EST BI654665 FT (NID:g15568901)" FT /note="similar to Mus musculus EST BI854357 FT (NID:g15995104)" FT /note="similar to EST BI991354 (NID:g17962375)" FT /note="similar to Mus musculus EST BG916058 FT (NID:g14296534)" FT /note="match to EST BG291951 (NID:g13050273)" FT /note="similar to Bos taurus EST BG692877 (NID:g13934697)" FT /note="similar to Bos taurus EST AV603101 (NID:g9725427)" FT /note="similar to Homo sapiens EST BI869774 FT (NID:g16043447)" FT misc_feature 1807477..1807569 FT /note="match to EST AL048843 (NID:g4728152)" FT misc_feature 1807482..1807667 FT /note="similar to Mus musculus EST BF134155 FT (NID:g10973195)" FT misc_feature 1807483..1807667 FT /note="similar to Bos taurus EST BE757540 (NID:g10171532)" FT misc_feature 1807494..1807667 FT /note="similar to Mus musculus EST BG916523 FT (NID:g14296999)" FT misc_feature 1807522..1807667 FT /note="similar to EST BM155137 (NID:g17237830) fw09b06.y1" FT repeat_region 1807532..1807554 FT /rpt_family="GC_rich" FT misc_feature 1807579..1807667 FT /note="similar to Homo sapiens EST BE744312 FT (NID:g10158304)" FT /note="similar to Homo sapiens EST BG420848 FT (NID:g13327354)" FT misc_feature 1807587..1807667 FT /note="similar to Homo sapiens EST AL118906 (NID:g5924805)" FT /note="similar to Homo sapiens EST AU140272 FT (NID:g11001793)" FT /note="similar to Homo sapiens EST BF971242 FT (NID:g12338457)" FT /note="similar to Homo sapiens EST AU117120 FT (NID:g10932064)" FT misc_feature 1807600..1807667 FT /note="similar to Homo sapiens EST BE409700 (NID:g9346150)" FT misc_feature 1807610..1807667 FT /note="similar to Homo sapiens EST BE207666 (NID:g8751064) FT bb63c11.y1" FT /note="similar to Homo sapiens EST BG177791 FT (NID:g12684494)" FT /note="similar to Homo sapiens EST BI061627 FT (NID:g14469154)" FT /note="similar to Homo sapiens EST BE869674 FT (NID:g10318359)" FT /note="similar to Homo sapiens EST BI489689 FT (NID:g15328917)" FT misc_feature 1807771..1807900 FT /note="similar to Homo sapiens EST BI061417 FT (NID:g14468944)" FT /note="similar to Homo sapiens EST AA446994 (NID:g2159659) FT zw90c01.r1" FT misc_feature 1807776..1807900 FT /note="similar to Mus musculus EST BG974925 FT (NID:g14362562)" FT /note="similar to Bos taurus EST AV666876 (NID:g9925906)" FT misc_feature 1807778..1807917 FT /note="similar to Mus musculus EST BF134155 FT (NID:g10973195)" FT misc_feature 1807778..1807864 FT /note="similar to Homo sapiens EST AL118906 (NID:g5924805)" FT misc_feature 1807778..1807900 FT /note="similar to Mus musculus EST BG916523 FT (NID:g14296999)" FT /note="similar to Homo sapiens EST BE409700 (NID:g9346150)" FT /note="similar to Mus musculus EST BI654665 FT (NID:g15568901)" FT /note="similar to EST BM155137 (NID:g17237830) fw09b06.y1" FT /note="similar to Homo sapiens EST BE744312 FT (NID:g10158304)" FT /note="similar to Homo sapiens EST BG420848 FT (NID:g13327354)" FT /note="similar to Bos taurus EST BE757540 (NID:g10171532)" FT /note="similar to Mus musculus EST BF579962 FT (NID:g11653674)" FT /note="similar to Homo sapiens EST BE207666 (NID:g8751064) FT bb63c11.y1" FT /note="similar to Homo sapiens EST BG177791 FT (NID:g12684494)" FT /note="similar to Homo sapiens EST AU140272 FT (NID:g11001793)" FT /note="similar to Homo sapiens EST BF971242 FT (NID:g12338457)" FT /note="similar to Homo sapiens EST BI061627 FT (NID:g14469154)" FT /note="similar to Mus musculus EST BI854357 FT (NID:g15995104)" FT /note="similar to EST BI991354 (NID:g17962375)" FT /note="similar to Mus musculus EST BG916058 FT (NID:g14296534)" FT /note="similar to Mus musculus EST BG861716 FT (NID:g14212254)" FT /note="match to EST BG291951 (NID:g13050273)" FT misc_feature 1807778..1807835 FT /note="similar to Bos taurus EST BG692877 (NID:g13934697)" FT misc_feature 1807778..1807857 FT /note="similar to Homo sapiens EST AU117120 FT (NID:g10932064)" FT misc_feature 1807778..1807862 FT /note="similar to Homo sapiens EST BE869674 FT (NID:g10318359)" FT misc_feature 1807778..1807851 FT /note="similar to Homo sapiens EST BI489689 FT (NID:g15328917)" FT misc_feature 1807778..1807871 FT /note="similar to Homo sapiens EST BI869774 FT (NID:g16043447)" FT misc_feature 1807814..1807860 FT /note="similar to Homo sapiens EST AV688439 FT (NID:g10290302)" FT misc_feature 1807831..1807900 FT /note="match to EST BF724771 (NID:g12040682) bx08e05.y1" FT misc_feature 1807984..1808056 FT /note="similar to Homo sapiens EST BE207666 (NID:g8751064) FT bb63c11.y1" FT /note="similar to EST BI991354 (NID:g17962375)" FT misc_feature 1807984..1808054 FT /note="similar to Homo sapiens EST BI061417 FT (NID:g14468944)" FT /note="similar to Mus musculus EST BG974925 FT (NID:g14362562)" FT /note="similar to Mus musculus EST BG916523 FT (NID:g14296999)" FT /note="similar to Homo sapiens EST BE409700 (NID:g9346150)" FT /note="similar to Mus musculus EST BI654665 FT (NID:g15568901)" FT /note="match to EST BF724771 (NID:g12040682) bx08e05.y1" FT /note="similar to Bos taurus EST AV666876 (NID:g9925906)" FT /note="similar to Homo sapiens EST AA446994 (NID:g2159659) FT zw90c01.r1" FT /note="similar to EST BM155137 (NID:g17237830) fw09b06.y1" FT /note="similar to Homo sapiens EST BE744312 FT (NID:g10158304)" FT /note="similar to Homo sapiens EST BG420848 FT (NID:g13327354)" FT /note="similar to Bos taurus EST BE757540 (NID:g10171532)" FT /note="similar to Mus musculus EST BF579962 FT (NID:g11653674)" FT /note="similar to Homo sapiens EST BG177791 FT (NID:g12684494)" FT /note="similar to Homo sapiens EST AU140272 FT (NID:g11001793)" FT /note="similar to Homo sapiens EST BF971242 FT (NID:g12338457)" FT /note="similar to Homo sapiens EST BI061627 FT (NID:g14469154)" FT /note="similar to Mus musculus EST BI854357 FT (NID:g15995104)" FT /note="similar to Mus musculus EST BG916058 FT (NID:g14296534)" FT /note="similar to Mus musculus EST BG861716 FT (NID:g14212254)" FT /note="match to EST BG291951 (NID:g13050273)" FT misc_feature 1807984..1808020 FT /note="similar to Homo sapiens EST BI489689 FT (NID:g15328917)" FT misc_feature 1807996..1808038 FT /note="similar to Homo sapiens EST BE869674 FT (NID:g10318359)" FT misc_feature 1808002..1808054 FT /note="similar to Mus musculus EST BF134155 FT (NID:g10973195)" FT misc_feature 1808273..1808370 FT /note="similar to Homo sapiens EST BI061417 FT (NID:g14468944)" FT /note="similar to Homo sapiens EST BE409700 (NID:g9346150)" FT misc_feature 1808273..1808412 FT /note="similar to Mus musculus EST BF134155 FT (NID:g10973195)" FT misc_feature 1808273..1808369 FT /note="similar to Homo sapiens EST BG177791 FT (NID:g12684494)" FT misc_feature 1808273..1808401 FT /note="similar to Homo sapiens EST AU140272 FT (NID:g11001793)" FT misc_feature 1808273..1808407 FT /note="similar to Homo sapiens EST BF971242 FT (NID:g12338457)" FT misc_feature 1808273..1808323 FT /note="similar to Homo sapiens EST BI061627 FT (NID:g14469154)" FT misc_feature 1808273..1808390 FT /note="similar to Homo sapiens EST AA446994 (NID:g2159659) FT zw90c01.r1" FT /note="similar to Mus musculus EST BI854357 FT (NID:g15995104)" FT misc_feature 1808273..1808410 FT /note="similar to Mus musculus EST BG974925 FT (NID:g14362562)" FT /note="similar to Mus musculus EST BG916523 FT (NID:g14296999)" FT /note="match to EST BF724771 (NID:g12040682) bx08e05.y1" FT /note="similar to Bos taurus EST AV666876 (NID:g9925906)" FT /note="similar to EST BM155137 (NID:g17237830) fw09b06.y1" FT /note="similar to Homo sapiens EST BE744312 FT (NID:g10158304)" FT /note="similar to Homo sapiens EST BG420848 FT (NID:g13327354)" FT /note="similar to Bos taurus EST BE757540 (NID:g10171532)" FT /note="similar to Mus musculus EST BF579962 FT (NID:g11653674)" FT /note="similar to Mus musculus EST BG916058 FT (NID:g14296534)" FT /note="similar to Mus musculus EST BG861716 FT (NID:g14212254)" FT misc_feature 1808273..1808395 FT /note="match to EST BG291951 (NID:g13050273)" FT misc_feature 1808274..1808410 FT /note="similar to Homo sapiens EST AI762110 (NID:g5177777) FT wi53g09.x1" FT /note="similar to Homo sapiens EST BG011715 FT (NID:g12460193)" FT /note="similar to Bos taurus EST BF776700 (NID:g12124600)" FT /note="similar to Homo sapiens EST AU117825 FT (NID:g10932824)" FT /note="similar to Homo sapiens EST BE938297 FT (NID:g10465484)" FT misc_feature 1808274..1808369 FT /note="similar to Homo sapiens EST AV688439 FT (NID:g10290302)" FT misc_feature 1808307..1808410 FT /note="similar to Homo sapiens EST BF876752 FT (NID:g12266882)" FT misc_feature 1808480..1808483 FT /note="similar to Homo sapiens EST BI061417 FT (NID:g14468944)" FT /note="similar to Homo sapiens EST BE409700 (NID:g9346150)" FT /note="similar to Homo sapiens EST AV688439 FT (NID:g10290302)" FT /note="similar to Homo sapiens EST BG177791 FT (NID:g12684494)" FT misc_feature 1808556..1808637 FT /note="similar to Bos taurus EST BF776700 (NID:g12124600)" FT misc_feature 1808556..1808677 FT /note="similar to Bos taurus EST AV666876 (NID:g9925906)" FT misc_feature 1808556..1808628 FT /note="similar to EST BM155137 (NID:g17237830) fw09b06.y1" FT misc_feature 1808556..1808661 FT /note="similar to Homo sapiens EST AI762110 (NID:g5177777) FT wi53g09.x1" FT /note="similar to Homo sapiens EST BG011715 FT (NID:g12460193)" FT /note="similar to Mus musculus EST BG916523 FT (NID:g14296999)" FT /note="similar to Homo sapiens EST BF876752 FT (NID:g12266882)" FT /note="similar to Homo sapiens EST AU117825 FT (NID:g10932824)" FT /note="match to EST BF724771 (NID:g12040682) bx08e05.y1" FT /note="similar to Homo sapiens EST BE744312 FT (NID:g10158304)" FT misc_feature 1808556..1808640 FT /note="similar to Homo sapiens EST BE938297 FT (NID:g10465484)" FT /note="similar to Homo sapiens EST BG420848 FT (NID:g13327354)" FT misc_feature 1808556..1808642 FT /note="similar to Mus musculus EST BF579962 FT (NID:g11653674)" FT misc_feature 1808556..1808633 FT /note="similar to Mus musculus EST BG916058 FT (NID:g14296534)" FT misc_feature 1808556..1808656 FT /note="similar to Mus musculus EST BG974925 FT (NID:g14362562)" FT /note="similar to Mus musculus EST BG861716 FT (NID:g14212254)" FT misc_feature 1808572..1808636 FT /note="similar to Homo sapiens EST BE409700 (NID:g9346150)" FT misc_feature 1808572..1808642 FT /note="similar to Homo sapiens EST BI061417 FT (NID:g14468944)" FT /note="similar to Homo sapiens EST AV688439 FT (NID:g10290302)" FT misc_feature 1808572..1808637 FT /note="similar to Homo sapiens EST BG177791 FT (NID:g12684494)" FT misc_feature 1808579..1808661 FT /note="match to EST BF525389 (NID:g11612750)" FT misc_feature 1808583..1808661 FT /note="match to EST BE612413 (NID:g9894010)" FT misc_feature 1808720..1808740 FT /note="similar to Homo sapiens EST AA446994 (NID:g2159659) FT zw90c01.r1" FT misc_feature 1808818..1808968 FT /note="similar to Bos taurus EST BF776700 (NID:g12124600)" FT misc_feature 1808840..1809465 FT /note="similar to Homo sapiens EST BG675640 FT (NID:g13907036)" FT misc_feature 1808840..1808934 FT /note="similar to Homo sapiens EST AI762110 (NID:g5177777) FT wi53g09.x1" FT /note="similar to Homo sapiens EST BG011715 FT (NID:g12460193)" FT /note="similar to Homo sapiens EST AU117825 FT (NID:g10932824)" FT /note="similar to Homo sapiens EST BE744312 FT (NID:g10158304)" FT misc_feature 1808840..1808866 FT /note="similar to Homo sapiens EST AU140272 FT (NID:g11001793)" FT misc_feature 1808843..1808952 FT /note="similar to Mus musculus EST BG916523 FT (NID:g14296999)" FT misc_feature 1808843..1809266 FT /note="match to EST BE612413 (NID:g9894010)" FT misc_feature 1808843..1809490 FT /note="match to EST BF525389 (NID:g11612750)" FT misc_feature 1808843..1808870 FT /note="similar to Homo sapiens EST BF876752 FT (NID:g12266882)" FT misc_feature 1808843..1808988 FT /note="match to EST BF724771 (NID:g12040682) bx08e05.y1" FT misc_feature 1808934..1809418 FT /note="match to EST BE394778 (NID:g9340143)" FT misc_feature 1809059..1809817 FT /note="match to EST BF982561 (NID:g12385373)" FT repeat_region 1809111..1809146 FT /rpt_family="(TG)n" FT misc_feature 1809371..1809728 FT /note="match to EST T29091 (NID:g611189)" FT misc_feature 1809378..1809708 FT /note="similar to EST BM288840 (NID:g17997866)" FT misc_feature 1809396..1809519 FT /note="match to EST BE612413 (NID:g9894010)" FT misc_feature 1809465..1810280 FT /note="match to EST BG679350 (NID:g13910747)" FT misc_feature 1809499..1810092 FT /note="similar to Bos taurus EST AV598707 (NID:g9717452)" FT misc_feature 1809543..1809953 FT /note="match to EST AI369615 (NID:g4148368) qy70g10.x1" FT misc_feature 1809619..1810521 FT /note="match to EST BG740982 (NID:g14051635)" FT repeat_region 1809621..1809650 FT /rpt_family="(TA)n" FT misc_feature 1809772..1810132 FT /note="similar to Homo sapiens EST N91660 (NID:g1263969) FT za21a03.r1" FT misc_feature 1809811..1810304 FT /note="match to EST AA253505 (NID:g1885680) zr77c05.r1" FT misc_feature 1809818..1810310 FT /note="similar to Bos taurus EST BE809520 (NID:g10240632)" FT misc_feature 1809842..1810595 FT /note="match to EST AI057095 (NID:g3330971) oz23f02.x1" FT misc_feature 1809860..1810007 FT /note="match to EST H74055 (NID:g1047191) ys13f03.r1" FT misc_feature 1809965..1810180 FT /note="match to EST BI036099 (NID:g14442725)" FT misc_feature 1809975..1810535 FT /note="similar to Sus scrofa EST BI404544 (NID:g15183757)" FT misc_feature 1810047..1810591 FT /note="match to EST AI332806 (NID:g4069365) qp98d03.x1" FT misc_feature 1810069..1810184 FT /note="match to EST BF089691 (NID:g10895401)" FT misc_feature 1810088..1810565 FT /note="match to EST AA928957 (NID:g3078314) oo31f10.s1" FT misc_feature 1810212..1810543 FT /note="similar to Homo sapiens EST BE613079 (NID:g9894676)" FT misc_feature 1810229..1810552 FT /note="match to EST BF089691 (NID:g10895401)" FT misc_feature 1810234..1810592 FT /note="match to EST BE466386 (NID:g9512248) hz21a08.x1" FT misc_feature 1810234..1810569 FT /note="match to EST R84974 (NID:g943380) yo40h08.s1" FT misc_feature 1810257..1810594 FT /note="match to EST N68644 (NID:g1224805) za21a03.s1" FT repeat_region 1810260..1810288 FT /rpt_family="AT_rich" FT misc_feature 1810459..1810592 FT /note="match to EST AA587307 (NID:g2398121) nn74g03.s1" FT misc_feature 1810459..1810594 FT /note="match to EST BE541194 (NID:g9769839)" FT repeat_region 1811243..1811412 FT /rpt_family="CT-rich" FT repeat_region 1813536..1813663 FT /rpt_family="Alu" FT repeat_region 1813664..1813942 FT /rpt_family="Alu" FT repeat_region 1813943..1814117 FT /rpt_family="Alu" FT repeat_region 1816172..1816221 FT /rpt_family="(TTCTCC)n" FT repeat_region 1818691..1818998 FT /rpt_family="Alu" FT repeat_region 1819002..1819304 FT /rpt_family="Alu" FT repeat_region 1819507..1819807 FT /rpt_family="Alu" FT repeat_region 1820059..1820369 FT /rpt_family="Alu" FT repeat_region 1820528..1820827 FT /rpt_family="Alu" FT repeat_region 1821471..1821664 FT /rpt_family="L1" FT repeat_region 1821665..1821961 FT /rpt_family="Alu" FT repeat_region 1821962..1821981 FT /rpt_family="L1" FT repeat_region 1821964..1822058 FT /rpt_family="L1" FT repeat_region 1822127..1822468 FT /rpt_family="L1" FT repeat_region 1822469..1822761 FT /rpt_family="Alu" FT repeat_region 1822762..1822840 FT /rpt_family="L1" FT repeat_region 1822851..1823118 FT /rpt_family="Alu" FT repeat_region 1823134..1823388 FT /rpt_family="Alu" FT repeat_region 1825768..1826061 FT /rpt_family="Alu" FT repeat_region 1828821..1829008 FT /rpt_family="L1" FT repeat_region 1829009..1830002 FT /rpt_family="SVA" FT misc_feature 1829589..1831117 FT /note="CpG_island (%GC=81.8, o/e=0.80, #CpGs=133)" FT repeat_region 1830016..1830591 FT /rpt_family="SVA" FT repeat_region 1830605..1831140 FT /rpt_family="SVA" FT repeat_region 1831146..1831259 FT /rpt_family="L1" FT repeat_region 1831260..1831569 FT /rpt_family="Alu" FT repeat_region 1831570..1832042 FT /rpt_family="L1" FT repeat_region 1832043..1832360 FT /rpt_family="Alu" FT repeat_region 1832361..1832575 FT /rpt_family="L1" FT repeat_region 1832992..1833341 FT /rpt_family="L1" FT repeat_region 1833349..1833436 FT /rpt_family="L1" FT repeat_region 1833746..1834040 FT /rpt_family="Alu" FT repeat_region 1834202..1834325 FT /rpt_family="L1" FT repeat_region 1834366..1834421 FT /rpt_family="L1" FT repeat_region 1834795..1835054 FT /rpt_family="Alu" FT repeat_region 1835824..1835916 FT /rpt_family="MER1_type" FT repeat_region 1836890..1837225 FT /rpt_family="Alu" FT repeat_region 1837526..1837794 FT /rpt_family="Alu" FT repeat_region 1837801..1837991 FT /rpt_family="Alu" FT repeat_region 1839107..1839321 FT /rpt_family="L1" FT repeat_region 1839304..1839414 FT /rpt_family="L1" FT repeat_region 1839427..1839731 FT /rpt_family="Alu" FT repeat_region 1839816..1840124 FT /rpt_family="Alu" FT repeat_region 1840150..1840427 FT /rpt_family="Alu" FT repeat_region 1840687..1840893 FT /rpt_family="L1" FT repeat_region 1841311..1841505 FT /rpt_family="ERV1" FT repeat_region 1841506..1841747 FT /rpt_family="ERV1" FT repeat_region 1841748..1841802 FT /rpt_family="L1" FT repeat_region 1841803..1841822 FT /rpt_family="ERV1" FT repeat_region 1841823..1842112 FT /rpt_family="Alu" FT repeat_region 1842113..1842446 FT /rpt_family="Alu" FT repeat_region 1842447..1842695 FT /rpt_family="ERV1" FT repeat_region 1842795..1843040 FT /rpt_family="Alu" FT repeat_region 1844817..1844918 FT /rpt_family="MIR" FT repeat_region 1846177..1846483 FT /rpt_family="Alu" FT repeat_region 1846494..1846625 FT /rpt_family="Alu" FT repeat_region 1846637..1846914 FT /rpt_family="Alu" FT repeat_region 1847064..1847186 FT /rpt_family="Alu" FT repeat_region 1847263..1847570 FT /rpt_family="Alu" FT repeat_region 1847589..1847883 FT /rpt_family="Alu" FT repeat_region 1848027..1848291 FT /rpt_family="Alu" FT repeat_region 1848776..1849087 FT /rpt_family="Alu" FT repeat_region 1849265..1849575 FT /rpt_family="Alu" FT repeat_region 1849576..1849751 FT /rpt_family="Alu" FT repeat_region 1849754..1849849 FT /rpt_family="MER2_type" FT repeat_region 1849850..1849993 FT /rpt_family="Alu" FT repeat_region 1849994..1850293 FT /rpt_family="Alu" FT repeat_region 1850294..1850472 FT /rpt_family="Alu" FT repeat_region 1850473..1850519 FT /rpt_family="MER2_type" FT repeat_region 1850995..1851294 FT /rpt_family="Alu" FT repeat_region 1851321..1851574 FT /rpt_family="Alu" FT repeat_region 1851602..1851897 FT /rpt_family="Alu" FT repeat_region 1852248..1852395 FT /rpt_family="Alu" FT repeat_region 1852410..1852664 FT /rpt_family="Alu" FT repeat_region 1853798..1854333 FT /rpt_family="ERV1" FT repeat_region 1854375..1854595 FT /rpt_family="Alu" FT repeat_region 1854598..1854683 FT /rpt_family="ERV1" FT repeat_region 1854786..1854918 FT /rpt_family="L2" FT repeat_region 1855013..1855508 FT /rpt_family="L1" FT repeat_region 1855927..1856224 FT /rpt_family="Alu" FT repeat_region 1856239..1856518 FT /rpt_family="Alu" FT repeat_region 1856523..1856549 FT /rpt_family="(CAAA)n" FT repeat_region 1856638..1856879 FT /rpt_family="Alu" FT misc_feature 1857066..1858887 FT /note="CpG_island (%GC=73.3, o/e=0.90, #CpGs=218)" FT repeat_region 1857616..1857652 FT /rpt_family="GC_rich" FT repeat_region 1857874..1857902 FT /rpt_family="GC_rich" FT repeat_region 1860274..1860563 FT /rpt_family="Alu" FT repeat_region 1861086..1861427 FT /rpt_family="L2" FT repeat_region 1861585..1861904 FT /rpt_family="Alu" FT repeat_region 1861948..1862243 FT /rpt_family="Alu" FT repeat_region 1862245..1862384 FT /rpt_family="L1" FT repeat_region 1862385..1862424 FT /rpt_family="(TA)n" FT repeat_region 1862425..1862698 FT /rpt_family="Alu" FT repeat_region 1862699..1862798 FT /rpt_family="MaLR" FT repeat_region 1863226..1863249 FT /rpt_family="(TTTTC)n" FT repeat_region 1863250..1863344 FT /rpt_family="L1" FT repeat_region 1863347..1863645 FT /rpt_family="Alu" FT repeat_region 1863669..1863853 FT /rpt_family="L1" FT repeat_region 1864680..1864955 FT /rpt_family="Alu" FT repeat_region 1864969..1865291 FT /rpt_family="MaLR" FT repeat_region 1866787..1867094 FT /rpt_family="Alu" FT repeat_region 1868663..1869030 FT /rpt_family="MaLR" FT repeat_region 1869057..1869358 FT /rpt_family="Alu" FT repeat_region 1869359..1869759 FT /rpt_family="L1" FT repeat_region 1869760..1869825 FT /rpt_family="MaLR" FT repeat_region 1869826..1870142 FT /rpt_family="Alu" FT repeat_region 1870143..1870299 FT /rpt_family="MaLR" FT repeat_region 1870300..1870397 FT /rpt_family="Alu" FT repeat_region 1870404..1870490 FT /rpt_family="L1" FT repeat_region 1870495..1870768 FT /rpt_family="Alu" FT repeat_region 1870781..1871064 FT /rpt_family="7SLRNA" FT repeat_region 1871073..1871377 FT /rpt_family="Alu" FT repeat_region 1871396..1871534 FT /rpt_family="Alu" FT repeat_region 1871543..1871799 FT /rpt_family="L1" FT repeat_region 1871996..1872153 FT /rpt_family="ERV1" FT misc_feature 1872102..1873986 FT /note="CpG_island (%GC=80.1, o/e=0.90, #CpGs=288)" FT repeat_region 1872678..1872747 FT /rpt_family="GC_rich" FT repeat_region 1872786..1872831 FT /rpt_family="GC_rich" FT repeat_region 1872885..1872970 FT /rpt_family="(CCCG)n" FT repeat_region 1873062..1873096 FT /rpt_family="(CGG)n" FT repeat_region 1873103..1873132 FT /rpt_family="GC_rich" FT repeat_region 1873153..1873234 FT /rpt_family="C-rich" FT repeat_region 1873508..1873675 FT /rpt_family="(CCGGG)n" FT repeat_region 1873721..1873749 FT /rpt_family="GC_rich" FT repeat_region 1873770..1873790 FT /rpt_family="GC_rich" FT repeat_region 1874292..1874319 FT /rpt_family="(TG)n" FT repeat_region 1874319..1874363 FT /rpt_family="(GA)n" FT repeat_region 1875581..1875739 FT /rpt_family="Alu" FT repeat_region 1876699..1876985 FT /rpt_family="Alu" FT repeat_region 1877001..1877263 FT /rpt_family="Alu" FT repeat_region 1877348..1877645 FT /rpt_family="Alu" FT repeat_region 1877661..1877953 FT /rpt_family="Alu" FT repeat_region 1878141..1878425 FT /rpt_family="Alu" FT repeat_region 1878591..1878879 FT /rpt_family="Alu" FT repeat_region 1879371..1879597 FT /rpt_family="L2" FT repeat_region 1879651..1879778 FT /rpt_family="Alu" FT repeat_region 1879802..1879953 FT /rpt_family="Alu" FT repeat_region 1879954..1879979 FT /rpt_family="(TA)n" FT repeat_region 1879980..1880134 FT /rpt_family="Alu" FT misc_feature complement(1880226..2071669) FT /note="annotated region of clone" FT polyA_site 2070816 FT polyA_signal 2070795..2070800 FT CDS join(2062853..2062889,2065487..2065854) FT /locus_tag="RP11-262P20.4-001" FT /standard_name="OTTHUMP00000149962" FT /product="novel protein" FT /protein_id="CAM15218.1" FT /translation="MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRM FT SVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDH FT YVLPGMTLSLAERLFFQVRYHRYRLQLREE" FT mRNA join(2061539..2061614,2062725..2062889,2065487..2070816) FT /locus_tag="RP11-262P20.4-001" FT /product="novel protein" FT /note="match: ESTs: Em:AI565540.1" FT /note="match: cDNAs: Em:AK094797.1" FT polyA_site 2045697 FT polyA_site 2045695 FT polyA_site 2045691 FT polyA_signal 2045674..2045679 FT CDS join(2044079..2044211,2044463..2044551,2045588..2045653) FT /locus_tag="RP11-262P20.5-002" FT /standard_name="OTTHUMP00000205823" FT /product="novel protein" FT /protein_id="CAX14864.1" FT /translation="MAPPPACRSPMSPPPPPLLLLLLSLALLGARARAEPAGSAVPAQS FT RPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWPAGH" FT mRNA join(2043777..2043902,2044054..2044211,2044463..2044551, FT 2045588..2045691) FT /locus_tag="RP11-262P20.5-002" FT /product="novel protein" FT /note="match: cDNAs: Em:BC062790.1" FT mRNA join(2043720..2043795,2044054..2044211,2044463..2044551, FT 2045588..2045695) FT /locus_tag="RP11-262P20.5-001" FT /product="novel protein" FT /note="match: cDNAs: Em:BC038466.1 Em:BC062790.1 FT Em:BC126819.1" FT /note="match: ESTs: Em:AI768042.1 Em:AW157771.1 FT Em:AW160730.1 Em:BG779872.1 Em:BI964108.1 Em:BQ129383.1" FT CDS join(2043722..2043795,2044054..2044211,2044463..2044551, FT 2045588..2045653) FT /locus_tag="RP11-262P20.5-001" FT /standard_name="OTTHUMP00000205822" FT /product="novel protein" FT /protein_id="CAX14865.1" FT /translation="MRVARRTRNVCRCPRAAGPGVPEPRAAPLPLLAMAPPPACRSPMS FT PPPPPLLLLLLSLALLGARARAEPAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTACSL FT DARTETLLLQAERRALCACWPAGH" FT mRNA complement(join(1984450..1985230,1985323..1985422, FT 1985575..1985840,1986535..1986646,1987503..1987591, FT 1987841..1987910,1987999..1988129,1989645..1989734, FT 1991435..1991596,1993271..1993442,2010477..2011837)) FT /gene="WHSC2" FT /locus_tag="RP11-262P20.2-001" FT /product="Wolf-Hirschhorn syndrome candidate 2" FT /note="match: cDNAs: Em:AB044549.1 Em:AK001304.1 FT Em:AK126056.1 Em:BC002764.2" FT CDS complement(join(1985046..1985230,1985323..1985422, FT 1985575..1985840,1986535..1986646,1987503..1987591, FT 1987841..1987910,1987999..1988129,1989645..1989734, FT 1991435..1991596,1993271..1993442,2010477..2010719)) FT /gene="WHSC2" FT /locus_tag="RP11-262P20.2-001" FT /standard_name="OTTHUMP00000114626" FT /product="Wolf-Hirschhorn syndrome candidate 2" FT /note="match: proteins: Sw:Q8BG30 Sw:Q9H3P2" FT /protein_id="CAM15219.1" FT /translation="MPGQRRALSPKMASMRESDTGLWLHNKLGATDELWAPPSIASLLT FT AAVIDNIRLCFHGLSSAVKLKLLLGTLHLPRRTVDEMKGALMEIIQLASLDSDPWVLMV FT ADILKSFPDTGSLNLELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTL FT AGPLTPPVKHFQLKRKPKSATLRAELLQKSTETAQQLKRSAGVPFHAKGRGLLRKMDTT FT TPLKGIPKQAPFRSPTAPSVFSPTGNRTPIPPSRTLLRKERGVKLLDISELDMVGAGRE FT AKRRRKTLDAEVVEKPAKEETVVENATPDYAAGLVSTQKLGSLNNEPALPSTSYLPSTP FT SVVPASSYIPSSETPPAPSSREASRPPEEPSAPSPTLPAQFKQRAPMYNSGLSPATPTP FT AAPTSPLTPTTPPAVAPTTQTPPVAMVAPQTQAPAQQQPKKNLSLTREQMFAAQEMFKT FT ANKVTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTEDLPKADGQGSTTMLVDTVF FT EMNYATGQWTRFKKYKPMTNVS" FT polyA_signal complement(1984470..1984475) FT polyA_site complement(1984450) FT polyA_site 1983934 FT polyA_site 1983919 FT polyA_signal 1983900..1983905 FT polyA_site 1981523 FT CDS join(1954870..1955251,1956888..1957067,1957420..1957576, FT 1957710..1957915,1959660..1959763,1961198..1961467, FT 1962762..1962878,1976590..1976731,1977021..1977127, FT 1978202..1978406,1980365..1980636) FT /gene="WHSC1" FT /locus_tag="RP11-262P20.3-005" FT /standard_name="OTTHUMP00000159147" FT /product="Wolf-Hirschhorn syndrome candidate 1" FT /note="match: proteins: Sw:O96028-2.1 Sw:Q8BVE8.2 FT Tr:A2A2T2.1 Tr:Q9UPR2" FT /protein_id="CAM15220.1" FT /translation="MAGSFCWRMLGLVSKVGNRARCFSSMAASEEELLDFSGSELQFNS FT CSLHLSLHPFFNFLLGIHSCFVCKESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRG FT FRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTA FT HFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRA FT GKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQ FT ARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARETQESERKPPPYK FT HIKVNKPYGKVQIYTADISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGEF FT CQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAH FT ENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDI FT PAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTTLSSEEKGKKTKKKTRRR FT RAKGEGKRQSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKRPFGKWECPWHHCDV FT CGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGRSYCCEHDLGAASVRSTKTEKPPPEPG FT KPKGKRRRRRGWRRVTEGK" FT mRNA join(1953835..1953958,1954479..1955251,1956888..1957067, FT 1957420..1957576,1957710..1957915,1959660..1959763, FT 1961198..1961467,1962762..1962878,1976590..1976731, FT 1977021..1977127,1978202..1978406,1980365..1980642) FT /gene="WHSC1" FT /locus_tag="RP11-262P20.3-005" FT /product="Wolf-Hirschhorn syndrome candidate 1" FT /note="match: cDNAs: Em:AB029013.1" FT /note="match: ESTs: Em:BF313809.1" FT misc_feature complement(1951466) FT /note="Clone_right_end: RP11-317B7" FT polyA_site 1950546 FT polyA_signal 1950520..1950525 FT polyA_site 1943471 FT polyA_signal 1943448..1943453 FT mRNA join(1941011..1941505,1944066..1944292,1952799..1952930, FT 1953835..1953958,1955051..1955251,1956888..1957067, FT 1957420..1957576,1957710..1957915,1959660..1959763, FT 1961198..1961467,1962762..1962878,1976590..1976731, FT 1977021..1977127,1978202..1978406,1980365..1981523) FT /gene="WHSC1" FT /locus_tag="RP11-262P20.3-003" FT /product="Wolf-Hirschhorn syndrome candidate 1" FT /note="match: cDNAs: Em:AF330040.1" FT CDS join(1902382..1902978,1905943..1906105,1918598..1918764, FT 1919868..1920350,1932353..1932497,1936871..1936989, FT 1940178..1940259,1941381..1941505,1952799..1952930, FT 1953835..1953958,1955051..1955251,1956888..1957067, FT 1957420..1957576,1957710..1957915,1959660..1959763, FT 1961198..1961467,1962762..1962878,1976590..1976731, FT 1977021..1977127,1978202..1978406,1980365..1980636) FT /gene="WHSC1" FT /locus_tag="RP11-262P20.3-001" FT /standard_name="OTTHUMP00000149955" FT /product="Wolf-Hirschhorn syndrome candidate 1" FT /note="match: proteins: Sw:O96028.1 Tr:O96028" FT /protein_id="CAM15221.1" FT /translation="MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECS FT VFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQE FT MKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPEN FT KARRNRKRSIKYDSLLEQGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNV FT GDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSL FT VAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEER FT KAKFTFLYVGDQLHLNPQVAKEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKR FT RRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPRSRKGDAAS FT QFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEED FT SGNVNGKKRNHTKRIQDPTEDAEAEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAME FT AASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSDSPGDE FT PSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLAC FT LGLSRRPEGRFTCSECASGIHSCFVCKESKTDVKRCVVTQCGKFYHEACVKKYPLTVFE FT SRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSII FT CTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCND FT CRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYW FT THQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARETQESERKPP FT PYKHIKVNKPYGKVQIYTADISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPA FT GEFCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIK FT HAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAV FT CDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTTLSSEEKGKKTKKKT FT RRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKRPFGKWECPWHH FT CDVCGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGRSYCCEHDLGAASVRSTKTEKPPP FT EPGKPKGKRRRRRGWRRVTEGK" FT mRNA join(1902353..1902978,1905943..1906105,1918598..1918764, FT 1919868..1920350,1932353..1932497,1936871..1936989, FT 1940178..1940259,1941381..1941505,1944066..1950545) FT /gene="WHSC1" FT /locus_tag="RP11-262P20.3-004" FT /product="Wolf-Hirschhorn syndrome candidate 1" FT /note="match: cDNAs: Em:AF071594.1 Em:BC070176.1" FT /note="match: ESTs: Em:AI802986.1 Em:AW058352.1 FT Em:BM676862.1" FT CDS join(1902382..1902978,1905943..1906105,1918598..1918764, FT 1919868..1920350,1932353..1932497,1936871..1936989, FT 1940178..1940259,1941381..1941505,1944066..1944128) FT /gene="WHSC1" FT /locus_tag="RP11-262P20.3-004" FT /standard_name="OTTHUMP00000159146" FT /product="Wolf-Hirschhorn syndrome candidate 1" FT /note="match: proteins: Tr:O96031 Tr:Q6IS00" FT /protein_id="CAM15222.1" FT /translation="MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECS FT VFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQE FT MKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPEN FT KARRNRKRSIKYDSLLEQGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNV FT GDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSL FT VAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEER FT KAKFTFLYVGDQLHLNPQVAKEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKR FT RRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPRSRKGDAAS FT QFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEED FT SGNVNGKKRNHTKRIQDPTEDAEAEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAME FT AASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENELLWEPTPV FT KLDLNPAALYCT" FT mRNA join(1893891..1894618,1902353..1902978,1905943..1906105, FT 1918598..1918764,1919868..1920350,1932353..1932497, FT 1936871..1936989,1940178..1940259,1941381..1941505, FT 1952799..1952930,1953835..1953958,1955051..1955251, FT 1956888..1957067,1957420..1957576,1957710..1957915, FT 1959660..1959763,1961198..1961467,1962762..1962878, FT 1976590..1976731,1977021..1977127,1978202..1978406, FT 1980365..1983934) FT /gene="WHSC1" FT /locus_tag="RP11-262P20.3-001" FT /product="Wolf-Hirschhorn syndrome candidate 1" FT /note="match: ESTs: Em:BM982021.1" FT /note="match: cDNAs: Em:AJ007042.1" FT mRNA join(1894509..1894618,1895457..1895636,1900948..1901122, FT 1902353..1902978,1905943..1906105,1918598..1918764, FT 1919868..1920350,1932353..1932497,1936871..1936989, FT 1940178..1940259,1941381..1941505,1944066..1944292, FT 1952799..1952930,1953835..1953958,1955051..1955251, FT 1956888..1957067,1957420..1957576,1957710..1957915, FT 1959660..1959763,1961198..1961467,1962762..1962878, FT 1976590..1976731,1977021..1977127,1978202..1978406, FT 1980365..1983930) FT /gene="WHSC1" FT /locus_tag="RP11-262P20.3-002" FT /product="Wolf-Hirschhorn syndrome candidate 1" FT /note="match: cDNAs: Em:AF083389.1" FT misc_feature complement(1893070..1893079) FT /note="Single clone region. Sequence generated from a short FT insert library derived from a single pUC clone. Restriction FT digest data confirm the assembly" FT misc_feature complement(1892803..1892841) FT /note="Single clone region. Sequence generated from a short FT insert library derived from a single pUC clone. Restriction FT digest data confirm the assembly" FT misc_feature complement(1882982..1883443) FT /note="Sequence from overlapping clone RP11-317B7 FT (AL136360). Assembly confirmed by restriction digest" FT misc_feature complement(2071670..2175396) FT /note="annotated region of clone" FT misc_feature complement(2175175) FT /note="Sequence from overlapping clone RP11-262P20 FT (AL132868). Assembly confirmed by restriction digest" FT misc_feature complement(2173397) FT /note="Clone_left_end: RP11-262P20" FT misc_feature complement(2090211) FT /note="Clone_right_end: RP11-478C1" FT polyA_signal complement(2073705..2073710) FT polyA_site complement(2073685) FT misc_feature complement(2071670) FT /note="Clone_left_end: RP11-317B7" FT CDS join(AL158068.18:120777..120909,AL158068.18:136882..136961, FT AL158068.18:141521..142021,AL158068.18:151291..151484, FT AL158068.18:156692..156804,AL158068.18:170543..170700, FT AL158068.18:173674..173742,AL158068.18:175257..175317, FT AL158068.18:175989..176053,complement(2172825..2172908), FT complement(2172406..2172501),complement(2160882..2160938), FT complement(2159585..2159638),complement(2158515..2158580), FT complement(2132960..2133017),complement(2130906..2130983), FT complement(2129840..2129954),complement(2097578..2097660), FT complement(2087340..2087471),complement(2083360..2083470), FT complement(2082685..2082763),complement(2077179..2077246), FT complement(2074695..2074756),complement(2073841..2074026)) FT /gene="POLN" FT /locus_tag="RP11-317B7.1-001" FT /standard_name="OTTHUMP00000114827" FT /product="polymerase (DNA directed) nu" FT /note="match: proteins: Sw:Q7Z5Q5" FT /protein_id="CAM16854.1" FT /translation="MENYEALVGFDLCNTPLSSVAQKIMSAMHSGDLVDSKTWGKSTET FT MEVINKSSVKYSVQLEDRKTQSPEKKDLKSLRSQTSRGSAKLSPQSFSVRLTDQLSADQ FT KQKSISSLTLSSCLIPQYNQEASVLQKKGHKRKHFLMENINNENKGSINLKRKHITYNN FT LSEKTSKQMALEEDTDDAEGYLNSGNSGALKKHFCDIRHLDDWAKSQLIEMLKQAAALV FT ITVMYTDGSTQLGADQTPVSSVRGIVVLVKRQAEGGHGCPDAPACGPVLEGFVSDDPCI FT YIQIEHSAIWDQEQEAHQQFARNVLFQTMKCKCPVICFNAKDFVRIVLQFFGNDGSWKH FT VADFIGLDPRIAAWLIDPSDATPSFEDLVEKYCEKSITVKVNSTYGNSSRNIVNQNVRE FT NLKTLYRLTMDLCSKLKDYGLWQLFRTLELPLIPILAVMESHAIQVNKEEMEKTSALLG FT ARLKELEQEAHFVAGERFLITSNNQLREILFGKLKLHLLSQRNSLPRTGLQKYPSTSEA FT VLNALRDLHPLPKIILEYRQVHKIKSTFVDGLLACMKKGSISSTWNQTGTVTGRLSAKH FT PNIQGISKHPIQITTPKNFKGKEDKILTISPRAMFVSSKGHTFLAADFSQIELRILTHL FT SGDPELLKLFQESERDDVFSTLTSQWKDVPVEQVTHADREQTKKVVYAVVYGAGKERLA FT ACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRRPLPRIHAHDQ FT QLRAQAERQAVNFVVQGSAADLCKLAMIHVFTAVAASHTLTARLVAQIHDELLFEVEDP FT QIPECAALVRRTMESLEQVQALELQLQVPLKVSLSAGRSWGHLVPLQEAWGPPPGPCRT FT ESPSNSLAAPGSPASTQPPPLHFSPSFCL" FT mRNA join(AL158068.18:120777..120909,AL158068.18:136882..136961, FT AL158068.18:141521..142021,AL158068.18:151291..151484, FT AL158068.18:156692..156804,AL158068.18:170543..170700, FT AL158068.18:173674..173742,AL158068.18:175257..175317, FT AL158068.18:175989..176053,complement(2172825..2172908), FT complement(2172406..2172501),complement(2160882..2160938), FT complement(2159585..2159638),complement(2158515..2158580), FT complement(2132960..2133017),complement(2130906..2130983), FT complement(2129840..2129954),complement(2097578..2097660), FT complement(2087340..2087471),complement(2083360..2083470), FT complement(2082685..2082763),complement(2077179..2077246), FT complement(2074695..2074756),complement(2073645..2074026)) FT /gene="POLN" FT /locus_tag="RP11-317B7.1-001" FT /product="polymerase (DNA directed) nu" FT /note="match: cDNAs: Em:AY136549.1" FT misc_feature complement(2175397..2349734) FT /note="annotated region of clone" FT mRNA complement(join(2249159..2252428,2252811..2252973, FT 2254135..2254249,2259709..2259738,2263452..2263551, FT 2263644..2264021)) FT /gene="MXD4" FT /locus_tag="RP11-478C1.1-001" FT /product="MAX dimerization protein 4" FT /note="match: ESTs: Em:BG430095.1" FT /note="match: cDNAs: Em:AF082740.1" FT CDS complement(join(2252271..2252428,2252811..2252973, FT 2254135..2254249,2259709..2259738,2263452..2263551, FT 2263644..2263707)) FT /gene="MXD4" FT /locus_tag="RP11-478C1.1-001" FT /standard_name="OTTHUMP00000115253" FT /product="MAX dimerization protein 4" FT /note="match: proteins: Sw:Q14582" FT /protein_id="CAM20460.1" FT /translation="MELNSLLILLEAAEYLERRDREAEHGYASVLPFDGDFAREKTKAA FT GLVRKAPNNRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKK FT LEEQDRRALSIKEQLQQEHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIEG FT MEFGPGELDSVGSSSDADDHYSLQSGTGGDSGFGPHCRRLGRPALS" FT polyA_signal 2249185..2249190 FT polyA_site complement(2249159) FT misc_feature complement(2247448..2247469) FT /note="Sequence from overlapping clone LA04NC01-33C6 FT (Z68282). Assembly confirmed by restriction digest" FT CDS join(complement(2230826..2230958), FT complement(2214774..2214853),complement(2209714..2210214), FT complement(2200251..2200444),complement(2194931..2195043), FT complement(2181035..2181192),complement(2177993..2178061), FT complement(2176418..2176478),complement(2175682..2175746), FT AL136360.21:2489..2572,AL136360.21:2896..2991, FT AL136360.21:14459..14515,AL136360.21:15759..15812, FT AL136360.21:16817..16882,AL136360.21:42380..42437, FT AL136360.21:44414..44491,AL136360.21:45443..45557, FT AL136360.21:77737..77819,AL136360.21:87926..88057, FT AL136360.21:91927..92037,AL136360.21:92634..92712, FT AL136360.21:98151..98218,AL136360.21:100641..100702, FT AL136360.21:101371..101556) FT /gene="POLN" FT /locus_tag="RP11-317B7.1-001" FT /standard_name="OTTHUMP00000114827" FT /product="polymerase (DNA directed) nu" FT /note="match: proteins: Sw:Q7Z5Q5" FT /protein_id="CAM20461.1" FT /translation="MENYEALVGFDLCNTPLSSVAQKIMSAMHSGDLVDSKTWGKSTET FT MEVINKSSVKYSVQLEDRKTQSPEKKDLKSLRSQTSRGSAKLSPQSFSVRLTDQLSADQ FT KQKSISSLTLSSCLIPQYNQEASVLQKKGHKRKHFLMENINNENKGSINLKRKHITYNN FT LSEKTSKQMALEEDTDDAEGYLNSGNSGALKKHFCDIRHLDDWAKSQLIEMLKQAAALV FT ITVMYTDGSTQLGADQTPVSSVRGIVVLVKRQAEGGHGCPDAPACGPVLEGFVSDDPCI FT YIQIEHSAIWDQEQEAHQQFARNVLFQTMKCKCPVICFNAKDFVRIVLQFFGNDGSWKH FT VADFIGLDPRIAAWLIDPSDATPSFEDLVEKYCEKSITVKVNSTYGNSSRNIVNQNVRE FT NLKTLYRLTMDLCSKLKDYGLWQLFRTLELPLIPILAVMESHAIQVNKEEMEKTSALLG FT ARLKELEQEAHFVAGERFLITSNNQLREILFGKLKLHLLSQRNSLPRTGLQKYPSTSEA FT VLNALRDLHPLPKIILEYRQVHKIKSTFVDGLLACMKKGSISSTWNQTGTVTGRLSAKH FT PNIQGISKHPIQITTPKNFKGKEDKILTISPRAMFVSSKGHTFLAADFSQIELRILTHL FT SGDPELLKLFQESERDDVFSTLTSQWKDVPVEQVTHADREQTKKVVYAVVYGAGKERLA FT ACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRRPLPRIHAHDQ FT QLRAQAERQAVNFVVQGSAADLCKLAMIHVFTAVAASHTLTARLVAQIHDELLFEVEDP FT QIPECAALVRRTMESLEQVQALELQLQVPLKVSLSAGRSWGHLVPLQEAWGPPPGPCRT FT ESPSNSLAAPGSPASTQPPPLHFSPSFCL" FT mRNA join(complement(2230826..2230958), FT complement(2214774..2214853),complement(2209714..2210214), FT complement(2200251..2200444),complement(2194931..2195043), FT complement(2181035..2181192),complement(2177993..2178061), FT complement(2176418..2176478),complement(2175682..2175746), FT AL136360.21:2489..2572,AL136360.21:2896..2991, FT AL136360.21:14459..14515,AL136360.21:15759..15812, FT AL136360.21:16817..16882,AL136360.21:42380..42437, FT AL136360.21:44414..44491,AL136360.21:45443..45557, FT AL136360.21:77737..77819,AL136360.21:87926..88057, FT AL136360.21:91927..92037,AL136360.21:92634..92712, FT AL136360.21:98151..98218,AL136360.21:100641..100702, FT AL136360.21:101371..101752) FT /gene="POLN" FT /locus_tag="RP11-317B7.1-001" FT /product="polymerase (DNA directed) nu" FT /note="match: cDNAs: Em:AY136549.1" FT misc_feature complement(2225743) FT /note="Tandem repeat. Forced join. Gap size estimated to be FT approximately 1020bp by restriction digest data" FT misc_feature complement(2194060..2194336) FT /note="Sequence from overlapping clone LA04NC01-190H5 FT (Z68163). Assembly confirmed by restriction digest" FT misc_feature complement(2193588..2193601) FT /note="Sequence from overlapping clone LA04NC01-190H5 FT (Z68163). Assembly confirmed by restriction digest" FT misc_feature complement(2190587..2190645) FT /note="Single clone region. Assembly confirmed by FT restriction digest data" FT misc_feature complement(2187973..2188513) FT /note="Sequence from overlapping clone LA04NC01-190H5 FT (Z68163). Assembly confirmed by restriction digest" FT misc_feature complement(2188006..2188049) FT /note="Sequence from uni-directional primer reads only" FT misc_feature complement(2179480) FT /note="Clone_right_end: RP11-503N18" FT misc_feature complement(2516418) FT /note="Clone_left_end: RP11-478C1" FT misc_feature complement(2490767) FT /note="Weak Data" FT misc_feature complement(2415491..2415512) FT /note="Sequence from overlapping clone RP11-478A6 FT (AL359379). Assembly confirmed by restriction digest" FT misc_feature complement(2403482..2403533) FT /note="Sequence from overlapping clone RP11-478A6 FT (AL359379). Assembly confirmed by restriction digest" FT misc_feature complement(2362775) FT /note="Clone_right_end: RP11-48L6" FT misc_feature complement(2577592..2577596) FT /note="Sequence from uni-directional dGTP big dye FT terminator reads only" FT misc_feature complement(2577040) FT /note="Clone_left_end: RP11-503N18" FT misc_feature complement(2556289..2557848) FT /note="Single clone region. Sequence generated from a short FT insert library derived from a single pUC clone. Restriction FT digest data confirm the assembly" FT misc_feature complement(2518418) FT /note="Clone_right_end: WI2-89927D4" FT misc_feature complement(2610220) FT /note="Clone_right_end: WI2-82754D2" FT misc_feature complement(2621916) FT /note="Clone_right_end: RP3-474M20" FT misc_feature complement(2621437) FT /note="Clone_left_end: WI2-89927D4" FT misc_feature complement(2611719) FT /note="Clone_left_end: WI2-82754D2" FT misc_feature complement(2623437..2748759) FT /note="annotated region of clone" FT misc_feature complement(2679347) FT /note="Clone_right_end: RP3-323A24" FT misc_feature complement(2636400..2636460) FT /note="Single clone region. Sequence from overlapping clone FT RP3-323A24 (AL158131). Assembly confirmed by restriction FT digest" FT mRNA join(AL121750.22:140626..140988,AL121750.22:149057..149347, FT complement(2747173..2747262),complement(2746424..2746672), FT complement(2746114..2746233),complement(2743387..2744247)) FT /gene="TNIP2" FT /locus_tag="RP3-474M20.1-001" FT /product="TNFAIP3 interacting protein 2" FT /note="match: cDNAs: Em:AF372839.1 Em:BC002740.2" FT CDS join(AL121750.22:140713..140988,AL121750.22:149057..149347, FT complement(2747173..2747262),complement(2746424..2746672), FT complement(2746114..2746233),complement(2743984..2744247)) FT /gene="TNIP2" FT /locus_tag="RP3-474M20.1-001" FT /standard_name="OTTHUMP00000115298" FT /product="TNFAIP3 interacting protein 2" FT /note="match: proteins: Tr:Q7L5L2 Tr:Q8NFZ5" FT /protein_id="CAM28252.1" FT /translation="MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALI FT ARLRARLAALEGDAAPSLVDALLEQVARFREQLRRQEGGAAEAQMRQEIERLTERLEEK FT EREMQQLLSQPQHEREKEVVLLRRSMAEGERARAASDVLCRSLANETHQLRRTLTATAH FT MCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEENRLLKQKVTHVED FT LNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQE FT LAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSW FT RQDSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRG FT QGDLQCPHCLQCFSDEQGEELLRHVAECCQ" FT misc_feature complement(2748760..2896728) FT /note="annotated region of clone" FT misc_feature complement(2889947..2890324) FT /note="Sequence from overlapping clone LA04NC01-30G1 FT (Z68870)" FT misc_feature complement(2889947..2889966) FT /note="Single clone region. Sequence from primer read only" FT misc_feature complement(2885769..2885854) FT /note="Sequence from uni-directional dGTP big dye FT terminator reads only" FT misc_feature complement(2885764..2885854) FT /note="Single clone region" FT misc_feature complement(2885764..2885767) FT /note="Sequence from uni-directional dGTP big dye FT terminator reads only" FT misc_feature complement(2881592..2881650) FT /note="Sequence from clone PCR only" FT misc_feature complement(2881620..2881643) FT /note="Weak data" FT misc_feature complement(2881348..2881415) FT /note="Sequence from clone PCR only" FT CDS join(2877643..2877837,2883625..2883787,2886242..2886393, FT 2895740..2895820,2896309..2896458, FT complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13105..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:8689..8781), FT complement(BX465861.7:3080..3236), FT complement(AL390065.20:147130..147228), FT complement(AL390065.20:146567..146600), FT complement(AL390065.20:145071..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-001" FT /standard_name="OTTHUMP00000151163" FT /product="adducin 1 (alpha)" FT /note="match: proteins: Tr:Q86XM2" FT /protein_id="CAM28231.1" FT /translation="MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL FT RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPN FT VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ FT LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFT FT LHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEE FT EKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN FT LVLLNPEKYKAKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA FT LREKSKKYSDVEVPASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASE FT EGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTA FT GPQSQVLCGVVMDRSLVQDAPLSDCTETIEGLELTEQTFSPAKSLSFRKGELVTASKAI FT IEKEYQPHVIVSTTGPNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKSPPDQ FT PAVPHPPPSTPIKLEEGDGCAREYLLP" FT mRNA join(2877623..2877837,2883625..2883787,2886242..2886393, FT 2895740..2895820,2896309..2896458, FT complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13105..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:3080..3236), FT complement(AL390065.20:147130..147228), FT complement(AL390065.20:143166..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-002" FT /product="adducin 1 (alpha)" FT /note="match: cDNAs: Em:X58141.1" FT CDS join(2877643..2877837,2883625..2883787,2886242..2886393, FT 2895740..2895820,2896309..2896458, FT complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13105..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:3080..3236), FT complement(AL390065.20:147130..147228), FT complement(AL390065.20:144719..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-002" FT /standard_name="OTTHUMP00000151164" FT /product="adducin 1 (alpha)" FT /note="match: proteins: Sw:P35611" FT /protein_id="CAM28232.1" FT /translation="MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL FT RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPN FT VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ FT LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFT FT LHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEE FT EKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN FT LVLLNPEKYKAKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA FT LREKSKKYSDVEVPASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASE FT EGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTA FT GPQSQVLCGVVMDRSLVQGELVTASKAIIEKEYQPHVIVSTTGPNPFTTLTDRELEEYR FT REVERKQKGSEENLDEAREQKEKSPPDQPAVPHPPPSTPIKLEEDLVPEPTTGDDSDAA FT TFKPTLPDLSPDEPSEALGFPMLEKEEEAHRPPSPTEAPTEASPEPAPDPAPVAEEAAP FT SAVEEGAAADPGSDGSPGKSPSKKKKKFRTPSFLKKSKKKSDS" FT mRNA join(2877641..2877837,2883625..2883787,2886242..2886393, FT 2895740..2895820,2896309..2896458, FT complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13012..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:3080..3236), FT complement(AL390065.20:147130..147228), FT complement(AL390065.20:146567..146600), FT complement(AL390065.20:144719..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-003" FT /product="adducin 1 (alpha)" FT /note="match: cDNAs: Em:L07261.1" FT CDS join(2877643..2877837,2883625..2883787,2886242..2886393, FT 2895740..2895820,2896309..2896458, FT complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13012..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:3080..3236), FT complement(AL390065.20:147130..147228), FT complement(AL390065.20:146567..146600), FT complement(AL390065.20:145071..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-003" FT /standard_name="OTTHUMP00000151165" FT /product="adducin 1 (alpha)" FT /protein_id="CAM28230.1" FT /translation="MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL FT RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPN FT VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ FT LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFT FT LHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEE FT EKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN FT LVLLNPEKYKAKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA FT LREKSKKYSDVEVPASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASE FT EGQNGSSPKSKTKVWTNITHDHVKPLLQSLSSGVCVPSCITNCLWTKEDGHRTSTSAVP FT NLFVPLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQGELVTASKAI FT IEKEYQPHVIVSTTGPNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKSPPDQ FT PAVPHPPPSTPIKLEEGDGCAREYLLP" FT misc_feature complement(2865852..2865910) FT /note="Sequence from uni-directional dGTP big dye FT terminator reads only" FT misc_feature complement(2852672..2852697) FT /note="Weak data" FT misc_feature complement(2848606..2848641) FT /note="Single clone region" FT mRNA join(2845877..2846561,2869699..2869856,2877623..2877837, FT 2883625..2883787,2886242..2886393,2895740..2895820, FT 2896309..2896458,complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13105..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:8689..8781), FT complement(BX465861.7:3080..3236), FT complement(AL390065.20:147130..147228), FT complement(AL390065.20:146567..146600), FT complement(AL390065.20:143180..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-001" FT /product="adducin 1 (alpha)" FT /note="match: cDNAs: Em:BC042998.1" FT misc_feature complement(2836740) FT /note="Tandem repeat. Forced join. Gap size estimated to be FT approximately 200bp by restriction digest data" FT misc_feature complement(2825595..2825812) FT /note="Sequence from overlapping clone LA04NC01-247F6 FT (Z68279)" FT misc_feature complement(2823373..2823596) FT /note="Sequence from overlapping clone LA04NC01-247F6 FT (Z68279)" FT misc_feature complement(2818839..2819154) FT /note="Sequence from overlapping clone LA04NC01-247F6 FT (Z68279)" FT misc_feature complement(2819121..2819141) FT /note="Single clone region" FT misc_feature complement(2818900..2819071) FT /note="Single clone region" FT misc_feature complement(2807216) FT /note="Clone_right_end: CTD-2314C7" FT misc_feature complement(2784532..2784561) FT /note="Sequence from overlapping clone CTD-2314C7 FT (BX465861)" FT misc_feature complement(2767933..2768042) FT /note="Sequence from overlapping clone CTD-2314C7 FT (BX465861)" FT misc_feature complement(2767804) FT /note="Sequence from overlapping clone CTD-2314C7 FT (BX465861)" FT misc_feature complement(2762224..2762526) FT /note="Sequence from overlapping clone CTD-2314C7 FT (BX465861)" FT misc_feature complement(2760782..2760833) FT /note="Sequence from overlapping clone CTD-2314C7 FT (BX465861)" FT mRNA join(complement(2757741..2758103), FT complement(2749382..2749672),AL110117.3:3498..3587, FT AL110117.3:4088..4336,AL110117.3:4527..4646, FT AL110117.3:6513..7373) FT /gene="TNIP2" FT /locus_tag="RP3-474M20.1-001" FT /product="TNFAIP3 interacting protein 2" FT /note="match: cDNAs: Em:AF372839.1 Em:BC002740.2" FT CDS join(complement(2757741..2758016), FT complement(2749382..2749672),AL110117.3:3498..3587, FT AL110117.3:4088..4336,AL110117.3:4527..4646, FT AL110117.3:6513..6776) FT /gene="TNIP2" FT /locus_tag="RP3-474M20.1-001" FT /standard_name="OTTHUMP00000115298" FT /product="TNFAIP3 interacting protein 2" FT /note="match: proteins: Tr:Q7L5L2 Tr:Q8NFZ5" FT /protein_id="CAM28233.1" FT /translation="MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALI FT ARLRARLAALEGDAAPSLVDALLEQVARFREQLRRQEGGAAEAQMRQEIERLTERLEEK FT EREMQQLLSQPQHEREKEVVLLRRSMAEGERARAASDVLCRSLANETHQLRRTLTATAH FT MCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEENRLLKQKVTHVED FT LNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQE FT LAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSW FT RQDSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRG FT QGDLQCPHCLQCFSDEQGEELLRHVAECCQ" FT misc_feature complement(2752421..2752468) FT /note="Sequence from overlapping clone LA04NCO1-86C3 FT (Z68283)" FT misc_feature complement(2752435..2752465) FT /note="Sequence from uni-directional primer reads only" FT misc_feature complement(2896729..2919846) FT /note="annotated region of clone" FT misc_feature complement(2917847) FT /note="Clone_left_end: RP3-323A24" FT CDS join(complement(AL121750.22:20892..21086), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420),2899911..2900054, FT 2900160..2900258,2900986..2901162,2906491..2906742, FT 2909470..2909571,2910242..2910331,2911066..2911158, FT 2916611..2916767,complement(AL390065.20:147130..147228), FT complement(AL390065.20:146567..146600), FT complement(AL390065.20:145071..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-001" FT /standard_name="OTTHUMP00000151163" FT /product="adducin 1 (alpha)" FT /note="match: proteins: Tr:Q86XM2" FT /protein_id="CAM25273.1" FT /translation="MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL FT RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPN FT VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ FT LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFT FT LHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEE FT EKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN FT LVLLNPEKYKAKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA FT LREKSKKYSDVEVPASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASE FT EGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTA FT GPQSQVLCGVVMDRSLVQDAPLSDCTETIEGLELTEQTFSPAKSLSFRKGELVTASKAI FT IEKEYQPHVIVSTTGPNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKSPPDQ FT PAVPHPPPSTPIKLEEGDGCAREYLLP" FT mRNA join(complement(AL121750.22:20892..21106), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420),2899911..2900054, FT 2900160..2900258,2900986..2901162,2906491..2906742, FT 2909470..2909571,2910242..2910331,2916611..2916767, FT complement(AL390065.20:147130..147228), FT complement(AL390065.20:143166..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-002" FT /product="adducin 1 (alpha)" FT /note="match: cDNAs: Em:X58141.1" FT CDS join(complement(AL121750.22:20892..21086), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420),2899911..2900054, FT 2900160..2900258,2900986..2901162,2906491..2906742, FT 2909470..2909571,2910242..2910331,2916611..2916767, FT complement(AL390065.20:147130..147228), FT complement(AL390065.20:144719..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-002" FT /standard_name="OTTHUMP00000151164" FT /product="adducin 1 (alpha)" FT /note="match: proteins: Sw:P35611" FT /protein_id="CAM25274.1" FT /translation="MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL FT RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPN FT VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ FT LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFT FT LHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEE FT EKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN FT LVLLNPEKYKAKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA FT LREKSKKYSDVEVPASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASE FT EGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTA FT GPQSQVLCGVVMDRSLVQGELVTASKAIIEKEYQPHVIVSTTGPNPFTTLTDRELEEYR FT REVERKQKGSEENLDEAREQKEKSPPDQPAVPHPPPSTPIKLEEDLVPEPTTGDDSDAA FT TFKPTLPDLSPDEPSEALGFPMLEKEEEAHRPPSPTEAPTEASPEPAPDPAPVAEEAAP FT SAVEEGAAADPGSDGSPGKSPSKKKKKFRTPSFLKKSKKKSDS" FT mRNA join(complement(AL121750.22:20892..21088), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420),2899911..2900054, FT 2900160..2900258,2900986..2901162,2906491..2906835, FT 2909470..2909571,2910242..2910331,2916611..2916767, FT complement(AL390065.20:147130..147228), FT complement(AL390065.20:146567..146600), FT complement(AL390065.20:144719..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-003" FT /product="adducin 1 (alpha)" FT /note="match: cDNAs: Em:L07261.1" FT CDS join(complement(AL121750.22:20892..21086), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420),2899911..2900054, FT 2900160..2900258,2900986..2901162,2906491..2906835, FT 2909470..2909571,2910242..2910331,2916611..2916767, FT complement(AL390065.20:147130..147228), FT complement(AL390065.20:146567..146600), FT complement(AL390065.20:145071..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-003" FT /standard_name="OTTHUMP00000151165" FT /product="adducin 1 (alpha)" FT /protein_id="CAM25275.1" FT /translation="MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL FT RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPN FT VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ FT LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFT FT LHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEE FT EKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN FT LVLLNPEKYKAKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA FT LREKSKKYSDVEVPASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASE FT EGQNGSSPKSKTKVWTNITHDHVKPLLQSLSSGVCVPSCITNCLWTKEDGHRTSTSAVP FT NLFVPLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQGELVTASKAI FT IEKEYQPHVIVSTTGPNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKSPPDQ FT PAVPHPPPSTPIKLEEGDGCAREYLLP" FT misc_feature complement(2898728) FT /note="Clone_right_end: RP11-520M5" FT mRNA join(complement(AL121750.22:52168..52852), FT complement(AL121750.22:28873..29030), FT complement(AL121750.22:20892..21106), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420),2899911..2900054, FT 2900160..2900258,2900986..2901162,2906491..2906742, FT 2909470..2909571,2910242..2910331,2911066..2911158, FT 2916611..2916767,complement(AL390065.20:147130..147228), FT complement(AL390065.20:146567..146600), FT complement(AL390065.20:143180..145071)) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-001" FT /product="adducin 1 (alpha)" FT /note="match: cDNAs: Em:BC042998.1" FT misc_feature complement(2919847..3072968) FT /note="annotated region of clone" FT misc_feature complement(3058519..3058594) FT /note="Sequence generated from a short insert library FT derived from a single pUC clone. Restriction digest data FT confirm the assembly. Sequence from uni-directional dGTP FT big dye terminator reads only" FT CDS join(complement(AL121750.22:20892..21086), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420), FT complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13105..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:8689..8781), FT complement(BX465861.7:3080..3236),2927741..2927839, FT 2928369..2928402,2929898..2929898) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-001" FT /standard_name="OTTHUMP00000151163" FT /product="adducin 1 (alpha)" FT /note="match: proteins: Tr:Q86XM2" FT /protein_id="CAM21298.1" FT /translation="MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL FT RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPN FT VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ FT LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFT FT LHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEE FT EKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN FT LVLLNPEKYKAKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA FT LREKSKKYSDVEVPASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASE FT EGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTA FT GPQSQVLCGVVMDRSLVQDAPLSDCTETIEGLELTEQTFSPAKSLSFRKGELVTASKAI FT IEKEYQPHVIVSTTGPNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKSPPDQ FT PAVPHPPPSTPIKLEEGDGCAREYLLP" FT mRNA join(complement(AL121750.22:20892..21106), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420), FT complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13105..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:3080..3236),2927741..2927839, FT 2929898..2931803) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-002" FT /product="adducin 1 (alpha)" FT /note="match: cDNAs: Em:X58141.1" FT CDS join(complement(AL121750.22:20892..21086), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420), FT complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13105..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:3080..3236),2927741..2927839, FT 2929898..2930250) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-002" FT /standard_name="OTTHUMP00000151164" FT /product="adducin 1 (alpha)" FT /note="match: proteins: Sw:P35611" FT /protein_id="CAM21299.1" FT /translation="MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL FT RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPN FT VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ FT LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFT FT LHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEE FT EKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN FT LVLLNPEKYKAKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA FT LREKSKKYSDVEVPASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASE FT EGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTA FT GPQSQVLCGVVMDRSLVQGELVTASKAIIEKEYQPHVIVSTTGPNPFTTLTDRELEEYR FT REVERKQKGSEENLDEAREQKEKSPPDQPAVPHPPPSTPIKLEEDLVPEPTTGDDSDAA FT TFKPTLPDLSPDEPSEALGFPMLEKEEEAHRPPSPTEAPTEASPEPAPDPAPVAEEAAP FT SAVEEGAAADPGSDGSPGKSPSKKKKKFRTPSFLKKSKKKSDS" FT mRNA join(complement(AL121750.22:20892..21088), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420), FT complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13012..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:3080..3236),2927741..2927839, FT 2928369..2928402,2929898..2930250) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-003" FT /product="adducin 1 (alpha)" FT /note="match: cDNAs: Em:L07261.1" FT CDS join(complement(AL121750.22:20892..21086), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420), FT complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13012..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:3080..3236),2927741..2927839, FT 2928369..2928402,2929898..2929898) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-003" FT /standard_name="OTTHUMP00000151165" FT /product="adducin 1 (alpha)" FT /protein_id="CAM21297.1" FT /translation="MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDL FT RQDFNMMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPN FT VYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQ FT LIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFT FT LHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEE FT EKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDN FT LVLLNPEKYKAKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPA FT LREKSKKYSDVEVPASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASE FT EGQNGSSPKSKTKVWTNITHDHVKPLLQSLSSGVCVPSCITNCLWTKEDGHRTSTSAVP FT NLFVPLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQGELVTASKAI FT IEKEYQPHVIVSTTGPNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKSPPDQ FT PAVPHPPPSTPIKLEEGDGCAREYLLP" FT misc_feature complement(3032119) FT /note="Tandem repeat. Forced join. Gap size estimated to be FT approximately 250 bp by restriction digest data" FT mRNA join(complement(AL121750.22:52168..52852), FT complement(AL121750.22:28873..29030), FT complement(AL121750.22:20892..21106), FT complement(AL121750.22:14942..15104), FT complement(AL121750.22:12336..12487), FT complement(AL121750.22:2909..2989), FT complement(AL121750.22:2271..2420), FT complement(BX465861.7:19793..19936), FT complement(BX465861.7:19589..19687), FT complement(BX465861.7:18685..18861), FT complement(BX465861.7:13105..13356), FT complement(BX465861.7:10276..10377), FT complement(BX465861.7:9516..9605), FT complement(BX465861.7:8689..8781), FT complement(BX465861.7:3080..3236),2927741..2927839, FT 2928369..2928402,2929898..2931789) FT /gene="ADD1" FT /locus_tag="RP11-520M5.1-001" FT /product="adducin 1 (alpha)" FT /note="match: cDNAs: Em:BC042998.1" FT mRNA complement(join(2932292..2932680,2932788..2932877, FT 2932954..2933001,2933102..2933192,2933282..2933390, FT 2933552..2933663,2933772..2933880,2934078..2934239, FT 2934327..2934485,2934833..2934936,2935294..2935390, FT 2935480..2935671,2936496..2936586)) FT /gene="TETRAN" FT /locus_tag="RP11-520M5.2-001" FT /product="tetracycline transporter-like protein" FT /note="match: ESTs: Em:BF197241.1" FT /note="match: cDNAs: Em:CR607301.1" FT CDS complement(join(2932565..2932680,2932788..2932877, FT 2932954..2933001,2933102..2933192,2933282..2933390, FT 2933552..2933663,2933772..2933880,2934078..2934239, FT 2934327..2934485,2934833..2934936,2935294..2935390, FT 2935480..2935650)) FT /gene="TETRAN" FT /locus_tag="RP11-520M5.2-001" FT /standard_name="OTTHUMP00000151166" FT /product="tetracycline transporter-like protein" FT /note="match: proteins: Tr:Q07706" FT /protein_id="CAM21300.1" FT /translation="MGWGGGGGCTPRPPIHQQPPERRVVTVVFLGLLLDLLAFTLLLPL FT LPGLLESHGRAHDPLYGSWQGGVDWFATAIGMPVEKRYNSVLFGGLIGSAFSVLQFLCA FT PLTGATSDCLGRRPVMLLCLMGVATSYAVWATSRSFAAFLASRLIGGISKGNVSLSTAI FT VADLGSPLARSQGMAVIGVAFSLGFTLGPMLGASLPLEMAPWFALLFAASDLLFIFCFL FT PETLPLEKRAPSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFL FT YLFLFSGLEYTLSFLTHQRFQFSSLQQGKMFFLIGLTMATIQGAYARRIHPGGEVAAVK FT RALLLLVPAFLLIGWGRSLPVLGLGLLLYSFAAAVVVPCLSSVVAGYGSPGQKGTVMGT FT LRSLGALARAAGPLVAASVYWLAGAQACFTTWSGLFLLPFFLLQKLSYPAQTLKAE" FT polyA_signal complement(2932310..2932315) FT polyA_site complement(2932292) FT polyA_site 2931803 FT polyA_site 2931789 FT polyA_signal 2931771..2931776 FT misc_feature complement(3255559) FT /note="Clone_left_end: RP11-520M5" FT misc_feature complement(3249878..3249920) FT /note="Single clone region. Assembly confirmed by FT restriction digest data" FT misc_feature complement(3158608..3158618) FT /note="Single clone region. Assembly confirmed by FT restriction digest data" FT misc_feature complement(3120219) FT /note="Clone_right_end: RP11-357G3" FT misc_feature complement(3271349..3416499) FT /note="annotated region of clone" FT misc_feature complement(3414500) FT /note="Clone_left_end: RP11-399E10" FT misc_feature complement(3395565) FT /note="Sequence from overlapping clone cL219B8 (Z54246). FT Assembly confirmed by restriction digest" FT misc_feature complement(3393311..3393398) FT /note="Sequence from overlapping clone cL185E6 & cL219B8 FT (Z68274 & Z54246). Assembly confirmed by restriction FT digest" FT misc_feature complement(3375845) FT /note="Tandem repeat. Forced join. Gap size estimated to be FT approximately 400bp by restriction digest data" FT mRNA join(3371724..3372048,3388143..3388164,3415799..3415968, FT 3416479..3416499,complement(AL590235.23:157175..157246), FT complement(AL590235.23:155898..156041), FT complement(AL590235.23:154927..155106), FT complement(AL590235.23:154478..154631), FT complement(AL590235.23:151301..151377), FT complement(AL590235.23:149449..149643), FT complement(AL590235.23:149041..149114), FT complement(AL590235.23:148378..148504), FT complement(AL590235.23:146459..146555), FT complement(AL590235.23:143850..143929), FT complement(AL590235.23:143308..143461), FT complement(AL590235.23:141064..141612), FT complement(AL590235.23:132114..132564)) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-003" FT /product="regulator of G-protein signaling 12" FT /note="match: cDNAs: Em:AF030109.1" FT CDS join(3371995..3372048,3388143..3388164,3415799..3415968, FT 3416479..3416499,complement(AL590235.23:157175..157246), FT complement(AL590235.23:155898..156041), FT complement(AL590235.23:154927..155106), FT complement(AL590235.23:154478..154631), FT complement(AL590235.23:151301..151377), FT complement(AL590235.23:149449..149643), FT complement(AL590235.23:149041..149114), FT complement(AL590235.23:148378..148504), FT complement(AL590235.23:146459..146555), FT complement(AL590235.23:143850..143929), FT complement(AL590235.23:143308..143461), FT complement(AL590235.23:141064..141612), FT complement(AL590235.23:132335..132564)) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-003" FT /standard_name="OTTHUMP00000151172" FT /product="regulator of G-protein signaling 12" FT /protein_id="CAM17750.1" FT /translation="MNLGKELSNETHVSNDQQSATVSDGELTGADLKDCVSNNSLSSNA FT SLPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACEYFN FT HVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDVLRAPHPDMFKEQQLQIF FT NLMKFDSYTRFLKSPLYQECILAEVEGRALPDSQQVPSSPASKHSLGSDHSSVSTPKKL FT SGKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQKKREHGDHADDALHANGGL FT CRRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIHLPDGTSCVVAVKAGFSIKDIL FT SGLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINRSVG FT LKAKPTKPVTEVLRPVVARYGLDLSGLLVRLSGEKEPLDLGAPISSLDGQRVVLEEKDP FT SRGKASADKQKGVPVKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLS FT KREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLRLPP FT GSTELTLPTPAAVAKGFSKRSATGNGRESASQPGEQWEPVQESSDSPSTSPGSASSPPG FT PPGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQSQEVEAGGIQTVEDEHVAELTL FT MGEGDISSPNSTLLPPPSTPQEVPGPSRPGSGTHGSRDLPVNRIIDVDLVTGSAPGRDG FT GIAGAQAGPGRSQASGGPPTSDLPGLGPVPGEPAKPKTSAHHATFV" FT misc_feature complement(3344448) FT /note="Tandem repeat. Forced join. Gap size estimated to be FT approximately 180bp by restriction digest data" FT misc_feature complement(3327052..3327097) FT /note="Sequence from uni-directional dGTP big dye FT terminator reads only" FT misc_feature complement(3326943..3326961) FT /note="Single clone region. Assembly confirmed by FT restriction digest data" FT misc_feature complement(3326905..3326961) FT /note="Sequence from uni-directional dGTP big dye FT terminator reads only" FT misc_feature complement(3323238..3323368) FT /note="Sequence from overlapping clone RPC1-193G15 FT (AL096838). Assembly confirmed by restriction digest" FT misc_feature complement(3322241..3322367) FT /note="Sequence from overlapping clone RPC1-193G15 FT (AL096838). Assembly confirmed by restriction digest" FT CDS join(3317898..3319778,3344664..3344780,3388143..3388164, FT 3415799..3415968,3416479..3416499, FT complement(AL590235.23:157175..157246), FT complement(AL590235.23:155898..156041), FT complement(AL590235.23:154927..155106), FT complement(AL590235.23:154478..154631), FT complement(AL590235.23:151301..151377), FT complement(AL590235.23:149449..149643), FT complement(AL590235.23:149041..149114), FT complement(AL590235.23:148378..148504), FT complement(AL590235.23:146459..146555), FT complement(AL590235.23:143850..143929), FT complement(AL590235.23:143308..143461), FT complement(AL590235.23:141064..141612), FT complement(AL590235.23:132335..132564)) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-001" FT /standard_name="OTTHUMP00000115311" FT /product="regulator of G-protein signaling 12" FT /note="match: proteins: Sw:O14924" FT /protein_id="CAM17751.1" FT /translation="MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLS FT CVMRGSPADFVGLRAGDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGVGRFES FT CSSDEEGGLYEGKGWLKPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASNSEP FT LKLKQRSLSESAATRFDVGHESINNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALD FT ASILNVAMIVGYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCV FT QLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVF FT MVDPDLFNHKIHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEG FT MRARAFLDGDADAHQNNSTSSNSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWD FT GVGGRGAQPWGAPWTGPFCPDPEGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRS FT SVPPSKRGTVGAGCGFNQRWLPVHVLREWQCGHTSDQDSYTDSTDGWSSINCGTLPPPM FT SKIPADRYRVEGSFAQPPLNAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGSKFGRGT FT GLTQPSQRTSARRSFGRSKRFSITRSLDDLESATVSDGELTGADLKDCVSNNSLSSNAS FT LPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACEYFNH FT VPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDVLRAPHPDMFKEQQLQIFN FT LMKFDSYTRFLKSPLYQECILAEVEGRALPDSQQVPSSPASKHSLGSDHSSVSTPKKLS FT GKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQKKREHGDHADDALHANGGLC FT RRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIHLPDGTSCVVAVKAGFSIKDILS FT GLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINRSVGL FT KAKPTKPVTEVLRPVVARYGLDLSGLLVRLSGEKEPLDLGAPISSLDGQRVVLEEKDPS FT RGKASADKQKGVPVKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLSK FT REESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLRLPPG FT STELTLPTPAAVAKGFSKRSATGNGRESASQPGEQWEPVQESSDSPSTSPGSASSPPGP FT PGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQSQEVEAGGIQTVEDEHVAELTLM FT GEGDISSPNSTLLPPPSTPQEVPGPSRPGSGTHGSRDLPVNRIIDVDLVTGSAPGRDGG FT IAGAQAGPGRSQASGGPPTSDLPGLGPVPGEPAKPKTSAHHATFV" FT mRNA join(3317795..3319778,3344664..3344780,3388143..3388164, FT 3415799..3415968,3416479..3416499, FT complement(AL590235.23:157175..157246), FT complement(AL590235.23:155898..156041), FT complement(AL590235.23:154927..155106), FT complement(AL590235.23:154478..154631), FT complement(AL590235.23:151301..151377), FT complement(AL590235.23:149449..149643), FT complement(AL590235.23:149041..149114), FT complement(AL590235.23:148378..148504), FT complement(AL590235.23:146459..146555), FT complement(AL590235.23:143850..143929), FT complement(AL590235.23:143308..143461), FT complement(AL590235.23:139769..141612)) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-002" FT /product="regulator of G-protein signaling 12" FT /note="match: cDNAs: Em:AF035152.1" FT /note="match: ESTs: Em:CA440016.1 Em:CB529269.1" FT CDS join(3317898..3319778,3344664..3344780,3388143..3388164, FT 3415799..3415968,3416479..3416499, FT complement(AL590235.23:157175..157246), FT complement(AL590235.23:155898..156041), FT complement(AL590235.23:154927..155106), FT complement(AL590235.23:154478..154631), FT complement(AL590235.23:151301..151377), FT complement(AL590235.23:149449..149643), FT complement(AL590235.23:149041..149114), FT complement(AL590235.23:148378..148504), FT complement(AL590235.23:146459..146555), FT complement(AL590235.23:143850..143929), FT complement(AL590235.23:143308..143461), FT complement(AL590235.23:141047..141612)) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-002" FT /standard_name="OTTHUMP00000115312" FT /product="regulator of G-protein signaling 12" FT /protein_id="CAM17752.1" FT /translation="MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLS FT CVMRGSPADFVGLRAGDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGVGRFES FT CSSDEEGGLYEGKGWLKPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASNSEP FT LKLKQRSLSESAATRFDVGHESINNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALD FT ASILNVAMIVGYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCV FT QLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVF FT MVDPDLFNHKIHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEG FT MRARAFLDGDADAHQNNSTSSNSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWD FT GVGGRGAQPWGAPWTGPFCPDPEGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRS FT SVPPSKRGTVGAGCGFNQRWLPVHVLREWQCGHTSDQDSYTDSTDGWSSINCGTLPPPM FT SKIPADRYRVEGSFAQPPLNAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGSKFGRGT FT GLTQPSQRTSARRSFGRSKRFSITRSLDDLESATVSDGELTGADLKDCVSNNSLSSNAS FT LPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACEYFNH FT VPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDVLRAPHPDMFKEQQLQIFN FT LMKFDSYTRFLKSPLYQECILAEVEGRALPDSQQVPSSPASKHSLGSDHSSVSTPKKLS FT GKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQKKREHGDHADDALHANGGLC FT RRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIHLPDGTSCVVAVKAGFSIKDILS FT GLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINRSVGL FT KAKPTKPVTEVLRPVVARYGLDLSGLLVRLSGEKEPLDLGAPISSLDGQRVVLEEKDPS FT RGKASADKQKGVPVKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLSK FT REESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLRLPPG FT STELTLPTPAAVAKGFSKRSATGNGRESASQPGEQWEPVQESSDSPSTSPGSASSPPGP FT PGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQSQEVEAGGIQTVEDEHVAELTLM FT GEGDISSPNSTLLPPPSTPQEVPGPSRPGTSRF" FT mRNA join(3315874..3316676,3317797..3319778,3344664..3344780, FT 3388143..3388164,3415799..3415968,3416479..3416499, FT complement(AL590235.23:157175..157246), FT complement(AL590235.23:155898..156041), FT complement(AL590235.23:154927..155106), FT complement(AL590235.23:154478..154631), FT complement(AL590235.23:151301..151377), FT complement(AL590235.23:149449..149643), FT complement(AL590235.23:149041..149114), FT complement(AL590235.23:148378..148504), FT complement(AL590235.23:146459..146555), FT complement(AL590235.23:143850..143929), FT complement(AL590235.23:143308..143461), FT complement(AL590235.23:141064..141612), FT complement(AL590235.23:132114..132564)) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-001" FT /product="regulator of G-protein signaling 12" FT /note="match: cDNAs: Em:AF030111.1" FT misc_feature complement(3312876..3313116) FT /note="Sequence from overlapping clone RPC1-193G15 FT (AL096838). Assembly confirmed by restriction digest" FT misc_feature complement(3293537) FT /note="Clone_right_end: RP11-529E10" FT misc_feature complement(3271349) FT /note="Clone_left_end: RP11-357G3" FT misc_feature complement(3416500..3573745) FT /note="annotated region of clone" FT misc_feature complement(3547754..3547808) FT /note="Sequence from uni-directional dGTP big dye FT terminator reads only" FT mRNA complement(join(3514294..3514763,3516479..3516655, FT 3517843..3517925,3519761..3519919,3520598..3520718, FT 3521799..3521920,3526634..3526778,3533936..3534149)) FT /gene="LRPAP1" FT /locus_tag="RP11-529E10.3-001" FT /product="low density lipoprotein receptor-related protein FT associated protein 1" FT /note="match: cDNAs: Em:M63959.1" FT CDS complement(join(3514701..3514763,3516479..3516655, FT 3517843..3517925,3519761..3519919,3520598..3520718, FT 3521799..3521920,3526634..3526778,3533936..3534139)) FT /gene="LRPAP1" FT /locus_tag="RP11-529E10.3-001" FT /standard_name="OTTHUMP00000115346" FT /product="low density lipoprotein receptor-related protein FT associated protein 1" FT /note="match: proteins: Sw:P30533" FT /protein_id="CAM21451.1" FT /translation="MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPS FT PKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDED FT GEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGK FT FSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHT FT ELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREEL FT KHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKK FT HLQDLSGRISRARHNEL" FT mRNA join(complement(AL645949.16:44452..44776), FT complement(AL645949.16:28336..28357), FT complement(AL645949.16:532..701), FT complement(AL645949.16:1..21),3416500..3416571, FT 3417705..3417848,3418640..3418819,3419115..3419268, FT 3422369..3422445,3424103..3424297,3424632..3424705, FT 3425242..3425368,3427191..3427287,3429817..3429896, FT 3430285..3430438,3432134..3432682,3441182..3441632) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-003" FT /product="regulator of G-protein signaling 12" FT /note="match: cDNAs: Em:AF030109.1" FT CDS join(complement(AL645949.16:44452..44505), FT complement(AL645949.16:28336..28357), FT complement(AL645949.16:532..701), FT complement(AL645949.16:1..21),3416500..3416571, FT 3417705..3417848,3418640..3418819,3419115..3419268, FT 3422369..3422445,3424103..3424297,3424632..3424705, FT 3425242..3425368,3427191..3427287,3429817..3429896, FT 3430285..3430438,3432134..3432682,3441182..3441411) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-003" FT /standard_name="OTTHUMP00000151172" FT /product="regulator of G-protein signaling 12" FT /protein_id="CAM21452.1" FT /translation="MNLGKELSNETHVSNDQQSATVSDGELTGADLKDCVSNNSLSSNA FT SLPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACEYFN FT HVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDVLRAPHPDMFKEQQLQIF FT NLMKFDSYTRFLKSPLYQECILAEVEGRALPDSQQVPSSPASKHSLGSDHSSVSTPKKL FT SGKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQKKREHGDHADDALHANGGL FT CRRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIHLPDGTSCVVAVKAGFSIKDIL FT SGLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINRSVG FT LKAKPTKPVTEVLRPVVARYGLDLSGLLVRLSGEKEPLDLGAPISSLDGQRVVLEEKDP FT SRGKASADKQKGVPVKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLS FT KREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLRLPP FT GSTELTLPTPAAVAKGFSKRSATGNGRESASQPGEQWEPVQESSDSPSTSPGSASSPPG FT PPGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQSQEVEAGGIQTVEDEHVAELTL FT MGEGDISSPNSTLLPPPSTPQEVPGPSRPGSGTHGSRDLPVNRIIDVDLVTGSAPGRDG FT GIAGAQAGPGRSQASGGPPTSDLPGLGPVPGEPAKPKTSAHHATFV" FT polyA_site complement(3514294) FT misc_feature complement(3512504..3512517) FT /note="Sequence from uni-directional dGTP big dye FT terminator reads only" FT misc_feature complement(3498484..3498566) FT /note="Sequence from overlapping clone RP11-492I23 FT (AC074370).Sequence from uni-directional primer reads only. FT Assembly confirmed by restriction digest" FT polyA_site 3496210 FT polyA_signal 3496190..3496195 FT mRNA join(3487076..3487385,3491404..3491523,3494486..3494612) FT /locus_tag="RP11-529E10.4-003" FT /product="novel protein" FT /note="match: ESTs: Em:DA947822.1 Em:DA962007.1" FT mRNA join(3486271..3486570,3487266..3487385,3491404..3491523, FT 3494486..3496208) FT /locus_tag="RP11-529E10.4-004" FT /product="novel protein" FT /note="match: ESTs: Em:DA767457.1 Em:DA823926.1" FT /note="match: cDNAs: Em:AK096456.1" FT misc_feature complement(3480877) FT /note="Clone_right_end: RP3-368B9" FT CDS join(complement(AL645949.16:96722..98602), FT complement(AL645949.16:71720..71836), FT complement(AL645949.16:28336..28357), FT complement(AL645949.16:532..701), FT complement(AL645949.16:1..21),3416500..3416571, FT 3417705..3417848,3418640..3418819,3419115..3419268, FT 3422369..3422445,3424103..3424297,3424632..3424705, FT 3425242..3425368,3427191..3427287,3429817..3429896, FT 3430285..3430438,3432134..3432682,3441182..3441411) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-001" FT /standard_name="OTTHUMP00000115311" FT /product="regulator of G-protein signaling 12" FT /note="match: proteins: Sw:O14924" FT /protein_id="CAM21453.1" FT /translation="MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLS FT CVMRGSPADFVGLRAGDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGVGRFES FT CSSDEEGGLYEGKGWLKPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASNSEP FT LKLKQRSLSESAATRFDVGHESINNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALD FT ASILNVAMIVGYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCV FT QLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVF FT MVDPDLFNHKIHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEG FT MRARAFLDGDADAHQNNSTSSNSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWD FT GVGGRGAQPWGAPWTGPFCPDPEGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRS FT SVPPSKRGTVGAGCGFNQRWLPVHVLREWQCGHTSDQDSYTDSTDGWSSINCGTLPPPM FT SKIPADRYRVEGSFAQPPLNAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGSKFGRGT FT GLTQPSQRTSARRSFGRSKRFSITRSLDDLESATVSDGELTGADLKDCVSNNSLSSNAS FT LPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACEYFNH FT VPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDVLRAPHPDMFKEQQLQIFN FT LMKFDSYTRFLKSPLYQECILAEVEGRALPDSQQVPSSPASKHSLGSDHSSVSTPKKLS FT GKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQKKREHGDHADDALHANGGLC FT RRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIHLPDGTSCVVAVKAGFSIKDILS FT GLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINRSVGL FT KAKPTKPVTEVLRPVVARYGLDLSGLLVRLSGEKEPLDLGAPISSLDGQRVVLEEKDPS FT RGKASADKQKGVPVKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLSK FT REESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLRLPPG FT STELTLPTPAAVAKGFSKRSATGNGRESASQPGEQWEPVQESSDSPSTSPGSASSPPGP FT PGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQSQEVEAGGIQTVEDEHVAELTLM FT GEGDISSPNSTLLPPPSTPQEVPGPSRPGSGTHGSRDLPVNRIIDVDLVTGSAPGRDGG FT IAGAQAGPGRSQASGGPPTSDLPGLGPVPGEPAKPKTSAHHATFV" FT mRNA join(complement(AL645949.16:96722..98705), FT complement(AL645949.16:71720..71836), FT complement(AL645949.16:28336..28357), FT complement(AL645949.16:532..701), FT complement(AL645949.16:1..21),3416500..3416571, FT 3417705..3417848,3418640..3418819,3419115..3419268, FT 3422369..3422445,3424103..3424297,3424632..3424705, FT 3425242..3425368,3427191..3427287,3429817..3429896, FT 3430285..3430438,3432134..3433977) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-002" FT /product="regulator of G-protein signaling 12" FT /note="match: cDNAs: Em:AF035152.1" FT /note="match: ESTs: Em:CA440016.1 Em:CB529269.1" FT CDS join(complement(AL645949.16:96722..98602), FT complement(AL645949.16:71720..71836), FT complement(AL645949.16:28336..28357), FT complement(AL645949.16:532..701), FT complement(AL645949.16:1..21),3416500..3416571, FT 3417705..3417848,3418640..3418819,3419115..3419268, FT 3422369..3422445,3424103..3424297,3424632..3424705, FT 3425242..3425368,3427191..3427287,3429817..3429896, FT 3430285..3430438,3432134..3432699) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-002" FT /standard_name="OTTHUMP00000115312" FT /product="regulator of G-protein signaling 12" FT /protein_id="CAM21454.1" FT /translation="MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLS FT CVMRGSPADFVGLRAGDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGVGRFES FT CSSDEEGGLYEGKGWLKPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASNSEP FT LKLKQRSLSESAATRFDVGHESINNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALD FT ASILNVAMIVGYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCV FT QLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVF FT MVDPDLFNHKIHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEG FT MRARAFLDGDADAHQNNSTSSNSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWD FT GVGGRGAQPWGAPWTGPFCPDPEGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRS FT SVPPSKRGTVGAGCGFNQRWLPVHVLREWQCGHTSDQDSYTDSTDGWSSINCGTLPPPM FT SKIPADRYRVEGSFAQPPLNAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGSKFGRGT FT GLTQPSQRTSARRSFGRSKRFSITRSLDDLESATVSDGELTGADLKDCVSNNSLSSNAS FT LPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACEYFNH FT VPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDVLRAPHPDMFKEQQLQIFN FT LMKFDSYTRFLKSPLYQECILAEVEGRALPDSQQVPSSPASKHSLGSDHSSVSTPKKLS FT GKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQKKREHGDHADDALHANGGLC FT RRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIHLPDGTSCVVAVKAGFSIKDILS FT GLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINRSVGL FT KAKPTKPVTEVLRPVVARYGLDLSGLLVRLSGEKEPLDLGAPISSLDGQRVVLEEKDPS FT RGKASADKQKGVPVKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLSK FT REESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLRLPPG FT STELTLPTPAAVAKGFSKRSATGNGRESASQPGEQWEPVQESSDSPSTSPGSASSPPGP FT PGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQSQEVEAGGIQTVEDEHVAELTLM FT GEGDISSPNSTLLPPPSTPQEVPGPSRPGTSRF" FT mRNA join(complement(AL645949.16:99824..100626), FT complement(AL645949.16:96722..98703), FT complement(AL645949.16:71720..71836), FT complement(AL645949.16:28336..28357), FT complement(AL645949.16:532..701), FT complement(AL645949.16:1..21),3416500..3416571, FT 3417705..3417848,3418640..3418819,3419115..3419268, FT 3422369..3422445,3424103..3424297,3424632..3424705, FT 3425242..3425368,3427191..3427287,3429817..3429896, FT 3430285..3430438,3432134..3432682,3441182..3441632) FT /gene="RGS12" FT /locus_tag="RP11-529E10.1-001" FT /product="regulator of G-protein signaling 12" FT /note="match: cDNAs: Em:AF030111.1" FT mRNA join(3465038..3465156,3465233..3465278,3475133..3475363, FT 3478069..3478258,3487266..3487385,3491404..3491523, FT 3494486..3496210) FT /locus_tag="RP11-529E10.4-001" FT /product="novel protein" FT /note="match: cDNAs: Em:AK091037.1 Em:AX746744.1" FT mRNA join(3465038..3465156,3465233..3465278,3475133..3475363, FT 3478069..3478269,3487266..3487385,3491404..3491523, FT 3494486..3496210) FT /locus_tag="RP11-529E10.4-002" FT /product="novel protein" FT /note="match: cDNAs: Em:AB220918.1 Em:AB220919.1 FT Em:BC089590.1" FT CDS join(3465103..3465156,3465233..3465278,3475133..3475363, FT 3478069..3478269,3487266..3487385,3491404..3491523, FT 3494486..3495228) FT /locus_tag="RP11-529E10.4-002" FT /standard_name="OTTHUMP00000194785" FT /product="novel protein" FT /note="match: proteins: Sw:Q18PD9.1 Sw:Q18PE0-3.1 FT Sw:Q18PE0.1 Sw:Q18PE1-3.1 Sw:Q18PE1.1" FT /protein_id="CAM21455.1" FT /translation="MTEAALVEGQVKLRDGKKWKSRWLVLRKPSPVADCLLMLVYKDKS FT ERIKGLRERSSLTLEDICGLEPGLPYEGLVHTLAIVCLSQAIMLGFDSHEAMCAWDARI FT RYALGEVHRFHVTVAPGTKLESGPATLHLCNDVLVLARDIPPAVTGQWKLSDLRRYGAV FT PSGFIFEGGTRCGYWAGVFFLSSAEGEQISFLFDCIVRGISPTKGPFGLRPVLPDPSPP FT GPSTVEERVAQEALETLQLEKRLSLLSHAGRPGSGGDDRSLSSSSSEASHLDVSASSRL FT TAWPEQSSSSASTSQEGPRPAAAQAAGEAMVGASRPPPKPLRPRQLQEVGRQSSSDSGI FT ATGSHSSYSSSLSSYAGSSLDVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPT FT SLRAHYDTPRSLCLAPRDHSPPSQGSPGNSAARDSGGQTSAGCPSGWLGTRRRGLVMEA FT PQGSEATLPGPAPGEPWEAGGPHAGPPPAFFSACPVCGGLKVNPPP" FT misc_feature complement(3456465..3456543) FT /note="Sequence from overlapping clone RP3-368B9 (AL121796) FT and 323A24. Assembly confirmed by restriction digest" FT misc_feature complement(3446053..3446105) FT /note="Single clone region. Sequence generated from a FT transposon library derived from a single pUC clone. FT Restriction digest data confirm the assembly" FT misc_feature complement(3445649..3445657) FT /note="Single clone region. Sequence generated from a FT transposon library derived from a single pUC clone. FT Restriction digest data confirm the assembly" FT mRNA join(3443614..3443845,3444459..3444639,3444777..3444873, FT 3445068..3445147,3445766..3445888,3446038..3446169, FT 3446350..3446460,3446546..3446720,3446992..3447077, FT 3447769..3448021,3449219..3449358,3449622..3449762, FT 3449855..3450003,3450964..3451211) FT /gene="HGFAC" FT /locus_tag="RP11-529E10.2-001" FT /product="HGF activator" FT /note="match: ESTs: Em:CK951773.1" FT /note="match: cDNAs: Em:D14012.1" FT CDS join(3443729..3443845,3444459..3444639,3444777..3444873, FT 3445068..3445147,3445766..3445888,3446038..3446169, FT 3446350..3446460,3446546..3446720,3446992..3447077, FT 3447769..3448021,3449219..3449358,3449622..3449762, FT 3449855..3450003,3450964..3451146) FT /gene="HGFAC" FT /locus_tag="RP11-529E10.2-001" FT /standard_name="OTTHUMP00000115316" FT /product="HGF activator" FT /note="match: proteins: Sw:Q04756" FT /protein_id="CAM21456.1" FT /translation="MGRWAWVPSPWPPPGLGPFLLLLLLLLLLPRGFQPQPGGNRTESP FT EPNATATPAIPTILVTSVTSETPATSAPEAEGPQSGGLPPPPRAVPSSSSPQAQALTED FT GRPCRFPFRYGGRMLHACTSEGSAHRKWCATTHNYDRDRAWGYCVEATPPPGGPAALDP FT CASGPCLNGGSCSNTQDPQSYHCSCPRAFTGKDCGTEKCFDETRYEYLEGGDRWARVRQ FT GHVEQCECFGGRTWCEGTRHTACLSSPCLNGGTCHLIVATGTTVCACPPGFAGRLCNIE FT PDERCFLGNGTGYRGVASTSASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRN FT PDNDERPWCYVVKDSALSWEYCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHK FT KRTFLRPRIIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSV FT SVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFV FT QPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGAD FT ISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVA FT NYVDWINDRIRPPRRLVAPS" FT polyA_site 3441632 FT polyA_signal 3441617..3441622 FT polyA_site 3433977 FT polyA_signal 3433958..3433963 FT polyA_site 3433899 FT polyA_signal 3433879..3433884 FT misc_feature complement(3423891..3423977) FT /note="Single clone region. Sequence generated from a FT transposon library derived from a single pUC clone. FT Restriction digest data confirm the assembly" FT misc_feature complement(3420611..3421324) FT /note="Sequence from AC074370 sequenced by UWGC" FT misc_feature complement(3416500) FT /note="Clone_left_end: RP11-529E10" FT misc_feature complement(3621117) FT /note="Tandem repeat. Forced join. Gap size estimated to be FT approximately 210 bp by restriction digest data" FT misc_feature complement(3618736) FT /note="Clone_right_end: RP3-513G18" FT misc_feature complement(3581891..3581922) FT /note="Single clone region. Assembly confirmed by FT restriction digest data" FT misc_feature complement(3581890) FT /note="Tandem repeat. Forced join. Gap size estimated to be FT approximately 70 bp by restriction digest data" FT misc_feature complement(3710982..3711034) FT /note="Sequence from overlapping clone LA04NC01-17A9 FT (Z54335). Assembly confirmed by restriction digest" FT misc_feature complement(3678264..3678559) FT /note="Sequence from overlapping clone LA04NC01-17A9 FT (Z54335) and Sequence from overlapping clone LA04NC01-228A7 FT (Z54272). Assembly confirmed by restriction digest" FT misc_feature complement(3666998) FT /note="Tandem repeat. Forced join. Gap size estimated to be FT approximately 140 bp by restriction digest data" FT misc_feature complement(3666982..3666997) FT /note="Single clone region. Assembly consistent with FT restriction digests" FT misc_feature 3767073..3769789 FT /note="CpG_island (%GC=75.4, o/e=0.87, #CpGs=392)" FT gene 3767430..3770248 FT /gene="ADRA2C" FT mRNA 3767430..3770248 FT /gene="ADRA2C" FT CDS 3768334..3769722 FT /codon_start=1 FT /gene="ADRA2C" FT /product="unknown" FT /note="Homo sapiens adrenergic, alpha-2C-, receptor FT (ADRA2C), mRNA.; H_AA085085A09.1 This gene was based on FT gi(15718672)" FT /protein_id="AAY41059.1" FT /translation="MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQ FT YSAGAVAGLAAVVGFLIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLV FT MPFSLANELMAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKR FT TPRRVKATIVAVWLISAVISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAP FT CLIMGLVYARIYRVAKLRTRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPA FT DVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPG FT PGGRLSRASSRSVEFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFF FT FSYSLYGICREACQVPGPLFKFFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRR FT GFRQ" FT unsure 3770917..3770964 FT /note="Sequence derived from one plasmid subclone." FT misc_feature 3773852..3774062 FT /note="CpG_island (%GC=64.5, o/e=0.74, #CpGs=17)" FT repeat_region 3794864..3794940 FT /rpt_family="CT-rich" FT repeat_region 3795179..3795291 FT /rpt_family="MER1_type" FT repeat_region 3795941..3797712 FT /rpt_family="L1" FT repeat_region 3798635..3798721 FT /rpt_family="MaLR" FT repeat_region 3798759..3798915 FT /rpt_family="MaLR" FT repeat_region 3798929..3799074 FT /rpt_family="MIR" FT repeat_region 3799210..3799309 FT /rpt_family="MER103" FT repeat_region 3801623..3801681 FT /rpt_family="MIR" FT repeat_region 3801695..3801979 FT /rpt_family="Alu" FT repeat_region 3802522..3802650 FT /rpt_family="AcHobo" FT repeat_region 3803194..3803342 FT /rpt_family="MIR" FT repeat_region 3803506..3803689 FT /rpt_family="MER53" FT repeat_region 3803951..3804028 FT /rpt_family="MIR" FT repeat_region 3804734..3804892 FT /rpt_family="MER2_type" FT repeat_region 3805511..3805738 FT /rpt_family="Tip100" FT misc_feature 3806002..3806127 FT /note="similar to EST BF872341 (NID:g12262380)" FT repeat_region 3806224..3806335 FT /rpt_family="MaLR" FT repeat_region 3806336..3806641 FT /rpt_family="Alu" FT repeat_region 3806642..3806831 FT /rpt_family="MaLR" FT repeat_region 3806832..3807260 FT /rpt_family="MaLR" FT repeat_region 3807261..3807357 FT /rpt_family="MaLR" FT repeat_region 3807584..3808010 FT /rpt_family="MaLR" FT repeat_region 3808012..3808305 FT /rpt_family="Alu" FT repeat_region 3808346..3808744 FT /rpt_family="CR1" FT repeat_region 3808752..3808837 FT /rpt_family="(TTCC)n" FT repeat_region 3808855..3809164 FT /rpt_family="Alu" FT repeat_region 3810356..3810482 FT /rpt_family="L1" FT repeat_region 3810505..3810946 FT /rpt_family="L2" FT repeat_region 3811046..3811754 FT /rpt_family="L2" FT repeat_region 3811726..3811888 FT /rpt_family="MIR" FT repeat_region 3812464..3812500 FT /rpt_family="MIR" FT repeat_region 3812501..3812866 FT /rpt_family="MaLR" FT repeat_region 3812867..3812943 FT /rpt_family="MIR" FT repeat_region 3813271..3813373 FT /rpt_family="MIR" FT repeat_region 3814645..3815061 FT /rpt_family="MaLR" FT repeat_region 3815753..3816047 FT /rpt_family="L2" FT repeat_region 3816268..3816422 FT /rpt_family="MIR" FT unsure 3816425..3817652 FT /note="Unresolved tandem repeat." FT repeat_region 3816432..3816523 FT /rpt_family="(CACTA)n" FT repeat_region 3816600..3816774 FT /rpt_family="(CTACT)n" FT repeat_region 3816781..3816891 FT /rpt_family="(CTATA)n" FT repeat_region 3816920..3817097 FT /rpt_family="(CTATA)n" FT repeat_region 3817126..3817198 FT /rpt_family="(CTATA)n" FT repeat_region 3817217..3817257 FT /rpt_family="(CTACT)n" FT repeat_region 3817289..3817432 FT /rpt_family="(CTATA)n" FT repeat_region 3817453..3817593 FT /rpt_family="(TACTG)n" FT repeat_region 3817509..3817678 FT /rpt_family="(CTATA)n" FT repeat_region 3818513..3818588 FT /rpt_family="MIR" FT repeat_region 3819049..3819195 FT /rpt_family="MaLR" FT repeat_region 3819353..3819430 FT /rpt_family="MIR" FT repeat_region 3819458..3819533 FT /rpt_family="L2" FT repeat_region 3820023..3820137 FT /rpt_family="MER1_type" FT repeat_region 3820223..3820567 FT /rpt_family="MaLR" FT repeat_region 3820693..3821031 FT /rpt_family="MaLR" FT repeat_region 3821032..3821448 FT /rpt_family="MaLR" FT repeat_region 3821717..3821797 FT /rpt_family="MaLR" FT repeat_region 3821861..3821927 FT /rpt_family="MaLR" FT repeat_region 3824228..3824692 FT /rpt_family="MaLR" FT repeat_region 3824698..3824890 FT /rpt_family="L1" FT repeat_region 3824894..3825200 FT /rpt_family="Alu" FT repeat_region 3826279..3827274 FT /rpt_family="L2" FT repeat_region 3827315..3827618 FT /rpt_family="MaLR" FT repeat_region 3828289..3828429 FT /rpt_family="MIR" FT repeat_region 3828659..3829016 FT /rpt_family="MaLR" FT repeat_region 3829173..3829210 FT /rpt_family="(TG)n" FT repeat_region 3830056..3830122 FT /rpt_family="MER1_type" FT repeat_region 3830382..3830522 FT /rpt_family="CR1" FT repeat_region 3830558..3830627 FT /rpt_family="MIR" FT repeat_region 3830799..3830933 FT /rpt_family="MER1_type" FT repeat_region 3831425..3831539 FT /rpt_family="L2" FT repeat_region 3832745..3832921 FT /rpt_family="ERVL" FT repeat_region 3833308..3833494 FT /rpt_family="L2" FT repeat_region 3833541..3833584 FT /rpt_family="(TG)n" FT repeat_region 3833849..3834024 FT /rpt_family="MIR" FT repeat_region 3834025..3834391 FT /rpt_family="MaLR" FT repeat_region 3834392..3834445 FT /rpt_family="MIR" FT repeat_region 3835707..3835908 FT /rpt_family="L2" FT repeat_region 3836643..3836892 FT /rpt_family="GA-rich" FT repeat_region 3837575..3837704 FT /rpt_family="MIR" FT repeat_region 3837775..3837864 FT /rpt_family="MIR" FT repeat_region 3839757..3840060 FT /rpt_family="MaLR" FT repeat_region 3840141..3840246 FT /rpt_family="MaLR" FT repeat_region 3841693..3841849 FT /rpt_family="ERVL" FT repeat_region 3842474..3842910 FT /rpt_family="MER1_type" FT repeat_region 3843130..3843240 FT /rpt_family="MaLR" FT repeat_region 3843425..3843704 FT /rpt_family="Alu" FT repeat_region 3843868..3843998 FT /rpt_family="MER1_type" FT repeat_region 3844036..3844068 FT /rpt_family="AT_rich" FT repeat_region 3844080..3844204 FT /rpt_family="MER1_type" FT repeat_region 3844205..3845011 FT /rpt_family="ERV1" FT repeat_region 3845210..3845303 FT /rpt_family="MER1_type" FT repeat_region 3845373..3845514 FT /rpt_family="MIR" FT repeat_region 3846388..3846744 FT /rpt_family="L1" FT repeat_region 3846745..3847102 FT /rpt_family="MaLR" FT repeat_region 3847103..3847537 FT /rpt_family="L1" FT repeat_region 3847630..3847694 FT /rpt_family="MIR" FT repeat_region 3847686..3847764 FT /rpt_family="L2" FT repeat_region 3847833..3847906 FT /rpt_family="MIR" FT repeat_region 3848115..3848462 FT /rpt_family="MaLR" FT repeat_region 3849294..3850723 FT /rpt_family="ERV1" FT repeat_region 3850741..3850865 FT /rpt_family="MaLR" FT repeat_region 3851326..3851355 FT /rpt_family="MaLR" FT repeat_region 3851356..3851769 FT /rpt_family="MaLR" FT repeat_region 3851770..3852149 FT /rpt_family="MaLR" FT repeat_region 3852671..3852766 FT /rpt_family="L2" FT repeat_region 3852920..3853043 FT /rpt_family="MIR" FT repeat_region 3853499..3853695 FT /rpt_family="L1" FT repeat_region 3853696..3854042 FT /rpt_family="MaLR" FT repeat_region 3854043..3854054 FT /rpt_family="L1" FT repeat_region 3854055..3854293 FT /rpt_family="ERV1" FT repeat_region 3854294..3854329 FT /rpt_family="(CCCCG)n" FT repeat_region 3854330..3854805 FT /rpt_family="ERV1" FT repeat_region 3854806..3854821 FT /rpt_family="L1" FT repeat_region 3856006..3856152 FT /rpt_family="L1" FT repeat_region 3856992..3857180 FT /rpt_family="MIR" FT repeat_region 3857112..3857200 FT /rpt_family="MIR" FT repeat_region 3857531..3857653 FT /rpt_family="L2" FT repeat_region 3857779..3857896 FT /rpt_family="L2" FT repeat_region 3858154..3858318 FT /rpt_family="MIR" FT repeat_region 3859465..3859531 FT /rpt_family="MIR" FT unsure 3859704..3859744 FT /note="Sequence derived from one plasmid subclone." FT repeat_region 3860352..3860423 FT /rpt_family="L2" FT repeat_region 3860416..3860499 FT /rpt_family="L2" FT repeat_region 3860546..3860629 FT /rpt_family="L2" FT repeat_region 3860770..3860818 FT /rpt_family="L2" FT repeat_region 3860820..3860907 FT /rpt_family="L2" FT repeat_region 3860965..3861013 FT /rpt_family="L2" FT repeat_region 3861085..3861168 FT /rpt_family="L2" FT repeat_region 3861150..3861209 FT /rpt_family="L2" FT repeat_region 3861215..3861298 FT /rpt_family="L2" FT repeat_region 3861345..3861400 FT /rpt_family="L2" FT repeat_region 3861411..3861458 FT /rpt_family="L2" FT repeat_region 3862001..3862128 FT /rpt_family="L2" FT repeat_region 3862129..3862669 FT /rpt_family="MaLR" FT repeat_region 3862833..3862999 FT /rpt_family="L2" FT repeat_region 3863549..3863718 FT /rpt_family="(CA)n" FT repeat_region 3863750..3864049 FT /rpt_family="(CA)n" FT repeat_region 3865311..3865685 FT /rpt_family="L1" FT repeat_region 3866316..3866415 FT /rpt_family="MIR" FT repeat_region 3868668..3869068 FT /rpt_family="MaLR" FT repeat_region 3869558..3869628 FT /rpt_family="L2" FT repeat_region 3869774..3870171 FT /rpt_family="MaLR" FT repeat_region 3871014..3871415 FT /rpt_family="MaLR" FT repeat_region 3872617..3872739 FT /rpt_family="(CAGAGA)n" FT repeat_region 3872776..3872886 FT /rpt_family="(CAGAGA)n" FT misc_feature 3873093..3874011 FT /note="CpG_island (%GC=70.8, o/e=0.90, #CpGs=91)" FT repeat_region 3873550..3873672 FT /rpt_family="G-rich" FT repeat_region 3873856..3873920 FT /rpt_family="MIR" FT repeat_region 3874303..3874336 FT /rpt_family="(TGGG)n" FT repeat_region 3874936..3875050 FT /rpt_family="L2" FT repeat_region 3875569..3875675 FT /rpt_family="(CAGGG)n" FT repeat_region 3876178..3877239 FT /rpt_family="L1" FT repeat_region 3878492..3878530 FT /rpt_family="MIR" FT repeat_region 3878602..3878648 FT /rpt_family="L1" FT repeat_region 3878649..3879118 FT /rpt_family="ERVL" FT repeat_region 3879119..3879928 FT /rpt_family="L1" FT repeat_region 3879929..3880174 FT /rpt_family="MER1_type" FT repeat_region 3880504..3880682 FT /rpt_family="L1" FT repeat_region 3881016..3881453 FT /rpt_family="ERV1" FT repeat_region 3882560..3882666 FT /rpt_family="GA-rich" FT repeat_region 3882756..3882861 FT /rpt_family="MIR" FT misc_feature 3883373..3883947 FT /note="similar to EST BG911468 (NID:g14291944)" FT misc_feature 3883373..3883748 FT /note="similar to EST BM673886 (NID:g18983784)" FT misc_feature 3883580..3883957 FT /note="similar to EST BF914982 (NID:g12306440)" FT repeat_region 3883820..3884141 FT /rpt_family="Alu" FT misc_feature 3884471..3884972 FT /note="similar to EST BU570327 (NID:g22920627)" FT repeat_region 3884536..3884749 FT /rpt_family="MIR" FT misc_feature 3884565..3884896 FT /note="similar to EST AV730543 (NID:g10839964)" FT repeat_region 3885078..3886079 FT /rpt_family="ERVK" FT misc_feature 3885488..3885948 FT /note="similar to EST BF105997 (NID:g10888523)" FT misc_feature 3886171..3886590 FT /note="similar to EST AW194462 (NID:g6473281) xm09a10.x1" FT misc_feature 3886189..3886559 FT /note="similar to EST AI830758 (NID:g5451514) wj10h10.x1" FT repeat_region 3886546..3886574 FT /rpt_family="AT_rich" FT repeat_region 3886595..3886846 FT /rpt_family="L1" FT repeat_region 3886847..3887129 FT /rpt_family="Alu" FT repeat_region 3887130..3887219 FT /rpt_family="L1" FT repeat_region 3887220..3887247 FT /rpt_family="(TTTG)n" FT repeat_region 3887250..3887544 FT /rpt_family="Alu" FT repeat_region 3887545..3888544 FT /rpt_family="L1" FT repeat_region 3888590..3888897 FT /rpt_family="Alu" FT repeat_region 3888947..3889180 FT /rpt_family="L1" FT repeat_region 3889181..3889464 FT /rpt_family="Alu" FT repeat_region 3889465..3889647 FT /rpt_family="L1" FT repeat_region 3889686..3889826 FT /rpt_family="Tc2" FT repeat_region 3889834..3890158 FT /rpt_family="Alu" FT misc_feature 3890091..3890382 FT /note="similar to EST AA091411 (NID:g1636874)" FT misc_feature 3890214..3890878 FT /note="similar to EST N99107 (NID:g1270673) yy67h07.r1" FT repeat_region 3890302..3890450 FT /rpt_family="MER1_type" FT misc_feature 3890525..3890909 FT /note="similar to EST AA219163 (NID:g1833237) zq16c11.r1" FT repeat_region 3890556..3890752 FT /rpt_family="MER2_type" FT misc_feature 3890625..3891282 FT /note="similar to EST BF062364 (NID:g10821274)" FT misc_feature 3890625..3891166 FT /note="similar to EST BE501015 (NID:g9703423)" FT misc_feature 3890689..3891264 FT /note="similar to EST H49406 (NID:g989247) yq19f08.s1" FT misc_feature 3890833..3890927 FT /note="similar to EST AA093222 (NID:g1638619)" FT misc_feature 3890989..3891672 FT /note="similar to EST AW009208 (NID:g5857986) ws79a10.x1" FT misc_feature 3890989..3891500 FT /note="similar to EST BX099017 (NID:g27829752)" FT misc_feature 3890989..3891283 FT /note="similar to EST R26061 (NID:g782196) yh39c04.s1" FT misc_feature 3890990..3891490 FT /note="similar to EST BM021254 (NID:g16535610) ie78f04.x1" FT misc_feature 3891176..3891796 FT /note="similar to EST BG117417 (NID:g12610923)" FT misc_feature 3891203..3891961 FT /note="similar to EST BF345274 (NID:g11292799)" FT misc_feature 3891315..3892003 FT /note="similar to EST BI087915 (NID:g14506245)" FT misc_feature 3891341..3892011 FT /note="similar to EST CB244830 (NID:g28366474)" FT misc_feature 3891433..3891575 FT /note="similar to EST BG182279 (NID:g13703966)" FT misc_feature 3891459..3891628 FT /note="similar to EST BG995764 (NID:g14399834)" FT misc_feature 3891813..3892001 FT /note="similar to EST BG117417 (NID:g12610923)" FT misc_feature 3892059..3892599 FT /note="similar to EST BE504987 (NID:g9707395) hz38h11.x1" FT misc_feature 3892342..3892602 FT /note="similar to EST BG182279 (NID:g13703966)" FT misc_feature 3892381..3892593 FT /note="similar to EST AW026780 (NID:g5880310) wv44h08.x1" FT misc_feature 3892383..3892845 FT /note="similar to EST AI821660 (NID:g5440739) zv46d07.x5" FT repeat_region 3892645..3892862 FT /rpt_family="Alu" FT repeat_region 3892864..3893255 FT /rpt_family="SATR2" FT repeat_region 3893226..3894035 FT /rpt_family="SATR1" FT repeat_region 3894062..3895054 FT /rpt_family="SATR1" FT repeat_region 3898925..3899068 FT /rpt_family="(TAA)n" FT repeat_region 3899134..3899155 FT /rpt_family="AT_rich" FT repeat_region 3899249..3900095 FT /rpt_family="SATR1" FT repeat_region 3900109..3902768 FT /rpt_family="SATR2" FT repeat_region 3902786..3903226 FT /rpt_family="SATR2" FT misc_feature 3903219..3903652 FT /note="similar to EST AU144503 (NID:g11006024)" FT misc_feature 3903223..3903796 FT /note="similar to EST BI495655 (NID:g15334999)" FT misc_feature 3903223..3903761 FT /note="similar to EST BI495654 (NID:g15334998)" FT misc_feature 3903333..3903652 FT /note="similar to EST BF062963 (NID:g10821873)" FT misc_feature 3903394..3903770 FT /note="similar to EST BG188946 (NID:g13710633)" FT misc_feature 3903406..3903770 FT /note="similar to EST BG204873 (NID:g13726560)" FT misc_feature 3903451..3903780 FT /note="similar to EST BM955917 (NID:g23346148)" FT misc_feature 3903457..3903652 FT /note="similar to EST BE067731 (NID:g8412381)" FT misc_feature 3903488..3904282 FT /note="similar to EST BG218617 (NID:g13744638)" FT misc_feature 3903495..3903770 FT /note="similar to EST BM684956 (NID:g18994852)" FT /note="similar to EST BM931903 (NID:g19391076)" FT misc_feature 3903517..3903652 FT /note="similar to EST BE858875 (NID:g10374366)" FT misc_feature 3903546..3903770 FT /note="similar to EST BG182159 (NID:g13703846)" FT misc_feature 3903615..3903770 FT /note="similar to EST AI766441 (NID:g5232950) wh60h03.x1" FT /note="similar to EST BM702886 (NID:g19016144)" FT misc_feature 3903617..3903770 FT /note="similar to EST BG818506 (NID:g14166093)" FT misc_feature 3903618..3903770 FT /note="similar to EST AA931563 (NID:g3085949) oo56d01.s1" FT /note="similar to EST BG193651 (NID:g13715338)" FT misc_feature 3903623..3903773 FT /note="similar to EST AI017096 (NID:g3231432) ou31h02.x1" FT /note="similar to EST BI825317 (NID:g15936867)" FT misc_feature 3903624..3903770 FT /note="similar to EST CA420830 (NID:g24783485)" FT misc_feature 3903625..3903770 FT /note="similar to EST BQ448630 (NID:g21251742)" FT misc_feature 3903644..3903770 FT /note="similar to EST BE674166 (NID:g10034707)" FT misc_feature 3903677..3903780 FT /note="similar to EST BE858875 (NID:g10374366)" FT misc_feature 3903677..3903775 FT /note="similar to EST AU144503 (NID:g11006024)" FT misc_feature 3903677..3903764 FT /note="similar to EST BF062963 (NID:g10821873)" FT misc_feature 3903677..3903737 FT /note="similar to EST BE067731 (NID:g8412381)" FT repeat_region 3903777..3903814 FT /rpt_family="(CAAAA)n" FT misc_feature 3903797..3904220 FT /note="similar to EST BG204873 (NID:g13726560)" FT misc_feature 3903797..3904176 FT /note="similar to EST BG818506 (NID:g14166093)" FT misc_feature 3903797..3903949 FT /note="similar to EST BE674166 (NID:g10034707)" FT misc_feature 3903802..3904278 FT /note="similar to EST BG193651 (NID:g13715338)" FT misc_feature 3903802..3904220 FT /note="similar to EST BG182159 (NID:g13703846)" FT /note="similar to EST BG188946 (NID:g13710633)" FT misc_feature 3903802..3904216 FT /note="similar to EST CA420830 (NID:g24783485)" FT misc_feature 3903802..3904206 FT /note="similar to EST BQ448630 (NID:g21251742)" FT misc_feature 3903802..3904087 FT /note="similar to EST AA931563 (NID:g3085949) oo56d01.s1" FT misc_feature 3903802..3904069 FT /note="similar to EST BM702886 (NID:g19016144)" FT misc_feature 3903802..3904016 FT /note="similar to EST AI766441 (NID:g5232950) wh60h03.x1" FT misc_feature 3903802..3903959 FT /note="similar to EST BM931903 (NID:g19391076)" FT misc_feature 3903802..3903945 FT /note="similar to EST BM684956 (NID:g18994852)" FT misc_feature 3903833..3904384 FT /note="similar to EST BX098784 (NID:g27843795)" FT misc_feature 3903833..3904334 FT /note="similar to EST AA042813 (NID:g1522468) zk53c07.s1" FT misc_feature 3903834..3904206 FT /note="similar to EST BM826502 (NID:g19182911)" FT misc_feature 3903834..3904079 FT /note="similar to EST BM911755 (NID:g19362134)" FT misc_feature 3903896..3904293 FT /note="similar to EST AV713699 (NID:g10795216)" FT misc_feature 3904040..3904216 FT /note="similar to EST BM832926 (NID:g19189335)" FT misc_feature 3904045..3904434 FT /note="similar to EST H78008 (NID:g1056097) yu82h12.r1" FT misc_feature 3904054..3904221 FT /note="similar to EST AA909905 (NID:g3049195) oj93c04.s2" FT misc_feature 3904104..3904472 FT /note="similar to EST BE709727 (NID:g10097992)" FT misc_feature 3904254..3904475 FT /note="similar to EST BQ327599 (NID:g20944906)" FT misc_feature 3904285..3904553 FT /note="similar to EST AI371376 (NID:g4150129) qo83f11.x1" FT misc_feature 3904310..3904953 FT /note="similar to EST BG203046 (NID:g13724733)" FT misc_feature 3904319..3904487 FT /note="similar to EST BM826502 (NID:g19182911)" FT misc_feature 3904319..3904446 FT /note="similar to EST BQ448630 (NID:g21251742)" FT misc_feature 3904355..3904579 FT /note="similar to EST AV713699 (NID:g10795216)" FT misc_feature 3904412..3904873 FT /note="similar to EST AW391026 (NID:g6895685)" FT misc_feature 3904688..3905069 FT /note="similar to EST AI301661 (NID:g3961007) qn46c09.x1" FT repeat_region 3904939..3905242 FT /rpt_family="Alu" FT misc_feature 3905175..3905681 FT /note="similar to EST BF899781 (NID:g12291240)" FT repeat_region 3905301..3905436 FT /rpt_family="L2" FT misc_feature 3905484..3905811 FT /note="similar to EST BI462381 (NID:g15253037)" FT misc_feature 3905579..3905649 FT /note="similar to EST BF667064 (NID:g11940959)" FT repeat_region 3905800..3906113 FT /rpt_family="Alu" FT misc_feature 3905835..3906112 FT /note="similar to EST BI462381 (NID:g15253037)" FT misc_feature 3905927..3906845 FT /note="similar to EST BQ881879 (NID:g22273887)" FT misc_feature 3906145..3906662 FT /note="similar to EST BG029979 (NID:g12419076)" FT misc_feature 3906231..3906941 FT /note="similar to EST BU569859 (NID:g22920159)" FT misc_feature 3906345..3906662 FT /note="similar to EST AW451324 (NID:g6992100)" FT repeat_region 3906508..3906727 FT /rpt_family="MIR" FT misc_feature 3906697..3907107 FT /note="similar to EST BE165573 (NID:g8628294)" FT repeat_region 3907048..3908062 FT /rpt_family="ERVK" FT misc_feature 3907903..3908179 FT /note="similar to EST BF105997 (NID:g10888523)" FT misc_feature 3908107..3908382 FT /note="similar to EST BF667064 (NID:g11940959)" FT repeat_region 3908524..3908554 FT /rpt_family="AT_rich" FT repeat_region 3908578..3908826 FT /rpt_family="L1" FT repeat_region 3908827..3909121 FT /rpt_family="Alu" FT repeat_region 3909122..3909227 FT /rpt_family="L1" FT repeat_region 3909228..3909542 FT /rpt_family="Alu" FT repeat_region 3909607..3909632 FT /rpt_family="(TA)n" FT repeat_region 3909669..3909953 FT /rpt_family="Alu" FT repeat_region 3910140..3910258 FT /rpt_family="MER1_type" FT repeat_region 3910280..3910360 FT /rpt_family="L2" FT repeat_region 3910361..3910413 FT /rpt_family="Mariner" FT repeat_region 3910414..3910716 FT /rpt_family="Alu" FT repeat_region 3910717..3910751 FT /rpt_family="Mariner" FT repeat_region 3910752..3911220 FT /rpt_family="L2" FT misc_feature 3910996..3911378 FT /note="similar to EST BF740918 (NID:g12067503)" FT repeat_region 3911918..3911953 FT /rpt_family="CR1" FT repeat_region 3912727..3912781 FT /rpt_family="ERV1" FT repeat_region 3912811..3912985 FT /rpt_family="(CA)n" FT repeat_region 3912999..3913152 FT /rpt_family="(CA)n" FT repeat_region 3913164..3913577 FT /rpt_family="(CA)n" FT unsure 3920831..3921086 FT /note="Unresolved tandem repeat." FT misc_feature 3931079..3932360 FT /note="Sequence derived from PCR product of project DNA" FT misc_feature 3986922..3987037 FT /note="Sequence derived from PCR product of project DNA" FT unsure 4003659..4003678 FT /note="Sequence derived from one plasmid subclone." FT misc_feature 4003843..4004693 FT /note="Sequence derived from PCR product of project DNA" FT unsure 4005759..4005766 FT /note="Sequence derived from one plasmid subclone." FT unsure 4005977..4006052 FT /note="Sequence derived from one plasmid subclone." FT misc_feature 4016490..4016507 FT /note="Sequence derived from PCR product of project DNA" FT repeat_region 4021526..4021820 FT /rpt_family="L2" FT repeat_region 4021820..4022051 FT /rpt_family="L2" FT repeat_region 4022120..4022433 FT /rpt_family="Alu" FT repeat_region 4022459..4022737 FT /rpt_family="Alu" FT repeat_region 4023056..4023078 FT /rpt_family="(CAG)n" FT repeat_region 4023256..4023386 FT /rpt_family="L1" FT repeat_region 4023394..4023732 FT /rpt_family="Alu" FT repeat_region 4023894..4024199 FT /rpt_family="Alu" FT repeat_region 4024366..4024660 FT /rpt_family="Alu" FT repeat_region 4024661..4025010 FT /rpt_family="L1" FT repeat_region 4025020..4025141 FT /rpt_family="MER1_type" FT repeat_region 4025526..4025680 FT /rpt_family="MIR" FT repeat_region 4025891..4026055 FT /rpt_family="MaLR" FT repeat_region 4026065..4026127 FT /rpt_family="MIR" FT repeat_region 4026830..4027135 FT /rpt_family="Alu" FT repeat_region 4027560..4027598 FT /rpt_family="MaLR" FT repeat_region 4027661..4027954 FT /rpt_family="ERVL" FT repeat_region 4027959..4028260 FT /rpt_family="Alu" FT repeat_region 4028414..4028671 FT /rpt_family="MaLR" FT repeat_region 4028870..4029127 FT /rpt_family="Alu" FT repeat_region 4029400..4029436 FT /rpt_family="(TG)n" FT repeat_region 4029437..4029604 FT /rpt_family="MaLR" FT repeat_region 4029605..4029647 FT /rpt_family="ERV1" FT repeat_region 4029649..4029725 FT /rpt_family="Alu" FT repeat_region 4029726..4030000 FT /rpt_family="Alu" FT repeat_region 4030002..4030431 FT /rpt_family="ERV1" FT repeat_region 4030586..4030795 FT /rpt_family="MaLR" FT repeat_region 4031414..4031711 FT /rpt_family="Alu" FT repeat_region 4031968..4032525 FT /rpt_family="ERV1" FT repeat_region 4032526..4032842 FT /rpt_family="ERV1" FT repeat_region 4038852..4039301 FT /rpt_family="ERV1" FT repeat_region 4039300..4039646 FT /rpt_family="MaLR" FT repeat_region 4039646..4039764 FT /rpt_family="MER1_type" FT repeat_region 4039809..4040104 FT /rpt_family="Alu" FT repeat_region 4040105..4040231 FT /rpt_family="Alu" FT repeat_region 4040253..4040398 FT /rpt_family="CR1" FT repeat_region 4041065..4041235 FT /rpt_family="L2" FT repeat_region 4041236..4041553 FT /rpt_family="Alu" FT repeat_region 4041554..4041565 FT /rpt_family="L2" FT repeat_region 4041656..4041963 FT /rpt_family="Alu" FT repeat_region 4041965..4042653 FT /rpt_family="L2" FT repeat_region 4042663..4043737 FT /rpt_family="ERVK" FT repeat_region 4043770..4043849 FT /rpt_family="L2" FT repeat_region 4043850..4044916 FT /rpt_family="ERVK" FT repeat_region 4044917..4045915 FT /rpt_family="ERVK" FT repeat_region 4045900..4047131 FT /rpt_family="ERVK" FT repeat_region 4049043..4049828 FT /rpt_family="ERVK" FT repeat_region 4049829..4050887 FT /rpt_family="ERVK" FT repeat_region 4050889..4050947 FT /rpt_family="L2" FT repeat_region 4051285..4051354 FT /rpt_family="MaLR" FT repeat_region 4051355..4051646 FT /rpt_family="Alu" FT repeat_region 4051647..4051902 FT /rpt_family="MaLR" FT repeat_region 4052071..4052374 FT /rpt_family="Alu" FT repeat_region 4052386..4052955 FT /rpt_family="MaLR" FT repeat_region 4053086..4053402 FT /rpt_family="Alu" FT repeat_region 4053405..4053572 FT /rpt_family="ERV1" FT repeat_region 4053601..4054570 FT /rpt_family="L1" FT repeat_region 4054571..4055016 FT /rpt_family="MaLR" FT repeat_region 4055301..4055597 FT /rpt_family="Alu" FT repeat_region 4055687..4055869 FT /rpt_family="MER1_type" FT repeat_region 4055957..4056083 FT /rpt_family="MER1_type" FT repeat_region 4056102..4056409 FT /rpt_family="Alu" FT repeat_region 4056415..4056693 FT /rpt_family="L1" FT repeat_region 4056694..4056839 FT /rpt_family="L1" FT repeat_region 4056855..4056898 FT /rpt_family="MER1_type" FT repeat_region 4057096..4057305 FT /rpt_family="Alu" FT repeat_region 4057432..4057732 FT /rpt_family="Alu" FT repeat_region 4057783..4057847 FT /rpt_family="MIR" FT repeat_region 4057889..4057990 FT /rpt_family="L2" FT repeat_region 4057991..4058282 FT /rpt_family="Alu" FT repeat_region 4058283..4058434 FT /rpt_family="L2" FT repeat_region 4058435..4058638 FT /rpt_family="L1" FT repeat_region 4058642..4058814 FT /rpt_family="Alu" FT repeat_region 4058815..4059190 FT /rpt_family="L1" FT repeat_region 4059361..4059591 FT /rpt_family="MER1_type" FT repeat_region 4059859..4060171 FT /rpt_family="Alu" FT repeat_region 4061126..4061248 FT /rpt_family="MaLR" FT repeat_region 4061421..4061522 FT /rpt_family="MaLR" FT repeat_region 4061699..4061995 FT /rpt_family="Alu" FT repeat_region 4062114..4062325 FT /rpt_family="MER1_type" FT repeat_region 4062951..4063250 FT /rpt_family="Alu" FT repeat_region 4064305..4064461 FT /rpt_family="Alu" FT repeat_region 4064726..4065083 FT /rpt_family="MaLR" FT repeat_region 4066686..4067039 FT /rpt_family="MaLR" FT repeat_region 4069217..4069514 FT /rpt_family="Alu" FT repeat_region 4070011..4070311 FT /rpt_family="Alu" FT repeat_region 4070313..4070381 FT /rpt_family="L1" FT repeat_region 4070385..4070886 FT /rpt_family="(TA)n" FT repeat_region 4070887..4071336 FT /rpt_family="L1" FT repeat_region 4071337..4071597 FT /rpt_family="L1" FT repeat_region 4071565..4072152 FT /rpt_family="L1" FT repeat_region 4072211..4072420 FT /rpt_family="L1" FT repeat_region 4072423..4073075 FT /rpt_family="L1" FT repeat_region 4073076..4073388 FT /rpt_family="Alu" FT repeat_region 4073389..4074539 FT /rpt_family="L1" FT repeat_region 4074543..4074721 FT /rpt_family="L1" FT repeat_region 4075124..4075584 FT /rpt_family="ERVK" FT repeat_region 4075598..4075694 FT /rpt_family="GA-rich" FT repeat_region 4075831..4076014 FT /rpt_family="ERVK" FT repeat_region 4076017..4077040 FT /rpt_family="ERVK" FT repeat_region 4077591..4077677 FT /rpt_family="L1" FT repeat_region 4077678..4077798 FT /rpt_family="MIR" FT repeat_region 4077921..4077976 FT /rpt_family="MER1_type" FT repeat_region 4077977..4078038 FT /rpt_family="(TATG)n" FT repeat_region 4078041..4078188 FT /rpt_family="Alu" FT repeat_region 4078194..4078363 FT /rpt_family="Alu" FT repeat_region 4079241..4079294 FT /rpt_family="Alu" FT repeat_region 4079297..4079520 FT /rpt_family="Alu" FT repeat_region 4079593..4079800 FT /rpt_family="L1" FT repeat_region 4079805..4080018 FT /rpt_family="L1" FT repeat_region 4080013..4080176 FT /rpt_family="L1" FT repeat_region 4080177..4080499 FT /rpt_family="Alu" FT repeat_region 4080500..4080662 FT /rpt_family="L1" FT repeat_region 4081290..4081312 FT /rpt_family="L2" FT repeat_region 4081313..4081598 FT /rpt_family="Alu" FT repeat_region 4081599..4081675 FT /rpt_family="L2" FT repeat_region 4081806..4082098 FT /rpt_family="Alu" FT repeat_region 4082450..4082537 FT /rpt_family="L1" FT repeat_region 4082538..4082849 FT /rpt_family="Alu" FT repeat_region 4082850..4082997 FT /rpt_family="L1" FT repeat_region 4082998..4083218 FT /rpt_family="MER1_type" FT repeat_region 4083219..4083273 FT /rpt_family="L1" FT repeat_region 4083343..4083363 FT /rpt_family="AT_rich" FT repeat_region 4084388..4084417 FT /rpt_family="(CA)n" FT repeat_region 4084438..4084736 FT /rpt_family="MaLR" FT repeat_region 4086087..4086165 FT /rpt_family="Mariner" FT repeat_region 4086333..4086362 FT /rpt_family="(CCA)n" FT repeat_region 4086750..4087208 FT /rpt_family="ERVL" FT repeat_region 4087224..4087305 FT /rpt_family="L2" FT repeat_region 4087587..4087885 FT /rpt_family="Alu" FT repeat_region 4088145..4088317 FT /rpt_family="L1" FT repeat_region 4088547..4088810 FT /rpt_family="Alu" FT repeat_region 4089404..4089703 FT /rpt_family="Alu" FT repeat_region 4090255..4090413 FT /rpt_family="MER1_type" FT repeat_region 4090711..4091001 FT /rpt_family="Alu" FT repeat_region 4091140..4091431 FT /rpt_family="L1" FT repeat_region 4091432..4091456 FT /rpt_family="(TAA)n" FT repeat_region 4091465..4091767 FT /rpt_family="Alu" FT repeat_region 4092061..4092111 FT /rpt_family="MER1_type" FT repeat_region 4092234..4092327 FT /rpt_family="MIR" FT repeat_region 4092676..4092980 FT /rpt_family="Alu" FT repeat_region 4093096..4093201 FT /rpt_family="MIR" FT repeat_region 4093399..4093516 FT /rpt_family="L2" FT repeat_region 4093613..4093827 FT /rpt_family="MIR" FT repeat_region 4093810..4093886 FT /rpt_family="L2" FT repeat_region 4093902..4094136 FT /rpt_family="(TGGA)n" FT repeat_region 4094186..4094333 FT /rpt_family="(TGGA)n" FT repeat_region 4095371..4095495 FT /rpt_family="MIR" FT repeat_region 4095524..4095901 FT /rpt_family="L2" FT repeat_region 4096191..4096496 FT /rpt_family="Alu" FT repeat_region 4097208..4097392 FT /rpt_family="MER53" FT repeat_region 4097984..4098079 FT /rpt_family="MIR" FT repeat_region 4098402..4098586 FT /rpt_family="L1" FT repeat_region 4098768..4099050 FT /rpt_family="L1" FT repeat_region 4099156..4099474 FT /rpt_family="Alu" FT repeat_region 4100100..4100407 FT /rpt_family="Alu" FT repeat_region 4101371..4101566 FT /rpt_family="MER1_type" FT repeat_region 4101974..4102149 FT /rpt_family="L1" FT repeat_region 4102150..4102460 FT /rpt_family="Alu" FT repeat_region 4102461..4102798 FT /rpt_family="L1" FT repeat_region 4102834..4102855 FT /rpt_family="AT_rich" FT repeat_region 4102871..4103169 FT /rpt_family="Alu" FT repeat_region 4103370..4103401 FT /rpt_family="AT_rich" FT repeat_region 4103402..4103608 FT /rpt_family="Alu" FT repeat_region 4103609..4103769 FT /rpt_family="L2" FT repeat_region 4104948..4105242 FT /rpt_family="Alu" FT repeat_region 4105246..4105429 FT /rpt_family="MIR" FT repeat_region 4105459..4105689 FT /rpt_family="MER1_type" FT repeat_region 4106982..4107006 FT /rpt_family="(TC)n" FT repeat_region 4107007..4107301 FT /rpt_family="Alu" FT repeat_region 4107385..4107628 FT /rpt_family="MIR" FT misc_feature 4108735..4109499 FT /note="CpG_island (%GC=74.0, o/e=0.80, #CpGs=89)" FT repeat_region 4108932..4108997 FT /rpt_family="C-rich" FT repeat_region 4109742..4110215 FT /rpt_family="L2" FT repeat_region 4110664..4110773 FT /rpt_family="L2" FT repeat_region 4110864..4110981 FT /rpt_family="MIR" FT repeat_region 4111002..4111604 FT /rpt_family="ERVL" FT repeat_region 4111610..4111669 FT /rpt_family="MIR" FT repeat_region 4111922..4112238 FT /rpt_family="Alu" FT repeat_region 4112477..4112777 FT /rpt_family="Alu" FT repeat_region 4113420..4113476 FT /rpt_family="GA-rich" FT repeat_region 4113567..4113794 FT /rpt_family="Alu" FT repeat_region 4113797..4113959 FT /rpt_family="L2" FT repeat_region 4113966..4114050 FT /rpt_family="MER1_type" FT repeat_region 4114181..4114363 FT /rpt_family="L2" FT repeat_region 4114364..4114662 FT /rpt_family="Alu" FT repeat_region 4114663..4115349 FT /rpt_family="L2" FT repeat_region 4115600..4115619 FT /rpt_family="(CAA)n" FT repeat_region 4116564..4116855 FT /rpt_family="Alu" FT repeat_region 4116946..4118342 FT /rpt_family="ERV1" FT repeat_region 4118451..4118539 FT /rpt_family="MIR" FT repeat_region 4118621..4118753 FT /rpt_family="L1" FT repeat_region 4118754..4119135 FT /rpt_family="MaLR" FT repeat_region 4119136..4119528 FT /rpt_family="L1" FT repeat_region 4119556..4119654 FT /rpt_family="L1" FT repeat_region 4120790..4121101 FT /rpt_family="Alu" FT repeat_region 4121496..4121705 FT /rpt_family="MIR" FT repeat_region 4122036..4123065 FT /rpt_family="ERVK" FT repeat_region 4123526..4123556 FT /rpt_family="AT_rich" FT repeat_region 4123577..4123827 FT /rpt_family="L1" FT repeat_region 4123828..4124111 FT /rpt_family="Alu" FT repeat_region 4124112..4124251 FT /rpt_family="L1" FT repeat_region 4124252..4124551 FT /rpt_family="Alu" FT repeat_region 4124473..4124547 FT /rpt_family="Alu" FT repeat_region 4124549..4125546 FT /rpt_family="L1" FT repeat_region 4125592..4125892 FT /rpt_family="Alu" FT misc_feature 4125729..4125731 FT /note="similar to Homo sapiens EST AA909905 (NID:g3049195) FT oj93c04.s2" FT repeat_region 4125930..4126169 FT /rpt_family="L1" FT repeat_region 4126170..4126449 FT /rpt_family="Alu" FT repeat_region 4126450..4126491 FT /rpt_family="L1" FT repeat_region 4126492..4126792 FT /rpt_family="Alu" FT repeat_region 4126763..4126801 FT /rpt_family="(A)n" FT repeat_region 4126793..4126954 FT /rpt_family="L1" FT repeat_region 4126993..4127135 FT /rpt_family="Tc2" FT misc_feature 4127002..4127007 FT /note="similar to Homo sapiens EST AA229829 (NID:g1852320) FT nc48c07.r1" FT repeat_region 4127141..4127463 FT /rpt_family="Alu" FT misc_feature 4127396..4127665 FT /note="similar to Homo sapiens EST AA091411 (NID:g1636874)" FT repeat_region 4127607..4127755 FT /rpt_family="MER1_type" FT misc_feature 4127827..4128212 FT /note="similar to Homo sapiens EST AA219163 (NID:g1833237) FT zq16c11.r1" FT repeat_region 4127859..4128055 FT /rpt_family="MER2_type" FT misc_feature 4127990..4128567 FT /note="similar to Homo sapiens EST H49406 (NID:g989247) FT yq19f08.s1" FT misc_feature 4128151..4128588 FT /note="similar to Homo sapiens EST BF062364 FT (NID:g10821274)" FT misc_feature 4128292..4128657 FT /note="similar to Homo sapiens EST BG189896 FT (NID:g13711583)" FT misc_feature 4128533..4128878 FT /note="similar to Homo sapiens EST AW514861 (NID:g7152943) FT xu99f03.x1" FT misc_feature 4129090..4129260 FT /note="similar to Homo sapiens EST AA909905 (NID:g3049195) FT oj93c04.s2" FT misc_feature 4129681..4129893 FT /note="similar to Homo sapiens EST AW026780 (NID:g5880310) FT wv44h08.x1" FT misc_feature 4129683..4130148 FT /note="similar to Homo sapiens EST AI821660 (NID:g5440739) FT zv46d07.x5" FT repeat_region 4129957..4130163 FT /rpt_family="Alu" FT repeat_region 4130165..4130781 FT /rpt_family="SATR2" FT repeat_region 4130527..4132353 FT /rpt_family="SATR1" FT misc_feature 4131037..4131043 FT /note="similar to Homo sapiens EST AA931563 (NID:g3085949) FT oo56d01.s1" FT repeat_region 4136501..4138529 FT /rpt_family="SATR1" FT repeat_region 4138663..4138852 FT /rpt_family="(TAA)n" FT repeat_region 4138929..4140030 FT /rpt_family="SATR1" FT repeat_region 4140035..4140249 FT /rpt_family="MaLR" FT repeat_region 4140265..4140340 FT /rpt_family="MaLR" FT repeat_region 4140349..4140637 FT /rpt_family="Alu" FT repeat_region 4140648..4140781 FT /rpt_family="Alu" FT repeat_region 4140764..4140834 FT /rpt_family="(TAAAA)n" FT repeat_region 4140845..4140967 FT /rpt_family="MaLR" FT repeat_region 4141015..4141221 FT /rpt_family="L1" FT repeat_region 4141222..4141510 FT /rpt_family="Alu" FT repeat_region 4141511..4141931 FT /rpt_family="L1" FT repeat_region 4141923..4141949 FT /rpt_family="(TTTTA)n" FT repeat_region 4141932..4142239 FT /rpt_family="Alu" FT repeat_region 4142240..4142330 FT /rpt_family="L1" FT repeat_region 4142398..4142712 FT /rpt_family="Alu" FT repeat_region 4142683..4142714 FT /rpt_family="(A)n" FT misc_feature 4143301..4143793 FT /note="similar to Mus musculus EST AI430580 (NID:g4276416) FT me04a10.y1" FT misc_feature 4143301..4143469 FT /note="similar to Mus musculus EST W65006 (NID:g1372648) FT me04a10.r1" FT misc_feature 4143728..4143730 FT /note="similar to Homo sapiens EST AA906079 (NID:g3041202) FT oj90f09.s1" FT misc_feature 4144576..4145667 FT /note="CpG_island (%GC=71.5, o/e=0.80, #CpGs=106)" FT misc_feature 4144737..4145268 FT /note="similar to Homo sapiens EST BF057285 FT (NID:g10811181)" FT misc_feature 4144738..4145096 FT /note="match to EST AI825565 (NID:g5446236) wb73h11.x1" FT misc_feature 4144775..4145182 FT /note="similar to Homo sapiens EST W56227 (NID:g1358116) FT zc01c10.r1" FT misc_feature 4144782..4145494 FT /note="similar to Homo sapiens EST BG746035 FT (NID:g14056688)" FT misc_feature 4144865..4145376 FT /note="similar to Homo sapiens EST AI935256 (NID:g5674126) FT wp16a07.x1" FT misc_feature 4144879..4145461 FT /note="match to EST AI074005 (NID:g3400649) oy66e08.x1" FT misc_feature 4145034..4145457 FT /note="similar to Homo sapiens EST AA906079 (NID:g3041202) FT oj90f09.s1" FT misc_feature 4145085..4145460 FT /note="similar to Homo sapiens EST AW204337 (NID:g6503809)" FT misc_feature 4145201..4145494 FT /note="similar to Homo sapiens EST BG469659 FT (NID:g13401934)" FT misc_feature 4145292..4145532 FT /note="similar to Homo sapiens EST AW298596 (NID:g6705232)" FT misc_feature 4145302..4145494 FT /note="match to EST BG754342 (NID:g14064995)" FT misc_feature 4145420..4145494 FT /note="similar to Homo sapiens EST BG341847 FT (NID:g13148285)" FT misc_feature 4145454..4145494 FT /note="similar to Homo sapiens EST AA250815 (NID:g1885777) FT zs06a08.s1" FT misc_feature 4145455..4145494 FT /note="similar to Homo sapiens EST AW449708 (NID:g6990484)" FT /note="similar to Homo sapiens EST BF514082 FT (NID:g11599261)" FT misc_feature 4145462..4145494 FT /note="similar to Homo sapiens EST BI906778 FT (NID:g16169536)" FT misc_feature 4145534..4145939 FT /note="match to EST M78232 (NID:g272549)" FT repeat_region 4145876..4145948 FT /rpt_family="MER1_type" FT repeat_region 4146028..4146258 FT /rpt_family="Alu" FT repeat_region 4146280..4146308 FT /rpt_family="(T)n" FT misc_feature 4146292..4146304 FT /note="similar to Homo sapiens EST BG193651 FT (NID:g13715338)" FT misc_feature 4146296..4146308 FT /note="similar to Homo sapiens EST BG187898 FT (NID:g13709585)" FT misc_feature 4146296..4146310 FT /note="similar to Homo sapiens EST BG215448 FT (NID:g13741469)" FT /note="similar to Homo sapiens EST BG216012 FT (NID:g13742033)" FT repeat_region 4146605..4146635 FT /rpt_family="(TTTTTA)n" FT repeat_region 4146607..4146921 FT /rpt_family="Alu" FT misc_feature 4146887..4147257 FT /note="match to EST T49747 (NID:g651607) ya80e02.s1" FT misc_feature 4147300..4147427 FT /note="similar to Homo sapiens EST AI936590 (NID:g5675460) FT wd29g07.x1" FT misc_feature 4147310..4147427 FT /note="similar to Homo sapiens EST BF514082 FT (NID:g11599261)" FT /note="match to EST BG754342 (NID:g14064995)" FT /note="similar to Homo sapiens EST AA250815 (NID:g1885777) FT zs06a08.s1" FT /note="similar to Homo sapiens EST BG746035 FT (NID:g14056688)" FT /note="similar to Homo sapiens EST BG341847 FT (NID:g13148285)" FT misc_feature 4147310..4147437 FT /note="similar to Homo sapiens EST BI906778 FT (NID:g16169536)" FT /note="similar to Homo sapiens EST BG469659 FT (NID:g13401934)" FT /note="similar to Homo sapiens EST AW449708 (NID:g6990484)" FT misc_feature 4147329..4147836 FT /note="match to EST AA586884 (NID:g2397698) nn68b06.s1" FT misc_feature 4147332..4147427 FT /note="match to EST AW373838 (NID:g6878492)" FT misc_feature 4147357..4147427 FT /note="match to EST AA730281 (NID:g2753493) nz94c04.s1" FT misc_feature 4147358..4147427 FT /note="similar to Homo sapiens EST AA835989 (NID:g2910308) FT oc81g09.s1" FT misc_feature 4147372..4147752 FT /note="match to EST M78233 (NID:g272550)" FT repeat_region 4149206..4149226 FT /rpt_family="GC_rich" FT misc_feature 4149248..4149526 FT /note="match to EST AW373838 (NID:g6878492)" FT /note="match to EST BG754342 (NID:g14064995)" FT /note="match to EST AW371793 (NID:g6876447)" FT misc_feature 4149248..4149742 FT /note="similar to Homo sapiens EST BG341847 FT (NID:g13148285)" FT misc_feature 4149248..4149391 FT /note="match to EST AA730281 (NID:g2753493) nz94c04.s1" FT misc_feature 4149248..4149595 FT /note="similar to Homo sapiens EST AI936590 (NID:g5675460) FT wd29g07.x1" FT misc_feature 4149248..4149358 FT /note="similar to Homo sapiens EST AA250815 (NID:g1885777) FT zs06a08.s1" FT misc_feature 4149248..4149618 FT /note="similar to Homo sapiens EST BF514082 FT (NID:g11599261)" FT misc_feature 4149248..4149283 FT /note="similar to Homo sapiens EST BG746035 FT (NID:g14056688)" FT misc_feature 4149248..4149467 FT /note="similar to Homo sapiens EST AA835989 (NID:g2910308) FT oc81g09.s1" FT misc_feature 4149317..4149517 FT /note="similar to Homo sapiens EST AI741457 (NID:g5109745) FT wg27h10.x1" FT repeat_region 4149582..4150555 FT /rpt_family="SATR1" FT repeat_region 4150575..4150617 FT /rpt_family="AT_rich" FT repeat_region 4150668..4150841 FT /rpt_family="(TAA)n" FT repeat_region 4150889..4150917 FT /rpt_family="AT_rich" FT repeat_region 4150964..4151963 FT /rpt_family="SATR1" FT misc_feature 4151977..4152032 FT /note="similar to Homo sapiens EST BG341847 FT (NID:g13148285)" FT misc_feature 4152219 FT /note="similar to Homo sapiens EST BG341847 FT (NID:g13148285)" FT repeat_region 4152237..4153252 FT /rpt_family="ERVK" FT repeat_region 4152411..4152440 FT /rpt_family="AT_rich" FT misc_feature 4152757..4153369 FT /note="similar to Homo sapiens EST BF105997 FT (NID:g10888523)" FT misc_feature 4153335..4153761 FT /note="similar to Homo sapiens EST AW194462 (NID:g6473281) FT xm09a10.x1" FT misc_feature 4153353..4153728 FT /note="similar to Homo sapiens EST AI830758 (NID:g5451514) FT wj10h10.x1" FT repeat_region 4153714..4153754 FT /rpt_family="AT_rich" FT repeat_region 4153766..4154015 FT /rpt_family="L1" FT repeat_region 4154016..4154289 FT /rpt_family="Alu" FT repeat_region 4154290..4154428 FT /rpt_family="L1" FT repeat_region 4154390..4154435 FT /rpt_family="(TTTG)n" FT repeat_region 4154429..4154721 FT /rpt_family="Alu" FT repeat_region 4154722..4155722 FT /rpt_family="L1" FT repeat_region 4155768..4156079 FT /rpt_family="Alu" FT repeat_region 4156050..4156086 FT /rpt_family="(A)n" FT repeat_region 4156166..4156367 FT /rpt_family="L1" FT repeat_region 4156368..4156646 FT /rpt_family="Alu" FT misc_feature 4156540..4156610 FT /note="match to EST BG182279 (NID:g13703966)" FT repeat_region 4156647..4156830 FT /rpt_family="L1" FT repeat_region 4156869..4157011 FT /rpt_family="Tc2" FT repeat_region 4157017..4157333 FT /rpt_family="Alu" FT repeat_region 4157483..4157629 FT /rpt_family="MER1_type" FT misc_feature 4157489..4158055 FT /note="similar to Homo sapiens EST N99107 (NID:g1270673) FT yy67h07.r1" FT repeat_region 4157734..4157929 FT /rpt_family="MER2_type" FT misc_feature 4157917..4157919 FT /note="similar to Homo sapiens EST BG995764 FT (NID:g14399834)" FT misc_feature 4158163..4158848 FT /note="similar to Homo sapiens EST AW009208 (NID:g5857986) FT ws79a10.x1" FT misc_feature 4158444..4159137 FT /note="similar to Homo sapiens EST BF345274 FT (NID:g11292799)" FT misc_feature 4158456..4158972 FT /note="similar to Homo sapiens EST BG117417 FT (NID:g12610923)" FT misc_feature 4158611..4158751 FT /note="match to EST BG182279 (NID:g13703966)" FT misc_feature 4158636..4158650 FT /note="similar to Homo sapiens EST BF028005 FT (NID:g10735820)" FT misc_feature 4158636..4158805 FT /note="similar to Homo sapiens EST BG995764 FT (NID:g14399834)" FT misc_feature 4158738..4159186 FT /note="similar to Homo sapiens EST BF028005 FT (NID:g10735820)" FT misc_feature 4158864..4159275 FT /note="similar to Homo sapiens EST BG988908 FT (NID:g14392978)" FT misc_feature 4159235..4159774 FT /note="similar to Homo sapiens EST BE504987 (NID:g9707395) FT hz38h11.x1" FT misc_feature 4159518..4159777 FT /note="match to EST BG182279 (NID:g13703966)" FT repeat_region 4159820..4160039 FT /rpt_family="Alu" FT repeat_region 4160041..4161617 FT /rpt_family="SATR2" FT repeat_region 4161314..4162483 FT /rpt_family="SATR1" FT misc_feature 4162556..4162560 FT /note="similar to Homo sapiens EST BE618004 (NID:g9888942)" FT misc_feature 4162561..4162649 FT /note="similar to Homo sapiens EST BF028005 FT (NID:g10735820)" FT misc_feature 4162755..4162860 FT /note="similar to Homo sapiens EST BF028005 FT (NID:g10735820)" FT misc_feature 4162891 FT /note="similar to Homo sapiens EST BF028005 FT (NID:g10735820)" FT misc_feature 4164368..4164418 FT /note="similar to Homo sapiens EST AA707468 (NID:g2717386) FT ah40c03.s1" FT repeat_region 4166595..4166734 FT /rpt_family="(TAA)n" FT misc_feature 4166603..4166862 FT /note="similar to Homo sapiens EST T16582 (NID:g518744)" FT repeat_region 4166888..4168643 FT /rpt_family="SATR1" FT misc_feature 4169922..4169924 FT /note="similar to Homo sapiens EST BG218617 FT (NID:g13744638)" FT misc_feature 4170222..4170367 FT /note="similar to Homo sapiens EST AA707468 (NID:g2717386) FT ah40c03.s1" FT misc_feature 4170495..4170499 FT /note="similar to Homo sapiens EST BG029979 FT (NID:g12419076)" FT repeat_region 4172547..4172733 FT /rpt_family="(TAA)n" FT repeat_region 4172737..4172779 FT /rpt_family="AT_rich" FT repeat_region 4172827..4173796 FT /rpt_family="SATR1" FT repeat_region 4173666..4175975 FT /rpt_family="SATR2" FT misc_feature 4175635..4175637 FT /note="similar to Homo sapiens EST BI462381 FT (NID:g15253037)" FT misc_feature 4175926..4175928 FT /note="similar to Homo sapiens EST BE618565 (NID:g9889503)" FT misc_feature 4175936..4175937 FT /note="similar to Homo sapiens EST AV713699 FT (NID:g10795216)" FT misc_feature 4175975..4176502 FT /note="similar to Homo sapiens EST BI495654 FT (NID:g15334998)" FT misc_feature 4175975..4176541 FT /note="similar to Homo sapiens EST BI495655 FT (NID:g15334999)" FT misc_feature 4175979..4176400 FT /note="similar to Homo sapiens EST AU144503 FT (NID:g11006024)" FT misc_feature 4176033..4176035 FT /note="similar to Homo sapiens EST AW514038 (NID:g7152120) FT xt79a12.x1" FT misc_feature 4176039..4176356 FT /note="similar to Homo sapiens EST AA502892 (NID:g2237859) FT nh57g07.s1" FT misc_feature 4176063..4176271 FT /note="similar to Homo sapiens EST BG188134 FT (NID:g13709821)" FT misc_feature 4176075..4176604 FT /note="similar to Homo sapiens EST AW514038 (NID:g7152120) FT xt79a12.x1" FT misc_feature 4176085..4176400 FT /note="similar to Homo sapiens EST BF062963 FT (NID:g10821873)" FT misc_feature 4176088..4176533 FT /note="similar to Homo sapiens EST AI081342 (NID:g3418134) FT ox72h12.x1" FT misc_feature 4176091..4176530 FT /note="similar to Homo sapiens EST AA235800 (NID:g1860237) FT zs42g05.r1" FT misc_feature 4176154..4176924 FT /note="similar to Homo sapiens EST BG188946 FT (NID:g13710633)" FT misc_feature 4176170..4176937 FT /note="similar to Homo sapiens EST BG204873 FT (NID:g13726560)" FT misc_feature 4176191..4176932 FT /note="similar to Homo sapiens EST BG191556 FT (NID:g13713243)" FT misc_feature 4176202..4176928 FT /note="similar to Homo sapiens EST BG184622 FT (NID:g13706437)" FT misc_feature 4176210..4176400 FT /note="similar to Homo sapiens EST BE067731 (NID:g8412381)" FT misc_feature 4176241..4177003 FT /note="similar to Homo sapiens EST BG218617 FT (NID:g13744638)" FT misc_feature 4176363..4176888 FT /note="similar to Homo sapiens EST AW874308 (NID:g8008445) FT hq04g08.x1" FT misc_feature 4176367..4176924 FT /note="similar to Homo sapiens EST BG215448 FT (NID:g13741469)" FT misc_feature 4176367..4176931 FT /note="similar to Homo sapiens EST BG216012 FT (NID:g13742033)" FT misc_feature 4176367..4176804 FT /note="similar to Homo sapiens EST AA931563 (NID:g3085949) FT oo56d01.s1" FT misc_feature 4176367..4176997 FT /note="similar to Homo sapiens EST BG193651 FT (NID:g13715338)" FT misc_feature 4176368..4176726 FT /note="similar to Homo sapiens EST AA229723 (NID:g1851934) FT nc48c07.s1" FT misc_feature 4176370..4176913 FT /note="similar to Homo sapiens EST BG187898 FT (NID:g13709585)" FT misc_feature 4176371..4176764 FT /note="similar to Homo sapiens EST AA759343 (NID:g2804818) FT ah53d01.s1" FT misc_feature 4176378..4177002 FT /note="similar to Homo sapiens EST BE618004 (NID:g9888942)" FT misc_feature 4176392..4176668 FT /note="similar to Homo sapiens EST BE674166 FT (NID:g10034707)" FT misc_feature 4176396..4176932 FT /note="similar to Homo sapiens EST BG198036 FT (NID:g13719851)" FT misc_feature 4176418..4176777 FT /note="similar to Homo sapiens EST BE835764 FT (NID:g10268246)" FT misc_feature 4176425..4176525 FT /note="similar to Homo sapiens EST AU144503 FT (NID:g11006024)" FT misc_feature 4176425..4177002 FT /note="similar to Homo sapiens EST BE618565 (NID:g9889503)" FT misc_feature 4176425..4176508 FT /note="similar to Homo sapiens EST BF062963 FT (NID:g10821873)" FT misc_feature 4176425..4176487 FT /note="similar to Homo sapiens EST BE067731 (NID:g8412381)" FT misc_feature 4176433 FT /note="similar to Homo sapiens EST AA042813 (NID:g1522468) FT zk53c07.s1" FT misc_feature 4176468..4176473 FT /note="similar to Homo sapiens EST AW391026 (NID:g6895685)" FT misc_feature 4176552..4177051 FT /note="similar to Homo sapiens EST AA042813 (NID:g1522468) FT zk53c07.s1" FT misc_feature 4176556..4176932 FT /note="similar to Homo sapiens EST BE893680 FT (NID:g10355287)" FT misc_feature 4176617..4177010 FT /note="similar to Homo sapiens EST AV713699 FT (NID:g10795216)" FT misc_feature 4176762..4177149 FT /note="similar to Homo sapiens EST H78008 (NID:g1056097) FT yu82h12.r1" FT misc_feature 4176765..4176928 FT /note="similar to Homo sapiens EST AA229829 (NID:g1852320) FT nc48c07.r1" FT misc_feature 4176797..4176932 FT /note="similar to Homo sapiens EST BI669484 FT (NID:g15583717)" FT misc_feature 4176800..4176946 FT /note="similar to Homo sapiens EST BG117417 FT (NID:g12610923)" FT misc_feature 4176821..4177179 FT /note="similar to Homo sapiens EST BE709727 FT (NID:g10097992)" FT misc_feature 4176973..4176976 FT /note="similar to Homo sapiens EST BF062963 FT (NID:g10821873)" FT misc_feature 4177023..4177268 FT /note="similar to Homo sapiens EST AI371376 (NID:g4150129) FT qo83f11.x1" FT misc_feature 4177069..4177291 FT /note="similar to Homo sapiens EST AV713699 FT (NID:g10795216)" FT misc_feature 4177129..4177595 FT /note="similar to Homo sapiens EST AW391026 (NID:g6895685)" FT misc_feature 4177208..4177683 FT /note="similar to Homo sapiens EST BG203046 FT (NID:g13724733)" FT misc_feature 4177401..4177735 FT /note="similar to Homo sapiens EST AI301661 (NID:g3961007) FT qn46c09.x1" FT repeat_region 4177669..4177972 FT /rpt_family="Alu" FT misc_feature 4177893..4177947 FT /note="similar to Homo sapiens EST AW514861 (NID:g7152943) FT xu99f03.x1" FT misc_feature 4177905..4178406 FT /note="similar to Homo sapiens EST BF899781 FT (NID:g12291240)" FT misc_feature 4178212..4178398 FT /note="similar to Homo sapiens EST BI462381 FT (NID:g15253037)" FT repeat_region 4178396..4178656 FT /rpt_family="Alu" FT misc_feature 4178485..4178487 FT /note="similar to Homo sapiens EST AL037128 (NID:g5866460)" FT misc_feature 4178682..4178864 FT /note="similar to Homo sapiens EST BG029979 FT (NID:g12419076)" FT misc_feature 4178831..4179057 FT /note="match to EST AA372943 (NID:g2025262)" FT misc_feature 4178865..4179165 FT /note="similar to Homo sapiens EST AW451324 (NID:g6992100)" FT misc_feature 4178865..4179179 FT /note="similar to Homo sapiens EST BG029979 FT (NID:g12419076)" FT repeat_region 4179021..4179230 FT /rpt_family="MIR" FT misc_feature 4179216..4179564 FT /note="similar to Homo sapiens EST AL037128 (NID:g5866460)" FT misc_feature 4179608..4179612 FT /note="similar to Homo sapiens EST AA229723 (NID:g1851934) FT nc48c07.s1" FT repeat_region 4180019..4180052 FT /rpt_family="AT_rich" FT repeat_region 4180073..4180319 FT /rpt_family="L1" FT repeat_region 4180320..4180624 FT /rpt_family="Alu" FT misc_feature 4180365..4180402 FT /note="similar to Homo sapiens EST BI462381 FT (NID:g15253037)" FT repeat_region 4180625..4180739 FT /rpt_family="L1" FT repeat_region 4180727..4180751 FT /rpt_family="(TTTG)n" FT repeat_region 4180740..4181049 FT /rpt_family="Alu" FT repeat_region 4181050..4182045 FT /rpt_family="L1" FT repeat_region 4182091..4182399 FT /rpt_family="Alu" FT repeat_region 4182374..4182399 FT /rpt_family="(A)n" FT misc_feature 4182374..4182392 FT /note="similar to Homo sapiens EST BG029979 FT (NID:g12419076)" FT repeat_region 4182446..4182704 FT /rpt_family="L1" FT repeat_region 4182705..4182984 FT /rpt_family="Alu" FT misc_feature 4182866..4182977 FT /note="similar to Homo sapiens EST BI462381 FT (NID:g15253037)" FT repeat_region 4182985..4183168 FT /rpt_family="L1" FT repeat_region 4183211..4183349 FT /rpt_family="Tc2" FT repeat_region 4183355..4183686 FT /rpt_family="Alu" FT misc_feature 4183424..4183490 FT /note="similar to Homo sapiens EST AI301661 (NID:g3961007) FT qn46c09.x1" FT repeat_region 4183659..4183689 FT /rpt_family="(A)n" FT repeat_region 4183882..4183995 FT /rpt_family="MER1_type" FT repeat_region 4184100..4184195 FT /rpt_family="MER2_type" FT misc_feature 4184742..4185157 FT /note="similar to Homo sapiens EST BF325553 FT (NID:g11296301)" FT misc_feature 4184788..4185192 FT /note="similar to Homo sapiens EST BF325544 FT (NID:g11296292)" FT misc_feature 4184910..4185437 FT /note="similar to Homo sapiens EST BF105847 FT (NID:g10888373)" FT repeat_region 4185355..4185418 FT /rpt_family="MER1_type" FT repeat_region 4185581..4185945 FT /rpt_family="MaLR" FT misc_feature 4185673..4186320 FT /note="match to EST BE909015 (NID:g10404172)" FT misc_feature 4185781..4186504 FT /note="similar to Homo sapiens EST BG399752 FT (NID:g13293200)" FT misc_feature 4185950..4186323 FT /note="match to EST AA400718 (NID:g2054589) zv09d10.s1" FT misc_feature 4185971..4186338 FT /note="similar to Homo sapiens EST R18348 (NID:g771958) FT yg01a09.r1" FT repeat_region 4186468..4187069 FT /rpt_family="L1" FT misc_feature 4186739..4187339 FT /note="match to EST BF806111 (NID:g12135100)" FT misc_feature 4187024..4187557 FT /note="similar to Homo sapiens EST AW418649 (NID:g6946532) FT hd14a10.x1" FT misc_feature 4187233..4187566 FT /note="similar to Homo sapiens EST R42552 (NID:g817314) FT yg01a09.s1" FT misc_feature 4187379..4187558 FT /note="similar to Homo sapiens EST AI140476 (NID:g3647933) FT ow82c07.s1" FT repeat_region 4187508..4187708 FT /rpt_family="L1" FT repeat_region 4187743..4187867 FT /rpt_family="MER1_type" FT repeat_region 4187758..4187885 FT /rpt_family="MER1_type" FT repeat_region 4188042..4188341 FT /rpt_family="Alu" FT repeat_region 4188325..4188377 FT /rpt_family="AT_rich" FT repeat_region 4188355..4188676 FT /rpt_family="Alu" FT repeat_region 4188528..4188551 FT /rpt_family="(TTTTG)n" FT repeat_region 4188720..4188828 FT /rpt_family="MER1_type" FT repeat_region 4188829..4189041 FT /rpt_family="L1" FT repeat_region 4189041..4189088 FT /rpt_family="AT_rich" FT repeat_region 4189042..4189144 FT /rpt_family="MER1_type" FT repeat_region 4189343..4189371 FT /rpt_family="AT_rich" FT repeat_region 4189404..4189902 FT /rpt_family="L1" FT misc_feature 4190053..4190701 FT /note="similar to EST BB220914 (NID:g16353551)" FT misc_feature 4190660..4190700 FT /note="similar to Homo sapiens EST AL519106 FT (NID:g12782599)" FT misc_feature 4190661..4190941 FT /note="match to EST AW897186 (NID:g8061391)" FT misc_feature 4190661..4191414 FT /note="match to EST AL547771 (NID:g12882146)" FT repeat_region 4190989..4191058 FT /rpt_family="MIR" FT misc_feature 4190990..4191365 FT /note="similar to Homo sapiens EST BF948416 FT (NID:g12365691)" FT repeat_region 4191236..4191799 FT /rpt_family="MaLR" FT repeat_region 4191845..4191917 FT /rpt_family="MER2_type" FT repeat_region 4191918..4192232 FT /rpt_family="Alu" FT repeat_region 4192200..4192234 FT /rpt_family="AT_rich" FT repeat_region 4192233..4192477 FT /rpt_family="MER2_type" FT repeat_region 4192480..4193628 FT /rpt_family="L2" FT repeat_region 4193623..4193687 FT /rpt_family="GA-rich" FT repeat_region 4193733..4194245 FT /rpt_family="MaLR" FT repeat_region 4194247..4194348 FT /rpt_family="L2" FT repeat_region 4194465..4194785 FT /rpt_family="L1" FT repeat_region 4194777..4194798 FT /rpt_family="AT_rich" FT repeat_region 4195633..4195919 FT /rpt_family="Alu" FT repeat_region 4196078..4196151 FT /rpt_family="L2" FT misc_feature 4196428..4196744 FT /note="similar to Homo sapiens EST BF363240 FT (NID:g11325265)" FT repeat_region 4196643..4197069 FT /rpt_family="L2" FT repeat_region 4197158..4197195 FT /rpt_family="MaLR" FT repeat_region 4197216..4197481 FT /rpt_family="MaLR" FT repeat_region 4197601..4197724 FT /rpt_family="L2" FT repeat_region 4197818..4197868 FT /rpt_family="L1" FT repeat_region 4197869..4197996 FT /rpt_family="Alu" FT repeat_region 4197997..4198291 FT /rpt_family="Alu" FT repeat_region 4198292..4198475 FT /rpt_family="Alu" FT repeat_region 4198476..4198859 FT /rpt_family="L1" FT misc_feature 4198893..4199687 FT /note="similar to Homo sapiens EST AL519106 FT (NID:g12782599)" FT misc_feature 4199527..4199830 FT /note="similar to EST BB637282 (NID:g16473067)" FT repeat_region 4200098..4200131 FT /rpt_family="(TAGA)n" FT repeat_region 4200114..4200299 FT /rpt_family="L1" FT repeat_region 4200636..4200935 FT /rpt_family="Alu" FT repeat_region 4200961..4201003 FT /rpt_family="(GA)n" FT repeat_region 4201003..4201092 FT /rpt_family="L1" FT repeat_region 4201131..4201438 FT /rpt_family="Alu" FT repeat_region 4201514..4201765 FT /rpt_family="MER1_type" FT repeat_region 4201941..4202215 FT /rpt_family="Alu" FT repeat_region 4202270..4202299 FT /rpt_family="(T)n" FT repeat_region 4202677..4202745 FT /rpt_family="MIR" FT repeat_region 4202746..4202871 FT /rpt_family="MIR" FT repeat_region 4202874..4203183 FT /rpt_family="Alu" FT repeat_region 4203155..4203197 FT /rpt_family="(TAAA)n" FT repeat_region 4203187..4203246 FT /rpt_family="ERV1" FT repeat_region 4203199..4203239 FT /rpt_family="(CA)n" FT repeat_region 4203398..4203573 FT /rpt_family="MIR" FT misc_feature 4204075..4204369 FT /note="similar to Homo sapiens EST BF825458 FT (NID:g12167863)" FT misc_feature 4204171..4204430 FT /note="similar to Homo sapiens EST AA297847 (NID:g1950252)" FT misc_feature 4204175..4204305 FT /note="similar to EST BB637282 (NID:g16473067)" FT repeat_region 4204827..4205103 FT /rpt_family="MaLR" FT repeat_region 4205106..4205242 FT /rpt_family="MIR" FT repeat_region 4206440..4206483 FT /rpt_family="(TG)n" FT repeat_region 4206492..4206796 FT /rpt_family="Alu" FT repeat_region 4207031..4207158 FT /rpt_family="ERV1" FT repeat_region 4207271..4207511 FT /rpt_family="ERV1" FT repeat_region 4207513..4207558 FT /rpt_family="MIR" FT misc_feature 4207797..4207857 FT /note="similar to Mus musculus EST BB636724 FT (NID:g15400990)" FT misc_feature 4207799..4207857 FT /note="similar to EST BB637282 (NID:g16473067)" FT repeat_region 4208027..4208111 FT /rpt_family="MER1_type" FT repeat_region 4208425..4208599 FT /rpt_family="MIR" FT repeat_region 4208611..4208668 FT /rpt_family="L2" FT repeat_region 4208702..4208773 FT /rpt_family="MIR" FT repeat_region 4208961..4209280 FT /rpt_family="L1" FT repeat_region 4209286..4209473 FT /rpt_family="L1" FT repeat_region 4209474..4210135 FT /rpt_family="ERV1" FT repeat_region 4210136..4210498 FT /rpt_family="L1" FT misc_feature 4210211..4210230 FT /note="similar to Homo sapiens EST AA297847 (NID:g1950252)" FT repeat_region 4210499..4210983 FT /rpt_family="ERV1" FT repeat_region 4210984..4211002 FT /rpt_family="L1" FT repeat_region 4211189..4211310 FT /rpt_family="L2" FT repeat_region 4211315..4211532 FT /rpt_family="MIR" FT repeat_region 4212058..4212275 FT /rpt_family="MaLR" FT repeat_region 4212276..4212574 FT /rpt_family="Alu" FT repeat_region 4212575..4212731 FT /rpt_family="MaLR" FT repeat_region 4212851..4213115 FT /rpt_family="Mariner" FT repeat_region 4213127..4213174 FT /rpt_family="MIR" FT repeat_region 4213180..4213344 FT /rpt_family="L1" FT repeat_region 4213345..4213493 FT /rpt_family="Alu" FT repeat_region 4213489..4213525 FT /rpt_family="AT_rich" FT repeat_region 4213529..4213828 FT /rpt_family="L1" FT repeat_region 4214112..4214286 FT /rpt_family="L1" FT repeat_region 4214152..4214180 FT /rpt_family="AT_rich" FT misc_feature 4214595..4214731 FT /note="similar to Mus musculus EST BB636724 FT (NID:g15400990)" FT misc_feature 4214595..4214733 FT /note="similar to EST BB637282 (NID:g16473067)" FT repeat_region 4214819..4215250 FT /rpt_family="L1" FT repeat_region 4215250..4215526 FT /rpt_family="L1" FT repeat_region 4215498..4215534 FT /rpt_family="L1" FT repeat_region 4215535..4215823 FT /rpt_family="Alu" FT repeat_region 4215824..4216704 FT /rpt_family="L1" FT repeat_region 4216696..4216723 FT /rpt_family="AT_rich" FT repeat_region 4216729..4216845 FT /rpt_family="Alu" FT repeat_region 4216827..4216862 FT /rpt_family="AT_rich" FT repeat_region 4216896..4216974 FT /rpt_family="L2" FT repeat_region 4217107..4217393 FT /rpt_family="Alu" FT repeat_region 4217388..4217417 FT /rpt_family="AT_rich" FT repeat_region 4217399..4217519 FT /rpt_family="L1" FT repeat_region 4217520..4217825 FT /rpt_family="Alu" FT repeat_region 4217826..4217844 FT /rpt_family="L1" FT repeat_region 4218598..4218783 FT /rpt_family="MER1_type" FT repeat_region 4218912..4218972 FT /rpt_family="L2" FT repeat_region 4219055..4219198 FT /rpt_family="L1" FT repeat_region 4219226..4219483 FT /rpt_family="L2" FT repeat_region 4219837..4220132 FT /rpt_family="Alu" FT repeat_region 4220373..4220668 FT /rpt_family="Alu" FT repeat_region 4220706..4220879 FT /rpt_family="L1" FT repeat_region 4220935..4221081 FT /rpt_family="L1" FT repeat_region 4221148..4221436 FT /rpt_family="Alu" FT repeat_region 4221499..4221833 FT /rpt_family="(TA)n" FT repeat_region 4221833..4221954 FT /rpt_family="Alu" FT repeat_region 4222001..4222151 FT /rpt_family="L1" FT repeat_region 4222206..4222402 FT /rpt_family="MIR" FT repeat_region 4222581..4222730 FT /rpt_family="CR1" FT repeat_region 4222744..4222824 FT /rpt_family="(TTTTA)n" FT repeat_region 4222798..4222953 FT /rpt_family="Alu" FT repeat_region 4222957..4223182 FT /rpt_family="Alu" FT repeat_region 4223149..4223174 FT /rpt_family="AT_rich" FT repeat_region 4223373..4223463 FT /rpt_family="L2" FT repeat_region 4223496..4223641 FT /rpt_family="Alu" FT repeat_region 4223738..4223771 FT /rpt_family="(TCCA)n" FT repeat_region 4223783..4223973 FT /rpt_family="L2" FT repeat_region 4224234..4224274 FT /rpt_family="CR1" FT repeat_region 4224700..4224745 FT /rpt_family="MIR" FT repeat_region 4224910..4225078 FT /rpt_family="L2" FT repeat_region 4225114..4225172 FT /rpt_family="(TGGA)n" FT repeat_region 4225290..4225325 FT /rpt_family="(GGAGAA)n" FT repeat_region 4225345..4225639 FT /rpt_family="Alu" FT repeat_region 4225616..4225641 FT /rpt_family="(CAAAAA)n" FT repeat_region 4225646..4225738 FT /rpt_family="GA-rich" FT repeat_region 4225794..4226097 FT /rpt_family="Alu" FT repeat_region 4226087..4226208 FT /rpt_family="GA-rich" FT repeat_region 4226703..4226853 FT /rpt_family="MIR" FT repeat_region 4227015..4227310 FT /rpt_family="Alu" FT misc_feature 4228100..4229839 FT /note="CpG_island (%GC=70.0, o/e=0.80, #CpGs=157)" FT misc_feature 4228189..4228598 FT /note="similar to Mus musculus EST BB636724 FT (NID:g15400990)" FT repeat_region 4228449..4228470 FT /rpt_family="GC_rich" FT repeat_region 4228989..4229092 FT /rpt_family="(CCCG)n" FT repeat_region 4229909..4230055 FT /rpt_family="AcHobo" FT repeat_region 4230145..4230288 FT /rpt_family="L2" FT repeat_region 4230481..4230500 FT /rpt_family="(TTTC)n" FT repeat_region 4230488..4230807 FT /rpt_family="Alu" FT repeat_region 4230944..4231118 FT /rpt_family="MaLR" FT misc_feature 4230954..4230960 FT /note="similar to Homo sapiens EST BI495654 FT (NID:g15334998)" FT repeat_region 4231197..4231235 FT /rpt_family="(TTTG)n" FT repeat_region 4231229..4231513 FT /rpt_family="Alu" FT repeat_region 4231610..4231898 FT /rpt_family="Alu" FT repeat_region 4232247..4232921 FT /rpt_family="L1" FT repeat_region 4233104..4233404 FT /rpt_family="Alu" FT repeat_region 4233409..4233876 FT /rpt_family="MaLR" FT repeat_region 4233885..4234009 FT /rpt_family="L1" FT repeat_region 4234010..4234151 FT /rpt_family="Alu" FT repeat_region 4234128..4234150 FT /rpt_family="(A)n" FT repeat_region 4234152..4234431 FT /rpt_family="Alu" FT misc_feature 4234212..4234214 FT /note="match to EST D61850 (NID:g965626)" FT repeat_region 4234407..4234431 FT /rpt_family="(A)n" FT repeat_region 4234432..4234601 FT /rpt_family="Alu" FT repeat_region 4234602..4235013 FT /rpt_family="L1" FT repeat_region 4235018..4236157 FT /rpt_family="Mariner" FT misc_feature 4235696..4235699 FT /note="match to EST T76995 (NID:g694198) yd72d05.s1" FT misc_feature 4236036..4236038 FT /note="match to EST AI765238 (NID:g5231747) wi72h10.x1" FT repeat_region 4236669..4236790 FT /rpt_family="MIR" FT repeat_region 4236796..4236961 FT /rpt_family="MER2_type" FT repeat_region 4236965..4237015 FT /rpt_family="MIR" FT misc_feature 4237212 FT /note="match to EST AA908733 (NID:g3048138) og75g10.s1" FT misc_feature 4237269..4237808 FT /note="match to EST AI765238 (NID:g5231747) wi72h10.x1" FT misc_feature 4237269..4237604 FT /note="match to EST T76995 (NID:g694198) yd72d05.s1" FT misc_feature 4237269..4237492 FT /note="match to EST AA908733 (NID:g3048138) og75g10.s1" FT repeat_region 4237273..4237295 FT /rpt_family="AT_rich" FT misc_feature 4237292..4237965 FT /note="match to EST BG497183 (NID:g13458700)" FT misc_feature 4237296..4238008 FT /note="match to EST AL576178 (NID:g12938064)" FT misc_feature 4237297..4237965 FT /note="match to EST BG493147 (NID:g13454659)" FT misc_feature 4237339..4237644 FT /note="match to EST D61850 (NID:g965626)" FT misc_feature 4237359 FT /note="match to EST AL519982 (NID:g12783475)" FT misc_feature 4237395..4238178 FT /note="match to EST AU128983 (NID:g10989337)" FT misc_feature 4237441..4237983 FT /note="similar to Homo sapiens EST AL561840 FT (NID:g12909670)" FT misc_feature 4237470..4237983 FT /note="match to EST BI757329 (NID:g15748907)" FT misc_feature 4237512..4237983 FT /note="match to EST AL519982 (NID:g12783475)" FT misc_feature 4237534..4237986 FT /note="match to EST AA995357 (NID:g3181846) or74a12.s1" FT misc_feature 4237561..4237893 FT /note="match to EST BF360893 (NID:g11319965)" FT misc_feature 4237577..4237983 FT /note="match to EST W47016 (NID:g1331674) zc38e11.r1" FT misc_feature 4237695..4237983 FT /note="match to EST AI184691 (NID:g3735329) qd68b12.x1" FT misc_feature 4237737..4237981 FT /note="match to EST N28835 (NID:g1147071) yx59b10.r1" FT misc_feature 4237760..4237983 FT /note="match to EST BG613172 (NID:g13664543)" FT misc_feature 4237769..4237983 FT /note="match to EST BF792179 (NID:g12097233)" FT misc_feature 4237800..4237983 FT /note="match to EST AW381572 (NID:g6886231)" FT misc_feature 4237803..4238217 FT /note="similar to Homo sapiens EST N85113 (NID:g1260738)" FT misc_feature 4237814..4237983 FT /note="match to EST T83570 (NID:g711858) yd44h11.r1" FT misc_feature 4237815..4238479 FT /note="match to EST AL036932 (NID:g5927962)" FT repeat_region 4237871..4238002 FT /rpt_family="Alu" FT repeat_region 4237987..4238006 FT /rpt_family="(A)n" FT misc_feature 4238022..4238671 FT /note="match to EST AW963019 (NID:g8152855)" FT misc_feature 4238093..4238804 FT /note="match to EST BG287305 (NID:g13041013)" FT repeat_region 4238195..4238366 FT /rpt_family="L2" FT misc_feature 4238239..4238804 FT /note="match to EST BI771222 (NID:g15762800)" FT misc_feature 4238253..4238254 FT /note="match to EST AL576178 (NID:g12938064)" FT misc_feature 4238298..4238754 FT /note="match to EST N80406 (NID:g1243107) yz92c05.r1" FT misc_feature 4238305..4238804 FT /note="match to EST AL523974 (NID:g12787467)" FT misc_feature 4238550..4238881 FT /note="match to EST AA334774 (NID:g1987081)" FT misc_feature 4238582..4238804 FT /note="match to EST BI916707 (NID:g16180668)" FT repeat_region 4239168..4239380 FT /rpt_family="Alu" FT misc_feature 4239467..4239662 FT /note="match to EST BI770797 (NID:g15762375)" FT misc_feature 4239554..4239661 FT /note="match to EST AW381572 (NID:g6886231)" FT misc_feature 4239554..4239662 FT /note="match to EST T83570 (NID:g711858) yd44h11.r1" FT /note="match to EST N28835 (NID:g1147071) yx59b10.r1" FT /note="match to EST BF792179 (NID:g12097233)" FT /note="match to EST AL523974 (NID:g12787467)" FT /note="match to EST BI916707 (NID:g16180668)" FT /note="match to EST BG613172 (NID:g13664543)" FT /note="match to EST AL519982 (NID:g12783475)" FT /note="match to EST BI757329 (NID:g15748907)" FT /note="match to EST AI184691 (NID:g3735329) qd68b12.x1" FT /note="match to EST BG287305 (NID:g13041013)" FT /note="similar to Homo sapiens EST AL561840 FT (NID:g12909670)" FT misc_feature 4239554..4239663 FT /note="match to EST BI771222 (NID:g15762800)" FT misc_feature 4239554..4239586 FT /note="match to EST W47016 (NID:g1331674) zc38e11.r1" FT misc_feature 4239556..4239662 FT /note="similar to Mus musculus EST BE623975 (NID:g9904391) FT uu46e01.y1" FT /note="similar to Mus musculus EST AW049362 (NID:g5909891)" FT repeat_region 4240479..4240779 FT /rpt_family="Alu" FT repeat_region 4240788..4240942 FT /rpt_family="L1" FT repeat_region 4240967..4241174 FT /rpt_family="L1" FT repeat_region 4241170..4241815 FT /rpt_family="L1" FT misc_feature 4242048..4242206 FT /note="similar to Mus musculus EST BE623975 (NID:g9904391) FT uu46e01.y1" FT /note="match to EST BI757329 (NID:g15748907)" FT /note="similar to Mus musculus EST BF450886 (NID:g11517055) FT uz72a09.y1" FT /note="match to EST BG613172 (NID:g13664543)" FT /note="match to EST BI770797 (NID:g15762375)" FT /note="match to EST BI916707 (NID:g16180668)" FT /note="match to EST AL519982 (NID:g12783475)" FT /note="match to EST AL523974 (NID:g12787467)" FT /note="match to EST BF792179 (NID:g12097233)" FT /note="similar to Mus musculus EST AW049362 (NID:g5909891)" FT misc_feature 4242048..4242126 FT /note="match to EST N28835 (NID:g1147071) yx59b10.r1" FT misc_feature 4242048..4242122 FT /note="match to EST T83570 (NID:g711858) yd44h11.r1" FT misc_feature 4242048..4242103 FT /note="match to EST AI184691 (NID:g3735329) qd68b12.x1" FT misc_feature 4242048..4242179 FT /note="similar to Homo sapiens EST AL561840 FT (NID:g12909670)" FT misc_feature 4242100..4242206 FT /note="similar to Rattus norvegicus EST AW507343 FT (NID:g8133508)" FT misc_feature 4242132..4242206 FT /note="match to EST F11871 (NID:g706186)" FT misc_feature 4242159..4242221 FT /note="match to EST BF686055 (NID:g11971463)" FT misc_feature 4242186..4242206 FT /note="match to EST N45593 (NID:g1186759) yy76d07.r1" FT repeat_region 4242523..4242840 FT /rpt_family="Alu" FT misc_feature 4242530..4243255 FT /note="match to EST BG539548 (NID:g13531781)" FT repeat_region 4242814..4242842 FT /rpt_family="AT_rich" FT repeat_region 4243401..4243574 FT /rpt_family="MIR" FT repeat_region 4243623..4243933 FT /rpt_family="Alu" FT repeat_region 4244014..4244180 FT /rpt_family="MER1_type" FT repeat_region 4244174..4244219 FT /rpt_family="MER1_type" FT repeat_region 4244241..4244262 FT /rpt_family="AT_rich" FT repeat_region 4244251..4244544 FT /rpt_family="Alu" FT repeat_region 4244592..4244677 FT /rpt_family="MER1_type" FT repeat_region 4244795..4244826 FT /rpt_family="AT_rich" FT repeat_region 4244818..4245107 FT /rpt_family="Alu" FT repeat_region 4245487..4245567 FT /rpt_family="MIR" FT repeat_region 4245921..4246225 FT /rpt_family="Alu" FT repeat_region 4246206..4246225 FT /rpt_family="(TAAAAA)n" FT repeat_region 4247404..4247503 FT /rpt_family="L1" FT repeat_region 4247452..4247563 FT /rpt_family="L1" FT repeat_region 4247479..4247553 FT /rpt_family="(TA)n" FT repeat_region 4247526..4247784 FT /rpt_family="L1" FT repeat_region 4247786..4247859 FT /rpt_family="L2" FT misc_feature 4247929..4248071 FT /note="similar to Mus musculus EST BE623975 (NID:g9904391) FT uu46e01.y1" FT /note="similar to Mus musculus EST BF450886 (NID:g11517055) FT uz72a09.y1" FT misc_feature 4247929..4248070 FT /note="match to EST BG613172 (NID:g13664543)" FT /note="match to EST BI770797 (NID:g15762375)" FT /note="match to EST F11871 (NID:g706186)" FT /note="match to EST BI916707 (NID:g16180668)" FT /note="match to EST AL519982 (NID:g12783475)" FT /note="match to EST AL523974 (NID:g12787467)" FT /note="match to EST N45593 (NID:g1186759) yy76d07.r1" FT misc_feature 4247929..4247999 FT /note="match to EST BI757329 (NID:g15748907)" FT misc_feature 4247929..4247982 FT /note="match to EST BF792179 (NID:g12097233)" FT misc_feature 4247929..4248074 FT /note="similar to Rattus norvegicus EST AW507343 FT (NID:g8133508)" FT misc_feature 4247929..4248003 FT /note="similar to Mus musculus EST AW049362 (NID:g5909891)" FT misc_feature 4247944..4248070 FT /note="match to EST BF686055 (NID:g11971463)" FT misc_feature 4247975..4248070 FT /note="match to EST Z42686 (NID:g570257)" FT repeat_region 4248481..4248789 FT /rpt_family="Alu" FT repeat_region 4248833..4248989 FT /rpt_family="MIR" FT misc_feature 4249328..4249929 FT /note="match to EST BF686055 (NID:g11971463)" FT misc_feature 4249422..4249783 FT /note="match to EST AA383168 (NID:g2035677)" FT repeat_region 4249423..4249620 FT /rpt_family="L1" FT misc_feature 4249833..4249960 FT /note="match to EST BG613172 (NID:g13664543)" FT misc_feature 4249833..4249936 FT /note="match to EST BI770797 (NID:g15762375)" FT misc_feature 4249833..4249934 FT /note="match to EST Z42686 (NID:g570257)" FT /note="match to EST F11871 (NID:g706186)" FT misc_feature 4249833..4249933 FT /note="match to EST BI916707 (NID:g16180668)" FT misc_feature 4249833..4249926 FT /note="match to EST AL519982 (NID:g12783475)" FT /note="match to EST AL523974 (NID:g12787467)" FT misc_feature 4249833..4249847 FT /note="match to EST N45593 (NID:g1186759) yy76d07.r1" FT misc_feature 4250020..4250473 FT /note="match to EST BF510602 (NID:g11593900)" FT misc_feature 4250048..4250470 FT /note="match to EST AI793120 (NID:g5340836) oo33b06.y5" FT misc_feature 4250255..4250469 FT /note="match to EST AA975902 (NID:g3151694) oo33b06.s1" FT repeat_region 4250742..4250865 FT /rpt_family="L2" FT misc_feature 4250879..4251245 FT /note="match to EST BF513364 (NID:g11598543)" FT repeat_region 4250909..4250948 FT /rpt_family="L2" FT repeat_region 4251238..4251540 FT /rpt_family="Alu" FT repeat_region 4251511..4251540 FT /rpt_family="AT_rich" FT repeat_region 4252117..4252436 FT /rpt_family="Alu" FT repeat_region 4252234..4252262 FT /rpt_family="AT_rich" FT repeat_region 4252409..4252436 FT /rpt_family="(GAAAA)n" FT repeat_region 4252624..4252709 FT /rpt_family="MIR" FT repeat_region 4253381..4253621 FT /rpt_family="MIR" FT repeat_region 4253660..4253681 FT /rpt_family="AT_rich" FT repeat_region 4253794..4253870 FT /rpt_family="MIR" FT repeat_region 4253959..4254041 FT /rpt_family="L1" FT repeat_region 4254042..4254241 FT /rpt_family="Alu" FT repeat_region 4254243..4254266 FT /rpt_family="(T)n" FT repeat_region 4254549..4254753 FT /rpt_family="L1" FT repeat_region 4255193..4255669 FT /rpt_family="ERVL" FT repeat_region 4255585..4255631 FT /rpt_family="(TA)n" FT repeat_region 4255713..4255830 FT /rpt_family="Alu" FT repeat_region 4256028..4256133 FT /rpt_family="ERVL" FT repeat_region 4256972..4257412 FT /rpt_family="ERVL" FT repeat_region 4257254..4257273 FT /rpt_family="(CAGGA)n" FT repeat_region 4257416..4257597 FT /rpt_family="MIR" FT repeat_region 4257811..4257897 FT /rpt_family="MIR" FT repeat_region 4258174..4258471 FT /rpt_family="Alu" FT repeat_region 4258472..4258586 FT /rpt_family="ERVL" FT repeat_region 4258740..4258935 FT /rpt_family="ERVL" FT repeat_region 4259049..4259195 FT /rpt_family="MER1_type" FT repeat_region 4259413..4259967 FT /rpt_family="L1" FT repeat_region 4259947..4259967 FT /rpt_family="AT_rich" FT repeat_region 4260056..4260365 FT /rpt_family="Alu" FT repeat_region 4260336..4260373 FT /rpt_family="(GAAA)n" FT repeat_region 4260563..4260872 FT /rpt_family="Alu" FT repeat_region 4260843..4260872 FT /rpt_family="(A)n" FT repeat_region 4262055..4262209 FT /rpt_family="L1" FT repeat_region 4262272..4262296 FT /rpt_family="(ATTG)n" FT repeat_region 4262293..4262575 FT /rpt_family="Alu" FT repeat_region 4262577..4262886 FT /rpt_family="Alu" FT repeat_region 4262749..4262772 FT /rpt_family="AT_rich" FT repeat_region 4262895..4263037 FT /rpt_family="L1" FT repeat_region 4263508..4263611 FT /rpt_family="MIR" FT repeat_region 4264089..4264118 FT /rpt_family="(TTTA)n" FT repeat_region 4264100..4264398 FT /rpt_family="Alu" FT repeat_region 4264467..4264778 FT /rpt_family="Alu" FT repeat_region 4265541..4265565 FT /rpt_family="(TTTC)n" FT repeat_region 4265542..4265847 FT /rpt_family="Alu" FT repeat_region 4266145..4266174 FT /rpt_family="(T)n" FT misc_feature 4266815..4266820 FT /note="match to EST BI003668 (NID:g14407742)" FT repeat_region 4267417..4267777 FT /rpt_family="MaLR" FT misc_feature 4267964..4267966 FT /note="match to EST AI633616 (NID:g4684946) th70c09.x1" FT repeat_region 4268124..4268270 FT /rpt_family="MIR" FT repeat_region 4268993..4269283 FT /rpt_family="Alu" FT misc_feature 4269425..4269750 FT /note="match to EST AI887937 (NID:g5593101) tk14e11.x1" FT misc_feature 4269428..4269750 FT /note="match to EST BI856853 (NID:g15997600)" FT misc_feature 4269428..4269753 FT /note="match to EST BG214154 (NID:g13735841)" FT misc_feature 4269432..4269750 FT /note="match to EST AI183462 (NID:g3734100) qd42b02.x1" FT misc_feature 4269433..4269750 FT /note="match to EST AI633616 (NID:g4684946) th70c09.x1" FT misc_feature 4269434..4269753 FT /note="similar to Sus scrofa EST BF711413 (NID:g12010888)" FT misc_feature 4269436..4269750 FT /note="match to EST BG187102 (NID:g13708789)" FT /note="similar to Rattus norvegicus EST BE115304 FT (NID:g8507409)" FT misc_feature 4269440..4269750 FT /note="similar to Mus musculus EST BG071774 FT (NID:g12554343)" FT misc_feature 4269465..4269750 FT /note="match to EST AL526640 (NID:g12790133)" FT misc_feature 4269490..4269750 FT /note="match to EST AL570132 (NID:g12926142)" FT misc_feature 4269510..4269750 FT /note="match to EST BE548629 (NID:g9777274)" FT misc_feature 4269640..4269750 FT /note="match to EST AI347186 (NID:g4084392) tc04f12.x1" FT misc_feature 4269656..4269713 FT /note="match to EST BI520528 (NID:g15345320)" FT misc_feature 4270234..4270344 FT /note="similar to Rattus norvegicus EST BE115304 FT (NID:g8507409)" FT misc_feature 4270250..4270342 FT /note="match to EST BI335887 (NID:g15030621)" FT misc_feature 4270257..4270328 FT /note="match to EST BG187102 (NID:g13708789)" FT misc_feature 4270257..4270417 FT /note="match to EST AI633616 (NID:g4684946) th70c09.x1" FT misc_feature 4270257..4270342 FT /note="match to EST BE548629 (NID:g9777274)" FT /note="match to EST BI856853 (NID:g15997600)" FT /note="match to EST AI347186 (NID:g4084392) tc04f12.x1" FT /note="match to EST AL570132 (NID:g12926142)" FT /note="match to EST AL526640 (NID:g12790133)" FT /note="similar to Mus musculus EST BG071774 FT (NID:g12554343)" FT /note="match to EST AI183462 (NID:g3734100) qd42b02.x1" FT /note="match to EST AI887937 (NID:g5593101) tk14e11.x1" FT repeat_region 4270347..4270367 FT /rpt_family="AT_rich" FT misc_feature 4270468..4271320 FT /note="match to EST BI837521 (NID:g15949071)" FT repeat_region 4270751..4271507 FT /rpt_family="L1" FT repeat_region 4271522..4271663 FT /rpt_family="L1" FT repeat_region 4271664..4271944 FT /rpt_family="Alu" FT repeat_region 4271945..4272010 FT /rpt_family="L1" FT repeat_region 4272035..4272607 FT /rpt_family="L1" FT repeat_region 4272608..4273410 FT /rpt_family="L1" FT repeat_region 4273411..4274047 FT /rpt_family="L1" FT repeat_region 4274072..4274353 FT /rpt_family="MER2_type" FT repeat_region 4274362..4274447 FT /rpt_family="MER2_type" FT repeat_region 4275171..4275279 FT /rpt_family="Alu" FT misc_feature 4275310..4275336 FT /note="match to EST AI347186 (NID:g4084392) tc04f12.x1" FT misc_feature 4275310..4275402 FT /note="match to EST AI183462 (NID:g3734100) qd42b02.x1" FT misc_feature 4275310..4275396 FT /note="match to EST BE548629 (NID:g9777274)" FT /note="match to EST BI335887 (NID:g15030621)" FT /note="match to EST BI856853 (NID:g15997600)" FT /note="match to EST AL570132 (NID:g12926142)" FT /note="match to EST AL526640 (NID:g12790133)" FT /note="similar to Mus musculus EST BG071774 FT (NID:g12554343)" FT /note="match to EST AI887937 (NID:g5593101) tk14e11.x1" FT misc_feature 4275332..4275396 FT /note="match to EST BI520528 (NID:g15345320)" FT repeat_region 4275682..4275986 FT /rpt_family="Alu" FT misc_feature 4276045..4276379 FT /note="similar to Mus musculus EST BG071774 FT (NID:g12554343)" FT misc_feature 4276094..4276418 FT /note="match to EST BE548629 (NID:g9777274)" FT misc_feature 4276094..4276191 FT /note="match to EST BI335887 (NID:g15030621)" FT misc_feature 4276094..4276150 FT /note="match to EST BI856853 (NID:g15997600)" FT misc_feature 4276094..4276496 FT /note="match to EST BI520528 (NID:g15345320)" FT /note="match to EST AL570132 (NID:g12926142)" FT /note="match to EST AL526640 (NID:g12790133)" FT misc_feature 4276094..4276139 FT /note="match to EST AI887937 (NID:g5593101) tk14e11.x1" FT misc_feature 4276181..4276481 FT /note="similar to Mus musculus EST BG084619 FT (NID:g12567183)" FT misc_feature 4276211..4276496 FT /note="match to EST AL554424 (NID:g12895192)" FT misc_feature 4276294..4276482 FT /note="match to EST AW361031 (NID:g6865681)" FT repeat_region 4276311..4276364 FT /rpt_family="CT-rich" FT misc_feature 4276333..4276585 FT /note="match to EST BE843539 (NID:g10276021)" FT misc_feature 4276345..4276496 FT /note="match to EST BG188642 (NID:g13710329)" FT misc_feature 4276350..4276496 FT /note="match to EST BG207193 (NID:g13728880)" FT misc_feature 4276361..4276496 FT /note="match to EST AA355932 (NID:g2008251)" FT misc_feature 4276362..4276496 FT /note="match to EST AI688625 (NID:g4899919) wd40a02.x1" FT misc_feature 4276471..4276496 FT /note="match to EST BI086623 (NID:g14504953)" FT repeat_region 4276834..4277045 FT /rpt_family="MIR" FT repeat_region 4277164..4277370 FT /rpt_family="Alu" FT repeat_region 4277435..4277721 FT /rpt_family="Alu" FT repeat_region 4277951..4278003 FT /rpt_family="MIR" FT repeat_region 4278158..4278290 FT /rpt_family="Alu" FT misc_feature 4278276..4278290 FT /note="match to EST BF513364 (NID:g11598543)" FT repeat_region 4278302..4278597 FT /rpt_family="Alu" FT misc_feature 4278732..4278738 FT /note="match to EST AU128983 (NID:g10989337)" FT repeat_region 4278786..4279070 FT /rpt_family="Alu" FT misc_feature 4279469..4279474 FT /note="match to EST BF686055 (NID:g11971463)" FT repeat_region 4280336..4280450 FT /rpt_family="L2" FT repeat_region 4280450..4280585 FT /rpt_family="MIR" FT repeat_region 4280770..4281081 FT /rpt_family="Alu" FT misc_feature 4281162..4281257 FT /note="similar to EST BB615626 (NID:g16455874)" FT /note="similar to Mus musculus EST AA089115 (NID:g1634594) FT ml57e05.r1" FT /note="similar to Mus musculus EST BG076061 FT (NID:g12558630)" FT misc_feature 4281173..4281257 FT /note="similar to Homo sapiens EST W43027 (NID:g1327527) FT zc84g12.s1" FT misc_feature 4281174..4281224 FT /note="match to EST BG207193 (NID:g13728880)" FT misc_feature 4281174..4281257 FT /note="match to EST AL554424 (NID:g12895192)" FT /note="match to EST BI086623 (NID:g14504953)" FT /note="match to EST BI520528 (NID:g15345320)" FT /note="similar to Mus musculus EST BG084619 FT (NID:g12567183)" FT /note="match to EST AI688625 (NID:g4899919) wd40a02.x1" FT /note="match to EST AA355932 (NID:g2008251)" FT /note="match to EST BG188642 (NID:g13710329)" FT /note="match to EST AL570132 (NID:g12926142)" FT misc_feature 4281174..4281216 FT /note="match to EST AL526640 (NID:g12790133)" FT misc_feature 4281176..4281257 FT /note="similar to Bos taurus EST BI681848 (NID:g15634773)" FT misc_feature 4281221..4281257 FT /note="match to EST BG718996 (NID:g13998183)" FT misc_feature 4281369..4281478 FT /note="similar to Mus musculus EST BG084619 FT (NID:g12567183)" FT misc_feature 4281369..4281451 FT /note="similar to Homo sapiens EST W43027 (NID:g1327527) FT zc84g12.s1" FT misc_feature 4281369..4281404 FT /note="match to EST AA355932 (NID:g2008251)" FT misc_feature 4281369..4281476 FT /note="match to EST BG718996 (NID:g13998183)" FT /note="match to EST AL554424 (NID:g12895192)" FT /note="match to EST BI086623 (NID:g14504953)" FT /note="similar to EST BB615626 (NID:g16455874)" FT /note="similar to Bos taurus EST BI681848 (NID:g15634773)" FT /note="match to EST BI827878 (NID:g15939428)" FT /note="similar to Mus musculus EST AA089115 (NID:g1634594) FT ml57e05.r1" FT /note="match to EST BI520528 (NID:g15345320)" FT /note="similar to Mus musculus EST BG076061 FT (NID:g12558630)" FT /note="match to EST AI688625 (NID:g4899919) wd40a02.x1" FT /note="match to EST BG188642 (NID:g13710329)" FT misc_feature 4281369..4281430 FT /note="match to EST AL570132 (NID:g12926142)" FT misc_feature 4281382..4281476 FT /note="similar to Mus musculus EST BG088593 FT (NID:g12571157)" FT misc_feature 4281402..4281476 FT /note="match to EST BG179468 (NID:g12686171)" FT misc_feature 4281463..4281476 FT /note="match to EST AA424663 (NID:g2103616) zv91f02.r1" FT repeat_region 4281629..4282271 FT /rpt_family="L1" FT repeat_region 4283048..4283079 FT /rpt_family="(T)n" FT repeat_region 4283050..4283344 FT /rpt_family="Alu" FT misc_feature 4283498..4283624 FT /note="similar to Mus musculus EST BG917478 FT (NID:g14297954)" FT misc_feature 4283510..4283570 FT /note="match to EST BI520528 (NID:g15345320)" FT misc_feature 4283510..4283605 FT /note="match to EST BG179468 (NID:g12686171)" FT misc_feature 4283510..4283630 FT /note="match to EST AI688625 (NID:g4899919) wd40a02.x1" FT misc_feature 4283510..4283624 FT /note="match to EST BG718996 (NID:g13998183)" FT /note="match to EST AA424663 (NID:g2103616) zv91f02.r1" FT /note="match to EST AL554424 (NID:g12895192)" FT /note="match to EST BI086623 (NID:g14504953)" FT /note="similar to EST BB615626 (NID:g16455874)" FT /note="similar to Bos taurus EST BI681848 (NID:g15634773)" FT /note="similar to Mus musculus EST AL361425 (NID:g9692454)" FT /note="match to EST BI827878 (NID:g15939428)" FT /note="similar to Mus musculus EST AA089115 (NID:g1634594) FT ml57e05.r1" FT /note="match to EST BG188642 (NID:g13710329)" FT misc_feature 4283569..4283624 FT /note="match to EST BG720612 (NID:g13999799)" FT misc_feature 4283616..4283624 FT /note="match to EST AI418609 (NID:g4264540) tg37d12.x1" FT repeat_region 4284906..4285174 FT /rpt_family="Alu" FT misc_feature 4285312..4285522 FT /note="similar to Mus musculus EST W62071 (NID:g1368811) FT md84e08.r1" FT misc_feature 4285348..4285522 FT /note="match to EST AI418609 (NID:g4264540) tg37d12.x1" FT /note="match to EST BG718996 (NID:g13998183)" FT /note="match to EST AA424663 (NID:g2103616) zv91f02.r1" FT /note="match to EST AL554424 (NID:g12895192)" FT /note="match to EST BI086623 (NID:g14504953)" FT /note="similar to Mus musculus EST BG088593 FT (NID:g12571157)" FT /note="similar to EST BB615626 (NID:g16455874)" FT /note="similar to Bos taurus EST BI681848 (NID:g15634773)" FT /note="similar to Mus musculus EST AL361425 (NID:g9692454)" FT /note="match to EST BG720612 (NID:g13999799)" FT /note="match to EST BI827878 (NID:g15939428)" FT misc_feature 4285348..4285496 FT /note="similar to Mus musculus EST BG917478 FT (NID:g14297954)" FT misc_feature 4285348..4285523 FT /note="similar to Mus musculus EST AA089115 (NID:g1634594) FT ml57e05.r1" FT misc_feature 4285348..4285526 FT /note="similar to Mus musculus EST BG076061 FT (NID:g12558630)" FT misc_feature 4285348..4285527 FT /note="match to EST BG188642 (NID:g13710329)" FT misc_feature 4285354..4285522 FT /note="similar to Homo sapiens EST BF174619 FT (NID:g13440833)" FT repeat_region 4285696..4285912 FT /rpt_family="MIR" FT misc_feature 4287430..4287562 FT /note="similar to Mus musculus EST BG088593 FT (NID:g12571157)" FT misc_feature 4287684..4287782 FT /note="similar to Mus musculus EST BG088593 FT (NID:g12571157)" FT misc_feature 4288246..4288299 FT /note="match to EST AI418609 (NID:g4264540) tg37d12.x1" FT /note="match to EST BG718996 (NID:g13998183)" FT /note="match to EST AA424663 (NID:g2103616) zv91f02.r1" FT /note="match to EST AL554424 (NID:g12895192)" FT /note="match to EST BI086623 (NID:g14504953)" FT /note="match to EST BG720612 (NID:g13999799)" FT /note="match to EST BI827878 (NID:g15939428)" FT repeat_region 4288360..4288390 FT /rpt_family="AT_rich" FT repeat_region 4288374..4288676 FT /rpt_family="Alu" FT repeat_region 4289264..4289409 FT /rpt_family="MIR" FT misc_feature 4289526..4289531 FT /note="similar to Homo sapiens EST W43027 (NID:g1327527) FT zc84g12.s1" FT repeat_region 4289811..4289928 FT /rpt_family="MIR" FT repeat_region 4290205..4290230 FT /rpt_family="(T)n" FT repeat_region 4290642..4290751 FT /rpt_family="MIR" FT repeat_region 4290876..4290953 FT /rpt_family="MIR" FT repeat_region 4291018..4291088 FT /rpt_family="L2" FT repeat_region 4291187..4291415 FT /rpt_family="MIR" FT misc_feature 4291330..4291764 FT /note="match to EST BG720612 (NID:g13999799)" FT misc_feature 4291330..4291704 FT /note="match to EST BI827878 (NID:g15939428)" FT repeat_region 4291508..4291598 FT /rpt_family="AcHobo" FT misc_feature 4291763..4291896 FT /note="match to EST AI418609 (NID:g4264540) tg37d12.x1" FT misc_feature 4291763..4291849 FT /note="match to EST BI086623 (NID:g14504953)" FT misc_feature 4291763..4291879 FT /note="match to EST BG718996 (NID:g13998183)" FT misc_feature 4291763..4291875 FT /note="similar to Mus musculus EST W62071 (NID:g1368811) FT md84e08.r1" FT misc_feature 4291763..4291854 FT /note="match to EST AL554424 (NID:g12895192)" FT /note="similar to Bos taurus EST BI681848 (NID:g15634773)" FT misc_feature 4291763..4291839 FT /note="similar to Mus musculus EST BG088593 FT (NID:g12571157)" FT /note="similar to EST BB615626 (NID:g16455874)" FT /note="similar to Mus musculus EST AL361425 (NID:g9692454)" FT misc_feature 4291763..4291856 FT /note="match to EST AA424663 (NID:g2103616) zv91f02.r1" FT misc_feature 4292040..4292079 FT /note="similar to Mus musculus EST BI697072 FT (NID:g15659701)" FT misc_feature 4292381 FT /note="match to EST BG718996 (NID:g13998183)" FT repeat_region 4292535..4292684 FT /rpt_family="MIR" FT repeat_region 4292683..4292753 FT /rpt_family="L2" FT repeat_region 4292871..4293221 FT /rpt_family="MaLR" FT repeat_region 4293448..4293554 FT /rpt_family="L2" FT repeat_region 4293576..4293719 FT /rpt_family="Alu" FT repeat_region 4293721..4294023 FT /rpt_family="Alu" FT repeat_region 4294050..4294166 FT /rpt_family="L2" FT repeat_region 4294184..4294278 FT /rpt_family="L2" FT repeat_region 4294739..4294841 FT /rpt_family="MIR" FT repeat_region 4294844..4294947 FT /rpt_family="L2" FT repeat_region 4295158..4295250 FT /rpt_family="MIR" FT repeat_region 4295265..4295727 FT /rpt_family="MaLR" FT repeat_region 4295736..4295859 FT /rpt_family="MIR" FT repeat_region 4296081..4296101 FT /rpt_family="AT_rich" FT repeat_region 4296098..4296380 FT /rpt_family="Alu" FT repeat_region 4296596..4296659 FT /rpt_family="ERV1" FT repeat_region 4296600..4296643 FT /rpt_family="(TG)n" FT repeat_region 4296668..4296844 FT /rpt_family="MIR" FT repeat_region 4296845..4297208 FT /rpt_family="MaLR" FT misc_feature 4297149..4297608 FT /note="match to EST AW862925 (NID:g7996940)" FT misc_feature 4297149..4297629 FT /note="match to EST AW892925 (NID:g8057130)" FT repeat_region 4297209..4297260 FT /rpt_family="MIR" FT repeat_region 4297606..4297874 FT /rpt_family="L2" FT repeat_region 4298027..4298391 FT /rpt_family="MaLR" FT misc_feature 4298652..4298655 FT /note="match to EST AI347186 (NID:g4084392) tc04f12.x1" FT repeat_region 4298786..4298815 FT /rpt_family="AT_rich" FT repeat_region 4299230..4299521 FT /rpt_family="Alu" FT misc_feature 4299501..4299515 FT /note="match to EST BG179468 (NID:g12686171)" FT misc_feature 4299505..4299518 FT /note="match to EST BF510602 (NID:g11593900)" FT repeat_region 4299657..4299772 FT /rpt_family="MER1_type" FT repeat_region 4299782..4299934 FT /rpt_family="MIR" FT repeat_region 4300157..4300451 FT /rpt_family="Alu" FT misc_feature 4300402..4300735 FT /note="match to EST BF847683 (NID:g12234833)" FT repeat_region 4300634..4300727 FT /rpt_family="L2" FT repeat_region 4300780..4301019 FT /rpt_family="L2" FT repeat_region 4301234..4301255 FT /rpt_family="AT_rich" FT repeat_region 4301328..4301476 FT /rpt_family="MER1_type" FT repeat_region 4301504..4301538 FT /rpt_family="(TG)n" FT misc_feature 4301654..4301824 FT /note="similar to Mus musculus EST BI697072 FT (NID:g15659701)" FT misc_feature 4301663..4301824 FT /note="similar to Mus musculus EST BG922724 FT (NID:g14303200)" FT /note="similar to EST BB602509 (NID:g16450595)" FT repeat_region 4302322..4302346 FT /rpt_family="AT_rich" FT repeat_region 4302383..4302524 FT /rpt_family="Alu" FT misc_feature 4302512..4302524 FT /note="similar to Homo sapiens EST AI371376 (NID:g4150129) FT qo83f11.x1" FT repeat_region 4303625..4303660 FT /rpt_family="AT_rich" FT misc_feature 4303716..4304061 FT /note="similar to EST BB602509 (NID:g16450595)" FT misc_feature 4303716..4304102 FT /note="similar to Mus musculus EST BI697072 FT (NID:g15659701)" FT misc_feature 4303735..4304500 FT /note="match to EST BF035755 (NID:g10743495)" FT misc_feature 4304343..4304671 FT /note="match to EST BI003668 (NID:g14407742)" FT misc_feature 4304401 FT /note="match to EST AW621122 (NID:g7382114)" FT misc_feature 4304425..4304583 FT /note="match to EST AW621122 (NID:g7382114)" FT misc_feature 4304451..4304818 FT /note="match to EST BI001954 (NID:g14406028)" FT repeat_region 4305454..4305512 FT /rpt_family="(TC)n" FT repeat_region 4305953..4306243 FT /rpt_family="Alu" FT repeat_region 4306391..4306582 FT /rpt_family="MER1_type" FT repeat_region 4306577..4306710 FT /rpt_family="MER1_type" FT misc_feature 4306660..4306666 FT /note="similar to Homo sapiens EST AW514861 (NID:g7152943) FT xu99f03.x1" FT repeat_region 4306866..4306910 FT /rpt_family="AT_rich" FT misc_feature 4307300..4307646 FT /note="match to EST AA452793 (NID:g2166462) zx39h06.r1" FT misc_feature 4307565..4308074 FT /note="match to EST BF196920 (NID:g11085469)" FT repeat_region 4308390..4308458 FT /rpt_family="L2" FT repeat_region 4309079..4309321 FT /rpt_family="MIR" FT repeat_region 4309474..4309576 FT /rpt_family="MIR" FT repeat_region 4309732..4309798 FT /rpt_family="MER1_type" FT repeat_region 4309799..4310102 FT /rpt_family="Alu" FT repeat_region 4309800..4309822 FT /rpt_family="(TTTA)n" FT repeat_region 4310103..4310162 FT /rpt_family="MER1_type" FT repeat_region 4310371..4310496 FT /rpt_family="L2" FT repeat_region 4311235..4311324 FT /rpt_family="CR1" FT repeat_region 4311985..4312224 FT /rpt_family="MIR" FT repeat_region 4312239..4312544 FT /rpt_family="Alu" FT repeat_region 4312401..4312428 FT /rpt_family="AT_rich" FT misc_feature 4314768..4314848 FT /note="match to EST BI001954 (NID:g14406028)" FT misc_feature 4314768..4314843 FT /note="similar to Mus musculus EST BG922724 FT (NID:g14303200)" FT repeat_region 4315516..4315557 FT /rpt_family="AcHobo" FT repeat_region 4316090..4316115 FT /rpt_family="AT_rich" FT repeat_region 4316528..4316688 FT /rpt_family="MIR" FT misc_feature 4316770..4317148 FT /note="match to EST R60555 (NID:g831250) yh14c03.s1" FT misc_feature 4317340..4317445 FT /note="match to EST R22697 (NID:g777454) yg08d07.r1" FT misc_feature 4317361..4317445 FT /note="match to EST BM151017 (NID:g17174048)" FT misc_feature 4317363..4317445 FT /note="similar to Mus musculus EST BB666797 FT (NID:g16500430)" FT /note="similar to Mus musculus EST BF714020 FT (NID:g12013292)" FT /note="similar to Mus musculus EST BG922724 FT (NID:g14303200)" FT misc_feature 4317536..4317698 FT /note="similar to Mus musculus EST BB666797 FT (NID:g16500430)" FT misc_feature 4317536..4317697 FT /note="match to EST BM151017 (NID:g17174048)" FT /note="match to EST R22697 (NID:g777454) yg08d07.r1" FT /note="similar to Mus musculus EST BF714020 FT (NID:g12013292)" FT /note="similar to Mus musculus EST BG922724 FT (NID:g14303200)" FT repeat_region 4317847..4317970 FT /rpt_family="L2" FT repeat_region 4318626..4318758 FT /rpt_family="Alu" FT repeat_region 4319049..4319342 FT /rpt_family="L1" FT misc_feature 4319127..4319569 FT /note="match to EST R60609 (NID:g831304) yh14c03.r1" FT repeat_region 4319348..4319409 FT /rpt_family="L1" FT repeat_region 4320061..4320360 FT /rpt_family="Alu" FT repeat_region 4320334..4320369 FT /rpt_family="A-rich" FT repeat_region 4320604..4320639 FT /rpt_family="(T)n" FT repeat_region 4320610..4320918 FT /rpt_family="Alu" FT repeat_region 4321266..4321524 FT /rpt_family="Alu" FT repeat_region 4321531..4321769 FT /rpt_family="Alu" FT repeat_region 4322167..4322345 FT /rpt_family="Alu" FT misc_feature 4322367..4322566 FT /note="match to EST BM151017 (NID:g17174048)" FT misc_feature 4322367..4322485 FT /note="match to EST R22697 (NID:g777454) yg08d07.r1" FT misc_feature 4322367..4322490 FT /note="similar to Mus musculus EST BF714020 FT (NID:g12013292)" FT misc_feature 4322367..4322600 FT /note="similar to Mus musculus EST BG922724 FT (NID:g14303200)" FT misc_feature 4322493..4322738 FT /note="match to EST N53915 (NID:g1195081) yy98g07.r1" FT misc_feature 4322591..4323362 FT /note="match to EST BG764475 (NID:g14075128)" FT misc_feature 4322945..4323516 FT /note="match to EST BF061904 (NID:g10820814)" FT misc_feature 4323159..4323510 FT /note="match to EST AI014894 (NID:g3229230) ot74c08.s1" FT misc_feature 4323328..4323513 FT /note="match to EST AA588376 (NID:g2401551) nf40g06.s1" FT repeat_region 4323639..4323754 FT /rpt_family="MIR" FT repeat_region 4324612..4324693 FT /rpt_family="L2" FT repeat_region 4324694..4324994 FT /rpt_family="Alu" FT repeat_region 4324965..4325006 FT /rpt_family="(A)n" FT repeat_region 4324995..4325200 FT /rpt_family="L2" FT repeat_region 4325201..4325336 FT /rpt_family="Alu" FT repeat_region 4325337..4325437 FT /rpt_family="L2" FT repeat_region 4325515..4325831 FT /rpt_family="L2" FT repeat_region 4325832..4326368 FT /rpt_family="ERV1" FT repeat_region 4326369..4326587 FT /rpt_family="L2" FT repeat_region 4326760..4327052 FT /rpt_family="Alu" FT repeat_region 4327319..4327413 FT /rpt_family="MIR" FT repeat_region 4327565..4327618 FT /rpt_family="MIR" FT repeat_region 4327637..4327771 FT /rpt_family="MER1_type" FT repeat_region 4327841..4328015 FT /rpt_family="MIR" FT repeat_region 4328215..4328505 FT /rpt_family="Alu" FT repeat_region 4328516..4328642 FT /rpt_family="Alu" FT repeat_region 4328647..4328869 FT /rpt_family="L1" FT repeat_region 4328870..4329200 FT /rpt_family="Alu" FT repeat_region 4328871..4328894 FT /rpt_family="(TTTTA)n" FT repeat_region 4329044..4329084 FT /rpt_family="(T)n" FT repeat_region 4329201..4329306 FT /rpt_family="L1" FT repeat_region 4329845..4330005 FT /rpt_family="L1" FT repeat_region 4330006..4330342 FT /rpt_family="MaLR" FT repeat_region 4330343..4330613 FT /rpt_family="Alu" FT repeat_region 4330614..4330719 FT /rpt_family="MaLR" FT repeat_region 4330720..4330830 FT /rpt_family="L1" FT repeat_region 4330846..4330888 FT /rpt_family="MIR" FT repeat_region 4331070..4331092 FT /rpt_family="(T)n" FT repeat_region 4331406..4331518 FT /rpt_family="MIR" FT repeat_region 4331568..4331680 FT /rpt_family="L2" FT repeat_region 4331777..4332177 FT /rpt_family="MaLR" FT repeat_region 4332178..4332470 FT /rpt_family="Alu" FT repeat_region 4332471..4332536 FT /rpt_family="MaLR" FT repeat_region 4333523..4333768 FT /rpt_family="MaLR" FT repeat_region 4333768..4333926 FT /rpt_family="MaLR" FT repeat_region 4333921..4333945 FT /rpt_family="AT_rich" FT repeat_region 4333927..4334214 FT /rpt_family="Alu" FT repeat_region 4334215..4334472 FT /rpt_family="MaLR" FT repeat_region 4334761..4335023 FT /rpt_family="Alu" FT repeat_region 4335357..4335420 FT /rpt_family="MIR" FT repeat_region 4335455..4335740 FT /rpt_family="Alu" FT repeat_region 4336284..4336449 FT /rpt_family="L1" FT repeat_region 4336464..4337463 FT /rpt_family="ERVK" FT repeat_region 4337489..4337799 FT /rpt_family="Alu" FT repeat_region 4337771..4337814 FT /rpt_family="A-rich" FT repeat_region 4337838..4338031 FT /rpt_family="Alu" FT repeat_region 4338039..4338077 FT /rpt_family="AT_rich" FT repeat_region 4338114..4338406 FT /rpt_family="Alu" FT repeat_region 4338409..4338866 FT /rpt_family="L1" FT repeat_region 4338890..4338905 FT /rpt_family="ERV1" FT repeat_region 4338906..4339199 FT /rpt_family="Alu" FT repeat_region 4339200..4339824 FT /rpt_family="ERV1" FT repeat_region 4339878..4339922 FT /rpt_family="L2" FT repeat_region 4339938..4340026 FT /rpt_family="L2" FT repeat_region 4340132..4340224 FT /rpt_family="ERVL" FT repeat_region 4341122..4341612 FT /rpt_family="ERV1" FT repeat_region 4341637..4341762 FT /rpt_family="MIR" FT repeat_region 4341890..4341982 FT /rpt_family="L2" FT repeat_region 4342267..4342570 FT /rpt_family="Alu" FT repeat_region 4342755..4342794 FT /rpt_family="(TTTC)n" FT repeat_region 4342765..4343071 FT /rpt_family="Alu" FT repeat_region 4343479..4343533 FT /rpt_family="MaLR" FT repeat_region 4343534..4343659 FT /rpt_family="Alu" FT repeat_region 4343646..4343670 FT /rpt_family="AT_rich" FT repeat_region 4343660..4344039 FT /rpt_family="MaLR" FT repeat_region 4344336..4344534 FT /rpt_family="MaLR" FT repeat_region 4344584..4344639 FT /rpt_family="L2" FT repeat_region 4344969..4345014 FT /rpt_family="(TTCA)n" FT repeat_region 4345190..4345224 FT /rpt_family="(T)n" FT repeat_region 4345197..4345530 FT /rpt_family="Alu" FT repeat_region 4345637..4345661 FT /rpt_family="(T)n" FT repeat_region 4345960..4346068 FT /rpt_family="Alu" FT repeat_region 4346209..4346355 FT /rpt_family="MER1_type" FT repeat_region 4346405..4346497 FT /rpt_family="MER1_type" FT repeat_region 4346560..4346848 FT /rpt_family="Alu" FT repeat_region 4346987..4347094 FT /rpt_family="MIR" FT repeat_region 4347207..4347489 FT /rpt_family="L1" FT repeat_region 4347491..4347635 FT /rpt_family="MIR" FT repeat_region 4347723..4348004 FT /rpt_family="MaLR" FT repeat_region 4348054..4348190 FT /rpt_family="Alu" FT repeat_region 4348204..4348494 FT /rpt_family="Alu" FT repeat_region 4348538..4348699 FT /rpt_family="L1" FT repeat_region 4348923..4349060 FT /rpt_family="L1" FT misc_feature 4349071..4349090 FT /note="similar to Homo sapiens EST AI371376 (NID:g4150129) FT qo83f11.x1" FT misc_feature 4349073..4349088 FT /note="match to EST BG179468 (NID:g12686171)" FT misc_feature 4349077..4349090 FT /note="match to EST BF510602 (NID:g11593900)" FT misc_feature 4349079..4349090 FT /note="match to EST BF061904 (NID:g10820814)" FT repeat_region 4349355..4349550 FT /rpt_family="ERV1" FT repeat_region 4349552..4349842 FT /rpt_family="ERV1" FT repeat_region 4349846..4349874 FT /rpt_family="(T)n" FT repeat_region 4350125..4350457 FT /rpt_family="ERV1" FT repeat_region 4350459..4350542 FT /rpt_family="ERV1" FT repeat_region 4350544..4350839 FT /rpt_family="ERV1" FT repeat_region 4350840..4350907 FT /rpt_family="Alu" FT repeat_region 4350911..4350986 FT /rpt_family="ERV1" FT repeat_region 4350911..4351057 FT /rpt_family="ERV1" FT repeat_region 4351179..4351294 FT /rpt_family="ERV1" FT repeat_region 4351309..4352328 FT /rpt_family="ERV1" FT repeat_region 4352329..4352621 FT /rpt_family="Alu" FT repeat_region 4352622..4353660 FT /rpt_family="ERV1" FT repeat_region 4353661..4353959 FT /rpt_family="Alu" FT repeat_region 4353960..4354262 FT /rpt_family="ERV1" FT repeat_region 4354263..4354570 FT /rpt_family="Alu" FT repeat_region 4354617..4355221 FT /rpt_family="ERV1" FT repeat_region 4355223..4355373 FT /rpt_family="ERVL" FT repeat_region 4355397..4355692 FT /rpt_family="Alu" FT repeat_region 4355696..4356025 FT /rpt_family="ERVL" FT repeat_region 4356026..4356265 FT /rpt_family="ERV1" FT repeat_region 4356266..4356576 FT /rpt_family="Alu" FT repeat_region 4356577..4356748 FT /rpt_family="ERV1" FT repeat_region 4356783..4356922 FT /rpt_family="ERV1" FT repeat_region 4356923..4357384 FT /rpt_family="ERV1" FT repeat_region 4357386..4357699 FT /rpt_family="MaLR" FT repeat_region 4357730..4357785 FT /rpt_family="(CATTT)n" FT repeat_region 4358817..4358906 FT /rpt_family="MIR" FT repeat_region 4358907..4358964 FT /rpt_family="L1" FT repeat_region 4358965..4359267 FT /rpt_family="Alu" FT repeat_region 4359268..4359855 FT /rpt_family="L1" FT repeat_region 4359977..4360192 FT /rpt_family="MIR" FT repeat_region 4360730..4360804 FT /rpt_family="MIR" FT repeat_region 4360805..4361048 FT /rpt_family="ERV1" FT repeat_region 4361049..4361347 FT /rpt_family="MaLR" FT repeat_region 4361348..4361645 FT /rpt_family="Alu" FT repeat_region 4361649..4361954 FT /rpt_family="Alu" FT repeat_region 4361955..4362026 FT /rpt_family="MaLR" FT repeat_region 4362027..4362422 FT /rpt_family="ERV1" FT repeat_region 4362582..4362767 FT /rpt_family="ERV1" FT repeat_region 4362768..4363074 FT /rpt_family="Alu" FT repeat_region 4363075..4363368 FT /rpt_family="ERV1" FT repeat_region 4363862..4363932 FT /rpt_family="MaLR" FT repeat_region 4363933..4364156 FT /rpt_family="MaLR" FT repeat_region 4364157..4364471 FT /rpt_family="Alu" FT repeat_region 4364472..4364630 FT /rpt_family="MaLR" FT repeat_region 4364631..4364755 FT /rpt_family="MaLR" FT repeat_region 4364781..4364943 FT /rpt_family="MaLR" FT repeat_region 4364947..4365039 FT /rpt_family="MIR" FT repeat_region 4365045..4365124 FT /rpt_family="Mariner" FT repeat_region 4365698..4366073 FT /rpt_family="ERVL" FT repeat_region 4366180..4366531 FT /rpt_family="MaLR" FT repeat_region 4366542..4367013 FT /rpt_family="MaLR" FT repeat_region 4367253..4367395 FT /rpt_family="CR1" FT repeat_region 4367451..4367644 FT /rpt_family="MIR" FT repeat_region 4368100..4368225 FT /rpt_family="L1" FT repeat_region 4368226..4368595 FT /rpt_family="MaLR" FT repeat_region 4368596..4368968 FT /rpt_family="L1" FT repeat_region 4368969..4369012 FT /rpt_family="MIR" FT repeat_region 4369034..4369166 FT /rpt_family="Alu" FT repeat_region 4369810..4370163 FT /rpt_family="MaLR" FT repeat_region 4370413..4370567 FT /rpt_family="MIR" FT repeat_region 4370863..4370961 FT /rpt_family="L2" FT repeat_region 4371109..4371145 FT /rpt_family="MIR" FT repeat_region 4371324..4371607 FT /rpt_family="MaLR" FT repeat_region 4371613..4371861 FT /rpt_family="MaLR" FT repeat_region 4371862..4372171 FT /rpt_family="Alu" FT repeat_region 4372172..4372420 FT /rpt_family="MaLR" FT repeat_region 4372424..4372882 FT /rpt_family="MaLR" FT repeat_region 4373124..4373479 FT /rpt_family="Alu" FT repeat_region 4373695..4373845 FT /rpt_family="L1" FT repeat_region 4373993..4374312 FT /rpt_family="Alu" FT repeat_region 4374600..4374716 FT /rpt_family="MIR" FT repeat_region 4375267..4375389 FT /rpt_family="L2" FT repeat_region 4375363..4375590 FT /rpt_family="MIR" FT repeat_region 4375685..4375919 FT /rpt_family="Alu" FT repeat_region 4375968..4376656 FT /rpt_family="L1" FT repeat_region 4376892..4376963 FT /rpt_family="MIR" FT repeat_region 4377093..4377196 FT /rpt_family="MER1_type" FT repeat_region 4377213..4377278 FT /rpt_family="CT-rich" FT repeat_region 4377279..4377462 FT /rpt_family="Alu" FT repeat_region 4377463..4377488 FT /rpt_family="(TTA)n" FT repeat_region 4377489..4377609 FT /rpt_family="Alu" FT repeat_region 4377680..4377841 FT /rpt_family="MER1_type" FT repeat_region 4378207..4378486 FT /rpt_family="MaLR" FT repeat_region 4378487..4378794 FT /rpt_family="Alu" FT repeat_region 4378795..4378965 FT /rpt_family="MaLR" FT repeat_region 4380133..4380254 FT /rpt_family="MIR" FT repeat_region 4380430..4380734 FT /rpt_family="Alu" FT repeat_region 4380829..4381085 FT /rpt_family="L1" FT repeat_region 4381279..4381348 FT /rpt_family="MIR" FT repeat_region 4381487..4381699 FT /rpt_family="ERVL" FT repeat_region 4382253..4382557 FT /rpt_family="Alu" FT repeat_region 4382955..4383017 FT /rpt_family="MIR" FT repeat_region 4383300..4383372 FT /rpt_family="L2" FT repeat_region 4383392..4383435 FT /rpt_family="AT_rich" FT repeat_region 4383552..4383897 FT /rpt_family="Alu" FT repeat_region 4384135..4384266 FT /rpt_family="L2" FT repeat_region 4384528..4384682 FT /rpt_family="L1" FT repeat_region 4385131..4385274 FT /rpt_family="MIR" FT repeat_region 4385507..4385804 FT /rpt_family="Alu" FT repeat_region 4386086..4386538 FT /rpt_family="MaLR" FT repeat_region 4387024..4387079 FT /rpt_family="(TG)n" FT repeat_region 4387109..4387130 FT /rpt_family="GC_rich" FT misc_feature 4387594..4389919 FT /note="CpG_island (%GC=71.6, o/e=0.80, #CpGs=233)" FT repeat_region 4390929..4391093 FT /rpt_family="CR1" FT repeat_region 4391163..4391324 FT /rpt_family="MIR" FT repeat_region 4391558..4391759 FT /rpt_family="MIR" FT repeat_region 4392879..4393078 FT /rpt_family="MIR" FT repeat_region 4393683..4393872 FT /rpt_family="MIR" FT repeat_region 4394462..4394576 FT /rpt_family="MIR" FT repeat_region 4395698..4395865 FT /rpt_family="MIR" FT repeat_region 4396662..4396737 FT /rpt_family="MIR" FT repeat_region 4396960..4397054 FT /rpt_family="MER1_type" FT repeat_region 4397017..4397071 FT /rpt_family="MER1_type" FT repeat_region 4398767..4398791 FT /rpt_family="(TG)n" FT repeat_region 4399078..4399158 FT /rpt_family="MIR" FT repeat_region 4399669..4399979 FT /rpt_family="Alu" FT repeat_region 4399997..4400857 FT /rpt_family="L1" FT repeat_region 4400858..4401169 FT /rpt_family="Alu" FT repeat_region 4401170..4401417 FT /rpt_family="L1" FT repeat_region 4401418..4401761 FT /rpt_family="MER1_type" FT repeat_region 4401762..4402382 FT /rpt_family="L1" FT repeat_region 4402384..4402733 FT /rpt_family="MER1_type" FT repeat_region 4403474..4403566 FT /rpt_family="AcHobo" FT repeat_region 4403620..4403914 FT /rpt_family="Alu" FT repeat_region 4403922..4404102 FT /rpt_family="Alu" FT repeat_region 4404103..4404414 FT /rpt_family="Alu" FT repeat_region 4404415..4404514 FT /rpt_family="AcHobo" FT repeat_region 4404819..4404845 FT /rpt_family="(CTCA)n" FT repeat_region 4404945..4405416 FT /rpt_family="MaLR" FT repeat_region 4405426..4405516 FT /rpt_family="MIR" FT repeat_region 4405748..4405814 FT /rpt_family="MER1_type" FT repeat_region 4406735..4407139 FT /rpt_family="MaLR" FT repeat_region 4407209..4407321 FT /rpt_family="MIR" FT repeat_region 4407763..4408053 FT /rpt_family="Alu" FT repeat_region 4408096..4408174 FT /rpt_family="MER1_type" FT repeat_region 4409495..4409615 FT /rpt_family="MIR" FT repeat_region 4410198..4410486 FT /rpt_family="Alu" FT repeat_region 4410650..4410746 FT /rpt_family="L2" FT repeat_region 4411814..4411921 FT /rpt_family="MIR" FT repeat_region 4412092..4412589 FT /rpt_family="MER2_type" FT repeat_region 4412590..4412882 FT /rpt_family="Alu" FT repeat_region 4412883..4413188 FT /rpt_family="MER2_type" FT repeat_region 4413189..4413521 FT /rpt_family="Alu" FT repeat_region 4413522..4413908 FT /rpt_family="MER2_type" FT repeat_region 4414074..4414142 FT /rpt_family="MER1_type" FT repeat_region 4414803..4414906 FT /rpt_family="L2" FT repeat_region 4416011..4416079 FT /rpt_family="MER1_type" FT repeat_region 4416314..4416454 FT /rpt_family="MIR" FT repeat_region 4416797..4416933 FT /rpt_family="Alu" FT repeat_region 4416956..4417099 FT /rpt_family="MIR" FT repeat_region 4417862..4417954 FT /rpt_family="MIR" FT repeat_region 4418781..4418893 FT /rpt_family="L2" FT repeat_region 4422691..4422834 FT /rpt_family="MER2_type" FT repeat_region 4422900..4423052 FT /rpt_family="MIR" FT repeat_region 4423071..4423275 FT /rpt_family="Alu" FT repeat_region 4424012..4424325 FT /rpt_family="Alu" FT repeat_region 4430067..4430273 FT /rpt_family="MIR" FT repeat_region 4430275..4430343 FT /rpt_family="MIR" FT repeat_region 4430828..4430962 FT /rpt_family="MIR" FT repeat_region 4432601..4432676 FT /rpt_family="MIR" FT repeat_region 4433158..4433633 FT /rpt_family="L2" FT repeat_region 4433860..4434008 FT /rpt_family="Mariner" FT repeat_region 4434226..4434387 FT /rpt_family="MIR" FT repeat_region 4434780..4434954 FT /rpt_family="MIR" FT repeat_region 4435110..4435273 FT /rpt_family="SVA" FT repeat_region 4435287..4435365 FT /rpt_family="L2" FT repeat_region 4435609..4435712 FT /rpt_family="MIR" FT repeat_region 4436993..4437029 FT /rpt_family="(TA)n" FT repeat_region 4437190..4437332 FT /rpt_family="L1" FT repeat_region 4438401..4438677 FT /rpt_family="L2" FT repeat_region 4438678..4438982 FT /rpt_family="Alu" FT repeat_region 4438983..4439116 FT /rpt_family="L2" FT repeat_region 4439125..4439308 FT /rpt_family="MER2_type" FT repeat_region 4440628..4440670 FT /rpt_family="(TA)n" FT repeat_region 4440708..4440857 FT /rpt_family="(CA)n" FT repeat_region 4440858..4440945 FT /rpt_family="(CATA)n" FT repeat_region 4440951..4441128 FT /rpt_family="(CA)n" FT repeat_region 4441176..4441390 FT /rpt_family="(CA)n" FT repeat_region 4441436..4441775 FT /rpt_family="L2" FT repeat_region 4441973..4442216 FT /rpt_family="MIR" FT repeat_region 4442264..4442375 FT /rpt_family="MER103" FT repeat_region 4442549..4443082 FT /rpt_family="MaLR" FT repeat_region 4443193..4443531 FT /rpt_family="L1" FT repeat_region 4443551..4443746 FT /rpt_family="L1" FT repeat_region 4443795..4444070 FT /rpt_family="L1" FT repeat_region 4444071..4444370 FT /rpt_family="Alu" FT repeat_region 4444434..4444532 FT /rpt_family="L1" FT repeat_region 4444572..4445092 FT /rpt_family="L1" FT repeat_region 4445116..4445225 FT /rpt_family="L1" FT repeat_region 4445235..4445597 FT /rpt_family="L1" FT repeat_region 4445605..4445817 FT /rpt_family="ERVL" FT repeat_region 4445843..4446086 FT /rpt_family="ERVL" FT repeat_region 4446088..4446444 FT /rpt_family="ERVL" FT repeat_region 4446542..4446570 FT /rpt_family="(CAAA)n" FT repeat_region 4446578..4446615 FT /rpt_family="Alu" FT repeat_region 4446616..4446852 FT /rpt_family="L1" FT repeat_region 4446853..4447163 FT /rpt_family="Alu" FT repeat_region 4447164..4448763 FT /rpt_family="L1" FT repeat_region 4448996..4449034 FT /rpt_family="MIR" FT repeat_region 4449035..4449347 FT /rpt_family="Alu" FT repeat_region 4449348..4449466 FT /rpt_family="MIR" FT repeat_region 4449995..4450064 FT /rpt_family="MIR" FT repeat_region 4450065..4450368 FT /rpt_family="Alu" FT repeat_region 4450369..4450508 FT /rpt_family="MIR" FT repeat_region 4450521..4450560 FT /rpt_family="MIR" FT repeat_region 4450568..4450667 FT /rpt_family="L1" FT repeat_region 4450767..4451076 FT /rpt_family="Alu" FT repeat_region 4451085..4451485 FT /rpt_family="L1" FT repeat_region 4451503..4452054 FT /rpt_family="L1" FT repeat_region 4452055..4452330 FT /rpt_family="Alu" FT repeat_region 4452331..4452370 FT /rpt_family="L1" FT repeat_region 4453132..4454280 FT /rpt_family="MER2_type" FT repeat_region 4454281..4454437 FT /rpt_family="Alu" FT repeat_region 4454442..4455372 FT /rpt_family="MER2_type" FT repeat_region 4455555..4455611 FT /rpt_family="L2" FT repeat_region 4455615..4455822 FT /rpt_family="MER1_type" FT repeat_region 4456467..4456636 FT /rpt_family="MIR" FT repeat_region 4456671..4456882 FT /rpt_family="MIR" FT repeat_region 4457161..4457709 FT /rpt_family="ERV1" FT repeat_region 4457730..4458014 FT /rpt_family="Alu" FT repeat_region 4458249..4458344 FT /rpt_family="MIR" FT repeat_region 4458566..4458785 FT /rpt_family="MIR" FT repeat_region 4459826..4459970 FT /rpt_family="MIR" FT repeat_region 4460399..4460619 FT /rpt_family="MIR" FT repeat_region 4460723..4460817 FT /rpt_family="(CA)n" FT repeat_region 4461278..4461418 FT /rpt_family="L2" FT repeat_region 4461455..4461477 FT /rpt_family="(GGGAGA)n" FT repeat_region 4461600..4462002 FT /rpt_family="L2" FT repeat_region 4463161..4463181 FT /rpt_family="AT_rich" FT repeat_region 4464008..4464202 FT /rpt_family="MIR" FT repeat_region 4464308..4464436 FT /rpt_family="Alu" FT repeat_region 4464525..4464585 FT /rpt_family="MIR" FT repeat_region 4464880..4465120 FT /rpt_family="MER1_type" FT repeat_region 4466168..4466342 FT /rpt_family="L2" FT repeat_region 4466357..4466455 FT /rpt_family="L1" FT repeat_region 4466453..4466872 FT /rpt_family="L1" FT repeat_region 4466873..4467512 FT /rpt_family="L1" FT repeat_region 4467581..4467695 FT /rpt_family="L2" FT repeat_region 4468452..4469186 FT /rpt_family="ERV1" FT repeat_region 4469234..4469447 FT /rpt_family="MIR" FT repeat_region 4469526..4469731 FT /rpt_family="L2" FT repeat_region 4469733..4469805 FT /rpt_family="L1" FT repeat_region 4469807..4470226 FT /rpt_family="ERV1" FT repeat_region 4470227..4470321 FT /rpt_family="ERV1" FT repeat_region 4470327..4470787 FT /rpt_family="L1" FT repeat_region 4470912..4471110 FT /rpt_family="MER1_type" FT repeat_region 4471626..4471859 FT /rpt_family="L2" FT repeat_region 4471918..4472119 FT /rpt_family="MER1_type" FT repeat_region 4472152..4472710 FT /rpt_family="L2" FT repeat_region 4474010..4474085 FT /rpt_family="L2" FT repeat_region 4474758..4474960 FT /rpt_family="MIR" FT repeat_region 4475019..4475319 FT /rpt_family="Alu" FT repeat_region 4475365..4475446 FT /rpt_family="L2" FT repeat_region 4475469..4475526 FT /rpt_family="MER1_type" FT repeat_region 4475762..4476116 FT /rpt_family="L2" FT repeat_region 4476197..4476677 FT /rpt_family="MaLR" FT repeat_region 4477189..4477236 FT /rpt_family="A-rich" FT repeat_region 4477516..4477647 FT /rpt_family="Alu" FT repeat_region 4478322..4478620 FT /rpt_family="L1" FT repeat_region 4478653..4478996 FT /rpt_family="Alu" FT repeat_region 4479178..4479419 FT /rpt_family="MIR" FT repeat_region 4479592..4479838 FT /rpt_family="MIR" FT repeat_region 4480311..4480394 FT /rpt_family="MIR" FT repeat_region 4480699..4480796 FT /rpt_family="MIR" FT repeat_region 4480851..4480981 FT /rpt_family="MIR" FT repeat_region 4481808..4481926 FT /rpt_family="L1" FT repeat_region 4482093..4482231 FT /rpt_family="L2" FT repeat_region 4483777..4484288 FT /rpt_family="L2" FT repeat_region 4484668..4484742 FT /rpt_family="CR1" FT misc_feature 4484710..4485162 FT /note="match to EST AI557326 (NID:g4489689)" FT repeat_region 4485511..4485588 FT /rpt_family="CR1" FT repeat_region 4485589..4485887 FT /rpt_family="Alu" FT repeat_region 4485888..4486185 FT /rpt_family="CR1" FT repeat_region 4486383..4486586 FT /rpt_family="CR1" FT repeat_region 4486832..4487018 FT /rpt_family="MIR" FT misc_feature 4487748..4487975 FT /note="match to EST BF759048 (NID:g12106948)" FT repeat_region 4488200..4488426 FT /rpt_family="MIR" FT repeat_region 4489090..4489282 FT /rpt_family="MIR" FT misc_feature 4489430..4489453 FT /note="match to EST BG428504 (NID:g13335010)" FT misc_feature 4489521..4490239 FT /note="match to EST BG428504 (NID:g13335010)" FT misc_feature 4490163..4490657 FT /note="match to EST BF819577 (NID:g12157520)" FT repeat_region 4491119..4491156 FT /rpt_family="(T)n" FT repeat_region 4491142..4491276 FT /rpt_family="Alu" FT misc_feature 4491156..4491539 FT /note="match to EST AI978931 (NID:g5803961) wr68b01.x1" FT misc_feature 4492336..4492710 FT /note="match to EST BF802432 (NID:g12131421)" FT misc_feature 4492397..4492860 FT /note="similar to Rattus norvegicus EST BF545001 FT (NID:g11636108)" FT repeat_region 4495977..4496076 FT /rpt_family="MIR" FT repeat_region 4496231..4496311 FT /rpt_family="MIR" FT repeat_region 4496709..4496755 FT /rpt_family="MER1_type" FT repeat_region 4496774..4496993 FT /rpt_family="MIR" FT repeat_region 4497080..4497133 FT /rpt_family="(TTTC)n" FT repeat_region 4497106..4497384 FT /rpt_family="Alu" FT repeat_region 4497277..4497309 FT /rpt_family="(T)n" FT misc_feature 4497306..4497726 FT /note="match to EST AI859325 (NID:g5512941) wm10a06.x1" FT misc_feature 4498419..4498595 FT /note="match to EST BF737079 (NID:g12063755)" FT repeat_region 4499218..4499463 FT /rpt_family="MIR" FT repeat_region 4500170..4500253 FT /rpt_family="L2" FT repeat_region 4500566..4500650 FT /rpt_family="CR1" FT misc_feature 4500657..4500661 FT /note="similar to Homo sapiens EST F22641 (NID:g2061817)" FT misc_feature 4501599..4502000 FT /note="match to EST AA969074 (NID:g3144254) op55b09.s1" FT repeat_region 4501863..4501995 FT /rpt_family="L1" FT repeat_region 4501996..4502326 FT /rpt_family="MER2_type" FT repeat_region 4502327..4502480 FT /rpt_family="L1" FT repeat_region 4502481..4502790 FT /rpt_family="Alu" FT repeat_region 4502766..4502794 FT /rpt_family="AT_rich" FT repeat_region 4502791..4502999 FT /rpt_family="L1" FT repeat_region 4503240..4503325 FT /rpt_family="MIR" FT repeat_region 4504400..4504676 FT /rpt_family="MER1_type" FT repeat_region 4504705..4505300 FT /rpt_family="MER1_type" FT repeat_region 4505217..4505239 FT /rpt_family="AT_rich" FT repeat_region 4505301..4505395 FT /rpt_family="L1" FT repeat_region 4505387..4505409 FT /rpt_family="AT_rich" FT repeat_region 4505396..4505769 FT /rpt_family="MER1_type" FT repeat_region 4506107..4506218 FT /rpt_family="L2" FT repeat_region 4506238..4506630 FT /rpt_family="L1" FT repeat_region 4506636..4506884 FT /rpt_family="L1" FT repeat_region 4506890..4507228 FT /rpt_family="MER2_type" FT repeat_region 4507229..4507535 FT /rpt_family="Alu" FT repeat_region 4507344..4507367 FT /rpt_family="AT_rich" FT repeat_region 4507512..4507534 FT /rpt_family="(CAAAAA)n" FT repeat_region 4507536..4507630 FT /rpt_family="MER2_type" FT repeat_region 4507631..4507872 FT /rpt_family="L1" FT repeat_region 4507863..4508338 FT /rpt_family="L1" FT repeat_region 4508359..4508675 FT /rpt_family="MER2_type" FT misc_feature 4508698 FT /note="similar to Homo sapiens EST BE276865 (NID:g9151927)" FT misc_feature 4508717 FT /note="similar to Homo sapiens EST BF974206 FT (NID:g12341421)" FT /note="similar to Homo sapiens EST BG506602 FT (NID:g13468119)" FT misc_feature 4508772..4508869 FT /note="similar to Homo sapiens EST BG506602 FT (NID:g13468119)" FT misc_feature 4508785..4508869 FT /note="similar to Homo sapiens EST AA311228 (NID:g1963628)" FT /note="similar to Homo sapiens EST BF970797 FT (NID:g12338012)" FT /note="similar to Homo sapiens EST AV717175 FT (NID:g10814327)" FT misc_feature 4508787..4508869 FT /note="similar to Homo sapiens EST BF974206 FT (NID:g12341421)" FT misc_feature 4508789..4508855 FT /note="similar to Bos taurus EST AV610237 (NID:g9745907)" FT misc_feature 4508790..4508869 FT /note="similar to Homo sapiens EST AA334458 (NID:g1986702)" FT /note="similar to Homo sapiens EST AL559005 FT (NID:g12904077)" FT misc_feature 4508794..4508869 FT /note="similar to Homo sapiens EST BE618580 (NID:g9889518)" FT misc_feature 4508796..4508869 FT /note="similar to Homo sapiens EST AA206205 (NID:g1801577) FT zq53f03.r1" FT misc_feature 4508798..4508869 FT /note="similar to Homo sapiens EST AA582168 (NID:g2360846) FT nn44f01.s1" FT misc_feature 4508804..4508869 FT /note="similar to Homo sapiens EST BE276865 (NID:g9151927)" FT misc_feature 4508831..4508869 FT /note="similar to Homo sapiens EST AV655528 (NID:g9876542)" FT misc_feature 4508832..4508869 FT /note="similar to Homo sapiens EST AW088278 (NID:g6044083) FT xd15a06.x1" FT /note="similar to Homo sapiens EST AV717011 FT (NID:g10814163)" FT repeat_region 4508892..4508982 FT /rpt_family="MER2_type" FT misc_feature 4508975..4509340 FT /note="similar to Bos taurus EST AV610237 (NID:g9745907)" FT misc_feature 4508986..4509572 FT /note="similar to Homo sapiens EST AA512934 (NID:g2251357) FT nh91b03.s1" FT misc_feature 4508986..4509535 FT /note="similar to Homo sapiens EST BE903944 FT (NID:g10395680)" FT misc_feature 4508986..4509430 FT /note="similar to Homo sapiens EST BF213727 FT (NID:g11107313)" FT misc_feature 4508986..4509524 FT /note="similar to Homo sapiens EST BE394953 (NID:g9340318)" FT misc_feature 4508987..4509542 FT /note="similar to Homo sapiens EST AA582168 (NID:g2360846) FT nn44f01.s1" FT misc_feature 4508987..4509259 FT /note="similar to Homo sapiens EST AL559005 FT (NID:g12904077)" FT misc_feature 4508987..4509508 FT /note="similar to Homo sapiens EST BG506602 FT (NID:g13468119)" FT misc_feature 4508987..4509563 FT /note="similar to Homo sapiens EST AV717011 FT (NID:g10814163)" FT misc_feature 4508987..4509450 FT /note="similar to Homo sapiens EST BE276865 (NID:g9151927)" FT misc_feature 4508987..4509321 FT /note="similar to Homo sapiens EST AA206205 (NID:g1801577) FT zq53f03.r1" FT misc_feature 4508987..4509266 FT /note="similar to Homo sapiens EST AV655528 (NID:g9876542)" FT /note="similar to Homo sapiens EST AV717175 FT (NID:g10814327)" FT misc_feature 4508987..4509559 FT /note="similar to Homo sapiens EST BF974206 FT (NID:g12341421)" FT misc_feature 4508987..4509408 FT /note="similar to Homo sapiens EST BF970797 FT (NID:g12338012)" FT misc_feature 4508987..4509440 FT /note="similar to Homo sapiens EST BE618580 (NID:g9889518)" FT misc_feature 4508987..4509360 FT /note="similar to Homo sapiens EST AA311228 (NID:g1963628)" FT misc_feature 4508987..4509148 FT /note="similar to Homo sapiens EST AA334458 (NID:g1986702)" FT misc_feature 4508987..4509551 FT /note="similar to Bos taurus EST AV593541 (NID:g9709938)" FT misc_feature 4508987..4509257 FT /note="similar to Homo sapiens EST AW088278 (NID:g6044083) FT xd15a06.x1" FT misc_feature 4508987..4509395 FT /note="similar to Homo sapiens EST AA135054 (NID:g1696156) FT zo23h07.r1" FT misc_feature 4509033..4509232 FT /note="similar to Homo sapiens EST AA570790 (NID:g2343381) FT nm37f01.s1" FT misc_feature 4509036..4509372 FT /note="similar to Homo sapiens EST AA306527 (NID:g1958856)" FT misc_feature 4509060..4509541 FT /note="similar to Homo sapiens EST AA149142 (NID:g1719578) FT zo36c09.s1" FT misc_feature 4509066..4509113 FT /note="similar to Homo sapiens EST AI193200 (NID:g3744409) FT qe41g02.s1" FT misc_feature 4509106..4509232 FT /note="similar to Rattus norvegicus EST BG381147 FT (NID:g13305619)" FT misc_feature 4509140..4509548 FT /note="similar to Homo sapiens EST AI193200 (NID:g3744409) FT qe41g02.s1" FT misc_feature 4509191..4509548 FT /note="similar to Homo sapiens EST AA224895 (NID:g1846307) FT nc34e05.s1" FT misc_feature 4509194..4509560 FT /note="similar to Homo sapiens EST AA484723 (NID:g2214108) FT ne81e01.s1" FT misc_feature 4509199..4509574 FT /note="similar to Homo sapiens EST BG223089 FT (NID:g12708610)" FT misc_feature 4509258..4509566 FT /note="similar to Rattus norvegicus EST BG381147 FT (NID:g13305619)" FT misc_feature 4509321..4509377 FT /note="similar to Homo sapiens EST AV655528 (NID:g9876542)" FT misc_feature 4509321..4509524 FT /note="similar to Homo sapiens EST AV717175 FT (NID:g10814327)" FT misc_feature 4509408..4509540 FT /note="similar to Homo sapiens EST F22641 (NID:g2061817)" FT misc_feature 4509412..4509554 FT /note="similar to Homo sapiens EST AW189117 (NID:g6463553) FT xl01c05.x1" FT repeat_region 4509543..4509564 FT /rpt_family="(A)n" FT misc_feature 4509736..4509738 FT /note="similar to Homo sapiens EST F22641 (NID:g2061817)" FT repeat_region 4510270..4511230 FT /rpt_family="L1" FT misc_feature 4511150..4511153 FT /note="similar to Homo sapiens EST AA135054 (NID:g1696156) FT zo23h07.r1" FT repeat_region 4511330..4511371 FT /rpt_family="AT_rich" FT repeat_region 4511384..4511676 FT /rpt_family="L2" FT repeat_region 4511681..4511842 FT /rpt_family="L2" FT repeat_region 4512206..4512916 FT /rpt_family="L1" FT repeat_region 4513441..4513491 FT /rpt_family="(TG)n" FT repeat_region 4513604..4513816 FT /rpt_family="MER1_type" FT repeat_region 4516275..4516450 FT /rpt_family="L2" FT repeat_region 4516890..4516921 FT /rpt_family="AT_rich" FT repeat_region 4518430..4518457 FT /rpt_family="AT_rich" FT misc_feature 4518667..4518869 FT /note="match to EST AA368562 (NID:g2020891)" FT repeat_region 4519495..4519521 FT /rpt_family="(T)n" FT repeat_region 4524369..4524390 FT /rpt_family="AT_rich" FT repeat_region 4524703..4524883 FT /rpt_family="MIR" FT repeat_region 4524964..4525560 FT /rpt_family="L2" FT repeat_region 4525579..4525900 FT /rpt_family="L2" FT repeat_region 4525983..4526544 FT /rpt_family="MaLR" FT repeat_region 4526681..4526705 FT /rpt_family="(GAAAA)n" FT repeat_region 4526882..4527104 FT /rpt_family="CR1" FT repeat_region 4527228..4527325 FT /rpt_family="L2" FT repeat_region 4528416..4528549 FT /rpt_family="Alu" FT repeat_region 4529502..4529608 FT /rpt_family="(TA)n" FT repeat_region 4529650..4529766 FT /rpt_family="ERVL" FT repeat_region 4529884..4529993 FT /rpt_family="ERVL" FT repeat_region 4529994..4530366 FT /rpt_family="MaLR" FT repeat_region 4530403..4530607 FT /rpt_family="ERVL" FT repeat_region 4530809..4531101 FT /rpt_family="Alu" FT repeat_region 4531426..4531570 FT /rpt_family="MIR" FT repeat_region 4531875..4532011 FT /rpt_family="L1" FT repeat_region 4532103..4532133 FT /rpt_family="AT_rich" FT repeat_region 4532378..4532631 FT /rpt_family="Alu" FT repeat_region 4532880..4532903 FT /rpt_family="(CA)n" FT repeat_region 4534171..4534211 FT /rpt_family="(CAAAAA)n" FT repeat_region 4534336..4534450 FT /rpt_family="MIR" FT repeat_region 4536453..4536660 FT /rpt_family="MER1_type" FT repeat_region 4536966..4537007 FT /rpt_family="L2" FT repeat_region 4537904..4537967 FT /rpt_family="MIR" FT repeat_region 4537999..4538456 FT /rpt_family="L2" FT repeat_region 4538632..4538794 FT /rpt_family="MIR" FT repeat_region 4539174..4539313 FT /rpt_family="MaLR" FT repeat_region 4539299..4539408 FT /rpt_family="MaLR" FT repeat_region 4539431..4539570 FT /rpt_family="MIR" FT repeat_region 4539667..4539809 FT /rpt_family="MIR" FT repeat_region 4539898..4540076 FT /rpt_family="MER1_type" FT repeat_region 4540395..4540507 FT /rpt_family="MIR" FT repeat_region 4541379..4541485 FT /rpt_family="CR1" FT repeat_region 4541898..4542013 FT /rpt_family="MIR" FT repeat_region 4542148..4542295 FT /rpt_family="L2" FT repeat_region 4542585..4542743 FT /rpt_family="AcHobo" FT repeat_region 4542751..4542821 FT /rpt_family="L2" FT repeat_region 4542828..4542880 FT /rpt_family="L2" FT repeat_region 4543190..4543260 FT /rpt_family="CR1" FT misc_feature 4543524..4543792 FT /note="match to EST BG700459 (NID:g13969818)" FT misc_feature 4543858..4544352 FT /note="match to EST AV742590 (NID:g10860171)" FT misc_feature 4543903..4543904 FT /note="match to EST BG700459 (NID:g13969818)" FT misc_feature 4543904..4544059 FT /note="match to EST R10565 (NID:g762521) yf31g07.r1" FT repeat_region 4544239..4544382 FT /rpt_family="MIR" FT repeat_region 4544635..4544807 FT /rpt_family="Alu" FT repeat_region 4544926..4545080 FT /rpt_family="MER1_type" FT repeat_region 4545085..4545209 FT /rpt_family="MER1_type" FT repeat_region 4545284..4545552 FT /rpt_family="Alu" FT repeat_region 4546305..4546395 FT /rpt_family="Alu" FT misc_feature 4546465..4546565 FT /note="match to EST AV742590 (NID:g10860171)" FT repeat_region 4546504..4546901 FT /rpt_family="MER2_type" FT repeat_region 4547009..4547155 FT /rpt_family="MaLR" FT repeat_region 4547156..4547603 FT /rpt_family="ERVL" FT repeat_region 4547604..4547683 FT /rpt_family="MaLR" FT repeat_region 4548074..4548136 FT /rpt_family="(T)n" FT repeat_region 4548107..4548428 FT /rpt_family="Alu" FT repeat_region 4548580..4548953 FT /rpt_family="MaLR" FT misc_feature 4548680..4549061 FT /note="match to EST BG950320 (NID:g14368491)" FT repeat_region 4549076..4549511 FT /rpt_family="MaLR" FT repeat_region 4550050..4550347 FT /rpt_family="Alu" FT misc_feature 4550395..4550734 FT /note="match to EST AW503737 (NID:g7141404)" FT repeat_region 4550709..4550747 FT /rpt_family="(TG)n" FT repeat_region 4551516..4551609 FT /rpt_family="MIR" FT repeat_region 4552012..4552365 FT /rpt_family="MaLR" FT repeat_region 4553924..4554271 FT /rpt_family="MaLR" FT repeat_region 4554448..4554955 FT /rpt_family="MaLR" FT repeat_region 4555848..4555997 FT /rpt_family="MIR" FT repeat_region 4556186..4556318 FT /rpt_family="L2" FT misc_feature 4556246..4556645 FT /note="match to EST AI027498 (NID:g3246428) ov98d03.x1" FT repeat_region 4556611..4556664 FT /rpt_family="MIR" FT repeat_region 4556665..4557031 FT /rpt_family="MaLR" FT repeat_region 4557032..4557079 FT /rpt_family="MIR" FT repeat_region 4557370..4557592 FT /rpt_family="CR1" FT misc_feature 4558575 FT /note="match to EST N76541 (NID:g1239119) yv53e05.r1" FT misc_feature 4558631..4558840 FT /note="match to EST N76541 (NID:g1239119) yv53e05.r1" FT repeat_region 4559250..4559452 FT /rpt_family="MIR" FT repeat_region 4559454..4559754 FT /rpt_family="Alu" FT repeat_region 4559768..4560055 FT /rpt_family="Alu" FT repeat_region 4560049..4560076 FT /rpt_family="(CAA)n" FT repeat_region 4561037..4561173 FT /rpt_family="Alu" FT repeat_region 4561438..4561484 FT /rpt_family="MIR" FT repeat_region 4561653..4561737 FT /rpt_family="L2" FT misc_feature 4562116..4562619 FT /note="match to EST BG202645 (NID:g13724332)" FT repeat_region 4562236..4562264 FT /rpt_family="(TTCA)n" FT repeat_region 4562252..4562387 FT /rpt_family="L2" FT repeat_region 4562419..4562444 FT /rpt_family="(CAAAAA)n" FT repeat_region 4562537..4562593 FT /rpt_family="CT-rich" FT repeat_region 4562704..4563118 FT /rpt_family="ERV1" FT repeat_region 4563297..4563610 FT /rpt_family="Alu" FT repeat_region 4563466..4563489 FT /rpt_family="AT_rich" FT repeat_region 4563813..4564153 FT /rpt_family="CR1" FT repeat_region 4564189..4564213 FT /rpt_family="(TG)n" FT repeat_region 4564670..4564707 FT /rpt_family="AT_rich" FT repeat_region 4564676..4565041 FT /rpt_family="L1" FT repeat_region 4565281..4565556 FT /rpt_family="Alu" FT repeat_region 4565555..4565584 FT /rpt_family="(TAA)n" FT repeat_region 4565905..4566021 FT /rpt_family="MIR" FT repeat_region 4566079..4566435 FT /rpt_family="MaLR" FT repeat_region 4566715..4567063 FT /rpt_family="MaLR" FT repeat_region 4567709..4568041 FT /rpt_family="L1" FT repeat_region 4568067..4568139 FT /rpt_family="MIR" FT repeat_region 4568173..4568581 FT /rpt_family="ERVL" FT repeat_region 4568598..4568629 FT /rpt_family="(A)n" FT repeat_region 4568625..4569108 FT /rpt_family="L1" FT repeat_region 4569181..4569310 FT /rpt_family="L2" FT repeat_region 4569304..4569399 FT /rpt_family="L2" FT repeat_region 4569479..4569773 FT /rpt_family="Alu" FT repeat_region 4570408..4570644 FT /rpt_family="MIR" FT repeat_region 4570897..4571007 FT /rpt_family="ERV1" FT misc_feature 4570916..4571270 FT /note="match to EST AI521113 (NID:g4435248) to43b11.x1" FT repeat_region 4571136..4571288 FT /rpt_family="ERV1" FT repeat_region 4571286..4571310 FT /rpt_family="(TG)n" FT repeat_region 4571332..4571432 FT /rpt_family="MIR" FT repeat_region 4571524..4571633 FT /rpt_family="L2" FT repeat_region 4571634..4571989 FT /rpt_family="MaLR" FT repeat_region 4571990..4572349 FT /rpt_family="L2" FT repeat_region 4572543..4572593 FT /rpt_family="MaLR" FT repeat_region 4572688..4573887 FT /rpt_family="L1" FT repeat_region 4573261..4573282 FT /rpt_family="AT_rich" FT repeat_region 4574171..4574505 FT /rpt_family="MaLR" FT repeat_region 4574827..4574881 FT /rpt_family="L2" FT repeat_region 4575070..4575194 FT /rpt_family="L2" FT repeat_region 4575348..4575391 FT /rpt_family="L2" FT repeat_region 4575511..4575850 FT /rpt_family="ERVL" FT repeat_region 4575979..4576348 FT /rpt_family="MaLR" FT misc_feature 4576284..4576635 FT /note="match to EST BE672372 (NID:g10032913)" FT repeat_region 4576600..4576642 FT /rpt_family="(CA)n" FT repeat_region 4576705..4576734 FT /rpt_family="(CA)n" FT repeat_region 4578172..4578222 FT /rpt_family="AT_rich" FT repeat_region 4578195..4578293 FT /rpt_family="MER1_type?" FT repeat_region 4578344..4578451 FT /rpt_family="MIR" FT repeat_region 4579250..4579620 FT /rpt_family="MaLR" FT repeat_region 4579624..4579751 FT /rpt_family="MIR" FT repeat_region 4580040..4580073 FT /rpt_family="MIR" FT repeat_region 4580321..4580465 FT /rpt_family="MIR" FT repeat_region 4580527..4580581 FT /rpt_family="MER1_type" FT repeat_region 4580682..4580722 FT /rpt_family="(CAAAAA)n" FT repeat_region 4581114..4581150 FT /rpt_family="(CA)n" FT repeat_region 4581365..4581491 FT /rpt_family="MIR" FT repeat_region 4581522..4582198 FT /rpt_family="L1" FT repeat_region 4582277..4582506 FT /rpt_family="MIR" FT repeat_region 4582536..4583003 FT /rpt_family="L1" FT repeat_region 4583013..4583120 FT /rpt_family="L1" FT repeat_region 4583121..4583407 FT /rpt_family="Alu" FT repeat_region 4583410..4583443 FT /rpt_family="L1" FT repeat_region 4583444..4583466 FT /rpt_family="(T)n" FT repeat_region 4583748..4584218 FT /rpt_family="L1" FT repeat_region 4583937..4583986 FT /rpt_family="AT_rich" FT repeat_region 4584317..4584658 FT /rpt_family="MER1_type" FT repeat_region 4584737..4585036 FT /rpt_family="L1" FT repeat_region 4585049..4585227 FT /rpt_family="ERVL" FT repeat_region 4585229..4585342 FT /rpt_family="Alu" FT repeat_region 4585346..4585424 FT /rpt_family="ERVL" FT repeat_region 4585421..4585540 FT /rpt_family="MaLR" FT repeat_region 4585624..4585992 FT /rpt_family="L1" FT repeat_region 4586518..4586656 FT /rpt_family="MaLR" FT repeat_region 4586663..4586849 FT /rpt_family="MaLR" FT repeat_region 4586850..4587131 FT /rpt_family="Alu" FT repeat_region 4587132..4587696 FT /rpt_family="MaLR" FT repeat_region 4587689..4587866 FT /rpt_family="MaLR" FT repeat_region 4588034..4588443 FT /rpt_family="MaLR" FT repeat_region 4588444..4588599 FT /rpt_family="MaLR" FT repeat_region 4588600..4590069 FT /rpt_family="L1" FT repeat_region 4590058..4590089 FT /rpt_family="(A)n" FT repeat_region 4590070..4590287 FT /rpt_family="MaLR" FT repeat_region 4591095..4591127 FT /rpt_family="CT-rich" FT repeat_region 4591103..4591410 FT /rpt_family="Alu" FT repeat_region 4591420..4591444 FT /rpt_family="(T)n" FT repeat_region 4591727..4591900 FT /rpt_family="MaLR" FT misc_feature 4591921 FT /note="match to EST T66338 (NID:g675383) yc78b03.r1" FT misc_feature 4591940..4592388 FT /note="match to EST T66338 (NID:g675383) yc78b03.r1" FT repeat_region 4592029..4592060 FT /rpt_family="L2" FT repeat_region 4592135..4592244 FT /rpt_family="MIR" FT repeat_region 4593079..4593155 FT /rpt_family="MIR" FT repeat_region 4593239..4593306 FT /rpt_family="MIR" FT repeat_region 4593307..4593897 FT /rpt_family="ERV1" FT repeat_region 4593646..4593689 FT /rpt_family="(TTTTTG)n" FT repeat_region 4593898..4594007 FT /rpt_family="MIR" FT repeat_region 4594079..4594192 FT /rpt_family="ERVL" FT repeat_region 4594331..4594806 FT /rpt_family="MaLR" FT repeat_region 4594852..4595021 FT /rpt_family="MER1_type" FT repeat_region 4596983..4597509 FT /rpt_family="MaLR" FT repeat_region 4598483..4598601 FT /rpt_family="L2" FT repeat_region 4598632..4598729 FT /rpt_family="L1" FT repeat_region 4598730..4599025 FT /rpt_family="Alu" FT repeat_region 4598733..4598757 FT /rpt_family="AT_rich" FT repeat_region 4599026..4599500 FT /rpt_family="L1" FT repeat_region 4599052..4599071 FT /rpt_family="(A)n" FT repeat_region 4599536..4599836 FT /rpt_family="Alu" FT repeat_region 4599873..4599972 FT /rpt_family="L1" FT repeat_region 4600092..4600224 FT /rpt_family="MIR" FT misc_feature 4600655..4601351 FT /note="match to EST AU121444 (NID:g10936679)" FT repeat_region 4600878..4601042 FT /rpt_family="MER1_type" FT repeat_region 4601200..4602089 FT /rpt_family="L1" FT repeat_region 4602156..4602474 FT /rpt_family="Alu" FT repeat_region 4602447..4602528 FT /rpt_family="(GAAA)n" FT repeat_region 4602578..4602746 FT /rpt_family="MIR" FT repeat_region 4602892..4603028 FT /rpt_family="MIR" FT repeat_region 4603036..4603222 FT /rpt_family="ERVL" FT repeat_region 4603272..4603354 FT /rpt_family="AcHobo" FT repeat_region 4604184..4604222 FT /rpt_family="AT_rich" FT repeat_region 4604289..4604642 FT /rpt_family="ERVL" FT repeat_region 4604859..4605229 FT /rpt_family="MaLR" FT repeat_region 4605230..4605539 FT /rpt_family="MaLR" FT repeat_region 4606126..4606865 FT /rpt_family="ERV1" FT repeat_region 4607115..4607137 FT /rpt_family="AT_rich" FT repeat_region 4607116..4607385 FT /rpt_family="Alu" FT repeat_region 4608056..4608342 FT /rpt_family="MaLR" FT repeat_region 4608343..4608371 FT /rpt_family="(T)n" FT repeat_region 4608656..4608809 FT /rpt_family="MaLR" FT repeat_region 4608858..4608924 FT /rpt_family="MIR" FT repeat_region 4609399..4609467 FT /rpt_family="L2" FT repeat_region 4609540..4609752 FT /rpt_family="MIR" FT repeat_region 4610317..4610491 FT /rpt_family="L1" FT repeat_region 4610473..4610514 FT /rpt_family="AT_rich" FT repeat_region 4610626..4610682 FT /rpt_family="(TAA)n" FT repeat_region 4610688..4610959 FT /rpt_family="Alu" FT repeat_region 4610970..4611118 FT /rpt_family="MIR" FT repeat_region 4611265..4611608 FT /rpt_family="MaLR" FT repeat_region 4611839..4612047 FT /rpt_family="MIR" FT repeat_region 4612826..4612850 FT /rpt_family="(T)n" FT repeat_region 4613257..4613317 FT /rpt_family="L2" FT repeat_region 4613760..4613887 FT /rpt_family="MIR" FT repeat_region 4614358..4614419 FT /rpt_family="MIR" FT repeat_region 4614491..4614791 FT /rpt_family="Alu" FT repeat_region 4614769..4614791 FT /rpt_family="(A)n" FT repeat_region 4614916..4615233 FT /rpt_family="L1" FT repeat_region 4615797..4615873 FT /rpt_family="L2" FT repeat_region 4616157..4616189 FT /rpt_family="(TTTTG)n" FT repeat_region 4616166..4616472 FT /rpt_family="Alu" FT repeat_region 4616501..4616614 FT /rpt_family="MIR" FT repeat_region 4616811..4616919 FT /rpt_family="MIR" FT repeat_region 4616986..4617053 FT /rpt_family="MIR" FT repeat_region 4617403..4617517 FT /rpt_family="MIR" FT repeat_region 4617848..4618149 FT /rpt_family="Alu" FT repeat_region 4618128..4618152 FT /rpt_family="AT_rich" FT repeat_region 4618226..4618532 FT /rpt_family="Alu" FT repeat_region 4618535..4618704 FT /rpt_family="Alu" FT repeat_region 4619785..4619907 FT /rpt_family="MIR" FT repeat_region 4619939..4620083 FT /rpt_family="MIR" FT repeat_region 4620130..4620506 FT /rpt_family="MaLR" FT repeat_region 4620507..4621053 FT /rpt_family="MaLR" FT repeat_region 4621054..4621120 FT /rpt_family="MaLR" FT repeat_region 4621330..4621363 FT /rpt_family="(TTTTTA)n" FT repeat_region 4621340..4621647 FT /rpt_family="Alu" FT repeat_region 4622013..4622081 FT /rpt_family="ERV1" FT repeat_region 4622016..4622069 FT /rpt_family="(TG)n" FT repeat_region 4622314..4622486 FT /rpt_family="MIR" FT repeat_region 4622487..4622719 FT /rpt_family="MIR" FT repeat_region 4622728..4623031 FT /rpt_family="MaLR" FT repeat_region 4623035..4623300 FT /rpt_family="Alu" FT repeat_region 4623661..4623788 FT /rpt_family="MaLR" FT repeat_region 4623905..4624423 FT /rpt_family="MaLR" FT repeat_region 4624426..4624500 FT /rpt_family="MaLR" FT repeat_region 4624678..4624792 FT /rpt_family="MER1_type" FT repeat_region 4624797..4624940 FT /rpt_family="Alu" FT repeat_region 4624943..4625290 FT /rpt_family="MaLR" FT repeat_region 4625336..4625627 FT /rpt_family="Alu" FT repeat_region 4625911..4625936 FT /rpt_family="(TC)n" FT repeat_region 4625954..4626271 FT /rpt_family="MER1_type" FT repeat_region 4626272..4626619 FT /rpt_family="MaLR" FT repeat_region 4626620..4626831 FT /rpt_family="MER1_type" FT repeat_region 4626833..4626950 FT /rpt_family="L2" FT misc_feature 4627138..4627490 FT /note="match to EST BF823733 (NID:g12164784)" FT repeat_region 4627327..4627726 FT /rpt_family="MaLR" FT repeat_region 4627839..4627978 FT /rpt_family="Alu" FT repeat_region 4627979..4628275 FT /rpt_family="Alu" FT repeat_region 4628276..4628408 FT /rpt_family="Alu" FT repeat_region 4628421..4628492 FT /rpt_family="AcHobo" FT repeat_region 4628498..4628686 FT /rpt_family="MIR" FT misc_feature 4628703..4629082 FT /note="match to EST AI961532 (NID:g5754245) wt33a10.x1" FT repeat_region 4629689..4629767 FT /rpt_family="L2" FT repeat_region 4630008..4630081 FT /rpt_family="L2" FT repeat_region 4630166..4630681 FT /rpt_family="L1" FT repeat_region 4630682..4631092 FT /rpt_family="MaLR" FT repeat_region 4631093..4631449 FT /rpt_family="L1" FT repeat_region 4631450..4631743 FT /rpt_family="Alu" FT repeat_region 4631744..4632177 FT /rpt_family="L1" FT repeat_region 4631755..4631776 FT /rpt_family="AT_rich" FT repeat_region 4632178..4632726 FT /rpt_family="L1" FT repeat_region 4632727..4632912 FT /rpt_family="L1" FT repeat_region 4632913..4633150 FT /rpt_family="L1" FT repeat_region 4633151..4633537 FT /rpt_family="L1" FT repeat_region 4633604..4633918 FT /rpt_family="MaLR" FT repeat_region 4634294..4634840 FT /rpt_family="ERVL" FT repeat_region 4634850..4634914 FT /rpt_family="MIR" FT repeat_region 4635009..4635167 FT /rpt_family="L2" FT repeat_region 4635271..4635413 FT /rpt_family="MIR" FT repeat_region 4635542..4635841 FT /rpt_family="Alu" FT repeat_region 4635823..4635843 FT /rpt_family="AT_rich" FT repeat_region 4636136..4636434 FT /rpt_family="Alu" FT repeat_region 4636829..4636876 FT /rpt_family="CT-rich" FT repeat_region 4636882..4636901 FT /rpt_family="(TTA)n" FT repeat_region 4636900..4637188 FT /rpt_family="Alu" FT repeat_region 4637578..4637616 FT /rpt_family="(T)n" FT repeat_region 4637587..4637864 FT /rpt_family="Alu" FT repeat_region 4637964..4638399 FT /rpt_family="L2" FT repeat_region 4638526..4638667 FT /rpt_family="MIR" FT repeat_region 4638698..4639009 FT /rpt_family="Alu" FT repeat_region 4638980..4639029 FT /rpt_family="(A)n" FT repeat_region 4639242..4639306 FT /rpt_family="MIR" FT repeat_region 4639471..4639529 FT /rpt_family="L2" FT repeat_region 4639661..4640069 FT /rpt_family="MaLR" FT repeat_region 4640509..4640704 FT /rpt_family="Alu" FT repeat_region 4640709..4640752 FT /rpt_family="Alu" FT misc_feature 4640739..4640752 FT /note="match to EST AI027498 (NID:g3246428) ov98d03.x1" FT repeat_region 4640757..4641051 FT /rpt_family="L1" FT repeat_region 4641052..4641414 FT /rpt_family="MaLR" FT repeat_region 4641415..4641925 FT /rpt_family="L1" FT repeat_region 4641937..4642057 FT /rpt_family="Alu" FT repeat_region 4642059..4642352 FT /rpt_family="Alu" FT repeat_region 4642351..4642378 FT /rpt_family="(TAA)n" FT repeat_region 4644710..4644736 FT /rpt_family="AT_rich" FT repeat_region 4644809..4644979 FT /rpt_family="MIR" FT repeat_region 4645020..4645118 FT /rpt_family="MIR" FT repeat_region 4645191..4645325 FT /rpt_family="MIR" FT repeat_region 4645374..4645404 FT /rpt_family="(T)n" FT repeat_region 4645420..4645943 FT /rpt_family="ERV1" FT repeat_region 4645949..4646217 FT /rpt_family="Alu" FT repeat_region 4646270..4646551 FT /rpt_family="L1" FT repeat_region 4646560..4646852 FT /rpt_family="Alu" FT repeat_region 4646846..4646878 FT /rpt_family="(TAAA)n" FT repeat_region 4647008..4647079 FT /rpt_family="MIR" FT repeat_region 4647080..4647394 FT /rpt_family="Alu" FT repeat_region 4647246..4647276 FT /rpt_family="(T)n" FT repeat_region 4647395..4647534 FT /rpt_family="MIR" FT repeat_region 4647607..4647658 FT /rpt_family="MIR" FT repeat_region 4648582..4649120 FT /rpt_family="MaLR" FT repeat_region 4648763..4649120 FT /rpt_family="MaLR" FT repeat_region 4649148..4649210 FT /rpt_family="MIR" FT repeat_region 4649271..4649589 FT /rpt_family="Alu" FT repeat_region 4649599..4649819 FT /rpt_family="Alu" FT repeat_region 4649829..4649855 FT /rpt_family="(TTTG)n" FT repeat_region 4649862..4650117 FT /rpt_family="Alu" FT repeat_region 4650364..4650501 FT /rpt_family="Alu" FT repeat_region 4650687..4650828 FT /rpt_family="MIR" FT repeat_region 4650915..4651351 FT /rpt_family="MaLR" FT repeat_region 4652068..4652114 FT /rpt_family="(TAA)n" FT repeat_region 4652163..4652258 FT /rpt_family="MIR" FT repeat_region 4652462..4652600 FT /rpt_family="MIR" FT repeat_region 4652734..4652921 FT /rpt_family="Alu" FT repeat_region 4653120..4653204 FT /rpt_family="ERV1" FT repeat_region 4653205..4653496 FT /rpt_family="Alu" FT repeat_region 4653497..4654011 FT /rpt_family="ERV1" FT repeat_region 4654784..4655153 FT /rpt_family="MaLR" FT repeat_region 4655154..4655448 FT /rpt_family="Alu" FT repeat_region 4655449..4655561 FT /rpt_family="MaLR" FT repeat_region 4655639..4655969 FT /rpt_family="L1" FT repeat_region 4655970..4656280 FT /rpt_family="Alu" FT repeat_region 4656281..4656372 FT /rpt_family="L1" FT repeat_region 4656373..4656653 FT /rpt_family="Alu" FT repeat_region 4656654..4656759 FT /rpt_family="L1" FT repeat_region 4657285..4657305 FT /rpt_family="AT_rich" FT repeat_region 4657405..4657698 FT /rpt_family="Alu" FT repeat_region 4657820..4657954 FT /rpt_family="MaLR" FT repeat_region 4657955..4658346 FT /rpt_family="MaLR" FT repeat_region 4658347..4658601 FT /rpt_family="MaLR" FT repeat_region 4658772..4658871 FT /rpt_family="MIR" FT repeat_region 4658879..4658941 FT /rpt_family="MIR" FT repeat_region 4658931..4659020 FT /rpt_family="MIR" FT repeat_region 4659563..4659655 FT /rpt_family="MIR" FT repeat_region 4659808..4660145 FT /rpt_family="MaLR" FT repeat_region 4660171..4660229 FT /rpt_family="MIR" FT repeat_region 4660594..4660695 FT /rpt_family="MaLR" FT repeat_region 4660696..4660992 FT /rpt_family="Alu" FT repeat_region 4660993..4661422 FT /rpt_family="MaLR" FT repeat_region 4662257..4662371 FT /rpt_family="L1" FT repeat_region 4662382..4662557 FT /rpt_family="Alu" FT repeat_region 4662558..4662857 FT /rpt_family="Alu" FT repeat_region 4662858..4662992 FT /rpt_family="Alu" FT repeat_region 4663029..4663092 FT /rpt_family="L1" FT repeat_region 4663093..4663403 FT /rpt_family="Alu" FT repeat_region 4663404..4663695 FT /rpt_family="L1" FT repeat_region 4663915..4664291 FT /rpt_family="MaLR" FT repeat_region 4664387..4664479 FT /rpt_family="L2" FT repeat_region 4664519..4664621 FT /rpt_family="L2" FT repeat_region 4665100..4665350 FT /rpt_family="Alu" FT repeat_region 4665629..4666087 FT /rpt_family="L2" FT repeat_region 4666294..4666721 FT /rpt_family="ERV1" FT repeat_region 4666785..4667221 FT /rpt_family="MaLR" FT repeat_region 4669554..4669631 FT /rpt_family="MER1_type" FT repeat_region 4669637..4669818 FT /rpt_family="MER1_type" FT repeat_region 4669970..4670094 FT /rpt_family="L2" FT repeat_region 4670256..4670393 FT /rpt_family="MIR" FT repeat_region 4670579..4670678 FT /rpt_family="MIR" FT repeat_region 4671226..4671491 FT /rpt_family="L2" FT repeat_region 4671509..4671604 FT /rpt_family="ERV1" FT repeat_region 4671605..4671907 FT /rpt_family="Alu" FT repeat_region 4671908..4672453 FT /rpt_family="ERV1" FT repeat_region 4672622..4672766 FT /rpt_family="MIR" FT repeat_region 4672776..4672896 FT /rpt_family="Alu" FT repeat_region 4673930..4673960 FT /rpt_family="(TG)n" FT repeat_region 4674119..4674184 FT /rpt_family="L2" FT repeat_region 4674360..4674506 FT /rpt_family="L2" FT repeat_region 4675539..4675834 FT /rpt_family="Alu" FT repeat_region 4675835..4676036 FT /rpt_family="L1" FT repeat_region 4676045..4676064 FT /rpt_family="Alu" FT repeat_region 4676065..4676465 FT /rpt_family="L1" FT repeat_region 4676466..4676523 FT /rpt_family="Alu" FT repeat_region 4676525..4676728 FT /rpt_family="L1" FT repeat_region 4676860..4676978 FT /rpt_family="(CCCA)n" FT repeat_region 4677032..4677206 FT /rpt_family="(TCCA)n" FT repeat_region 4679262..4679286 FT /rpt_family="(A)n" FT repeat_region 4680750..4681023 FT /rpt_family="Alu" FT repeat_region 4681024..4681068 FT /rpt_family="(CA)n" FT repeat_region 4681238..4681355 FT /rpt_family="L2" FT repeat_region 4681429..4681801 FT /rpt_family="Alu" FT repeat_region 4681808..4682177 FT /rpt_family="MaLR" FT repeat_region 4682403..4682496 FT /rpt_family="MIR" FT repeat_region 4682501..4682700 FT /rpt_family="MIR" FT repeat_region 4682844..4682989 FT /rpt_family="MaLR" FT repeat_region 4683171..4683242 FT /rpt_family="MIR" FT repeat_region 4683327..4683411 FT /rpt_family="(TA)n" FT repeat_region 4683734..4683906 FT /rpt_family="Alu" FT repeat_region 4683977..4684051 FT /rpt_family="MIR" FT repeat_region 4684060..4684074 FT /rpt_family="MIR" FT repeat_region 4684075..4684461 FT /rpt_family="MaLR" FT repeat_region 4684462..4684582 FT /rpt_family="MIR" FT repeat_region 4685007..4685140 FT /rpt_family="Alu" FT repeat_region 4685539..4685632 FT /rpt_family="MIR" FT repeat_region 4685938..4686040 FT /rpt_family="L2" FT repeat_region 4686086..4686386 FT /rpt_family="Alu" FT repeat_region 4686800..4687094 FT /rpt_family="Alu" FT repeat_region 4687553..4687651 FT /rpt_family="L2" FT repeat_region 4688154..4688354 FT /rpt_family="MIR" FT repeat_region 4688355..4688634 FT /rpt_family="MaLR" FT repeat_region 4688655..4688757 FT /rpt_family="MIR" FT repeat_region 4688944..4689239 FT /rpt_family="L2" FT repeat_region 4689339..4689718 FT /rpt_family="L1" FT repeat_region 4690356..4690643 FT /rpt_family="L2" FT repeat_region 4690877..4691190 FT /rpt_family="Alu" FT repeat_region 4691418..4691974 FT /rpt_family="MaLR" FT repeat_region 4692144..4692440 FT /rpt_family="Alu" FT repeat_region 4692776..4692888 FT /rpt_family="L2" FT repeat_region 4692938..4693064 FT /rpt_family="AcHobo" FT repeat_region 4693084..4693397 FT /rpt_family="Alu" FT repeat_region 4693425..4693465 FT /rpt_family="AcHobo" FT repeat_region 4693927..4694420 FT /rpt_family="ERVL" FT repeat_region 4694421..4694738 FT /rpt_family="Alu" FT repeat_region 4694815..4695114 FT /rpt_family="Alu" FT repeat_region 4695250..4695623 FT /rpt_family="ERVL" FT repeat_region 4695894..4696031 FT /rpt_family="MIR" FT repeat_region 4696758..4696849 FT /rpt_family="MIR" FT repeat_region 4697134..4697259 FT /rpt_family="MIR" FT repeat_region 4697260..4697581 FT /rpt_family="(TCCA)n" FT repeat_region 4697797..4697946 FT /rpt_family="MIR" FT repeat_region 4697985..4698160 FT /rpt_family="MIR" FT repeat_region 4698938..4699024 FT /rpt_family="MIR" FT repeat_region 4699356..4699572 FT /rpt_family="(TCTA)n" FT repeat_region 4699593..4699856 FT /rpt_family="Alu" FT repeat_region 4700790..4700972 FT /rpt_family="MIR" FT repeat_region 4701244..4701379 FT /rpt_family="MIR" FT repeat_region 4701498..4701644 FT /rpt_family="L2" FT repeat_region 4701663..4701993 FT /rpt_family="L2" FT repeat_region 4702044..4702194 FT /rpt_family="L1" FT repeat_region 4702350..4702704 FT /rpt_family="L1" FT repeat_region 4702705..4702731 FT /rpt_family="(TG)n" FT repeat_region 4702742..4702776 FT /rpt_family="(CA)n" FT repeat_region 4702777..4703016 FT /rpt_family="L1" FT repeat_region 4703029..4703316 FT /rpt_family="Alu" FT repeat_region 4703373..4703753 FT /rpt_family="L1" FT repeat_region 4703806..4703968 FT /rpt_family="MER1_type" FT repeat_region 4703994..4704074 FT /rpt_family="L2" FT repeat_region 4704110..4704175 FT /rpt_family="MER1_type" FT repeat_region 4704264..4704542 FT /rpt_family="Alu" FT repeat_region 4704543..4704667 FT /rpt_family="(GGAA)n" FT repeat_region 4705141..4705498 FT /rpt_family="MaLR" FT repeat_region 4706333..4706484 FT /rpt_family="MaLR" FT repeat_region 4706485..4706616 FT /rpt_family="Alu" FT repeat_region 4706617..4706646 FT /rpt_family="MaLR" FT repeat_region 4706647..4706772 FT /rpt_family="Alu" FT repeat_region 4706773..4707040 FT /rpt_family="MaLR" FT repeat_region 4707160..4707594 FT /rpt_family="MaLR" FT repeat_region 4707727..4707801 FT /rpt_family="L1" FT repeat_region 4707810..4707925 FT /rpt_family="ERVL" FT repeat_region 4708121..4708493 FT /rpt_family="ERVL" FT repeat_region 4709018..4709145 FT /rpt_family="L1" FT repeat_region 4709499..4709598 FT /rpt_family="MER1_type" FT repeat_region 4710426..4710875 FT /rpt_family="L1" FT repeat_region 4710901..4711056 FT /rpt_family="L2" FT repeat_region 4711281..4711383 FT /rpt_family="MIR" FT repeat_region 4712192..4712299 FT /rpt_family="MIR" FT repeat_region 4712813..4713064 FT /rpt_family="MIR" FT repeat_region 4713450..4713639 FT /rpt_family="L1" FT repeat_region 4713649..4713861 FT /rpt_family="ERVL" FT repeat_region 4714161..4714482 FT /rpt_family="ERVL" FT repeat_region 4714520..4714568 FT /rpt_family="ERVL" FT repeat_region 4714596..4714729 FT /rpt_family="ERVL" FT repeat_region 4714786..4715145 FT /rpt_family="MaLR" FT repeat_region 4715159..4715323 FT /rpt_family="L1" FT repeat_region 4715333..4715447 FT /rpt_family="Alu" FT repeat_region 4715830..4715853 FT /rpt_family="AT_rich" FT repeat_region 4715873..4716159 FT /rpt_family="Alu" FT repeat_region 4716174..4716360 FT /rpt_family="MIR" FT repeat_region 4716602..4716874 FT /rpt_family="MaLR" FT repeat_region 4717097..4717233 FT /rpt_family="MIR" FT repeat_region 4717457..4717519 FT /rpt_family="MaLR" FT repeat_region 4717631..4718005 FT /rpt_family="MER1_type" FT repeat_region 4718006..4718296 FT /rpt_family="Alu" FT repeat_region 4718297..4718397 FT /rpt_family="MER1_type" FT repeat_region 4718574..4718692 FT /rpt_family="ERVL" FT repeat_region 4718917..4719055 FT /rpt_family="L2" FT repeat_region 4719246..4719338 FT /rpt_family="L2" FT repeat_region 4719874..4720237 FT /rpt_family="ERVL" FT repeat_region 4720557..4720621 FT /rpt_family="MIR" FT repeat_region 4720667..4720752 FT /rpt_family="MIR" FT repeat_region 4720764..4720920 FT /rpt_family="L2" FT repeat_region 4720926..4721059 FT /rpt_family="MaLR" FT repeat_region 4721060..4721464 FT /rpt_family="MaLR" FT repeat_region 4721465..4721543 FT /rpt_family="MaLR" FT repeat_region 4721538..4721712 FT /rpt_family="MaLR" FT repeat_region 4721836..4721997 FT /rpt_family="AcHobo" FT repeat_region 4722214..4722265 FT /rpt_family="MIR" FT repeat_region 4722342..4722463 FT /rpt_family="MIR" FT repeat_region 4723216..4723238 FT /rpt_family="(TTTG)n" FT repeat_region 4723242..4723633 FT /rpt_family="L1" FT repeat_region 4724043..4724082 FT /rpt_family="CT-rich" FT repeat_region 4724453..4724656 FT /rpt_family="L2" FT repeat_region 4724931..4725263 FT /rpt_family="MER1_type" FT repeat_region 4725967..4726082 FT /rpt_family="MIR" FT repeat_region 4726206..4726310 FT /rpt_family="MIR" FT repeat_region 4726795..4726866 FT /rpt_family="MIR" FT repeat_region 4727284..4727314 FT /rpt_family="ERVL" FT repeat_region 4727315..4727352 FT /rpt_family="(TG)n" FT repeat_region 4727353..4727742 FT /rpt_family="ERVL" FT repeat_region 4728578..4728643 FT /rpt_family="MIR" FT repeat_region 4728644..4729054 FT /rpt_family="MaLR" FT repeat_region 4729055..4729116 FT /rpt_family="MIR" FT repeat_region 4729117..4729174 FT /rpt_family="MaLR" FT repeat_region 4729183..4729276 FT /rpt_family="MIR" FT repeat_region 4729803..4729831 FT /rpt_family="AT_rich" FT repeat_region 4729914..4730023 FT /rpt_family="MIR" FT repeat_region 4730375..4730570 FT /rpt_family="MIR" FT repeat_region 4731515..4731662 FT /rpt_family="L2" FT repeat_region 4731689..4731792 FT /rpt_family="L2" FT repeat_region 4732684..4732715 FT /rpt_family="AT_rich" FT repeat_region 4732780..4733350 FT /rpt_family="ERV1" FT repeat_region 4733374..4733741 FT /rpt_family="L1" FT repeat_region 4733742..4734161 FT /rpt_family="MaLR" FT repeat_region 4734162..4734450 FT /rpt_family="L1" FT repeat_region 4734955..4735304 FT /rpt_family="L2" FT repeat_region 4735409..4735801 FT /rpt_family="ERVL" FT repeat_region 4735853..4736069 FT /rpt_family="MIR" FT repeat_region 4737478..4737584 FT /rpt_family="MIR" FT repeat_region 4738305..4738408 FT /rpt_family="MIR" FT repeat_region 4738481..4738720 FT /rpt_family="L2" FT repeat_region 4738767..4739605 FT /rpt_family="AcHobo" FT repeat_region 4739676..4739721 FT /rpt_family="MIR" FT repeat_region 4739737..4739923 FT /rpt_family="MIR" FT repeat_region 4739927..4740027 FT /rpt_family="MIR" FT repeat_region 4740082..4740103 FT /rpt_family="AT_rich" FT repeat_region 4740104..4740399 FT /rpt_family="Alu" FT repeat_region 4740615..4740693 FT /rpt_family="MaLR" FT repeat_region 4740712..4741673 FT /rpt_family="L1" FT repeat_region 4741674..4742102 FT /rpt_family="MaLR" FT repeat_region 4742103..4742399 FT /rpt_family="L1" FT repeat_region 4742457..4742499 FT /rpt_family="MIR" FT repeat_region 4742559..4742655 FT /rpt_family="L2" FT repeat_region 4742772..4743121 FT /rpt_family="ERVL" FT repeat_region 4744288..4744401 FT /rpt_family="MaLR" FT repeat_region 4744402..4744684 FT /rpt_family="L2" FT repeat_region 4744809..4745030 FT /rpt_family="MER1_type" FT repeat_region 4745130..4745190 FT /rpt_family="MER1_type" FT repeat_region 4745935..4746008 FT /rpt_family="MIR" FT repeat_region 4746093..4746318 FT /rpt_family="MIR" FT repeat_region 4746403..4746790 FT /rpt_family="MaLR" FT repeat_region 4746972..4747120 FT /rpt_family="MIR" FT repeat_region 4747182..4747234 FT /rpt_family="L2" FT repeat_region 4748278..4748731 FT /rpt_family="MaLR" FT repeat_region 4748848..4749236 FT /rpt_family="MaLR" FT repeat_region 4750292..4750587 FT /rpt_family="Alu" FT repeat_region 4751465..4751548 FT /rpt_family="MER2_type" FT repeat_region 4751544..4751977 FT /rpt_family="MER2_type" FT repeat_region 4752397..4752541 FT /rpt_family="MIR" FT repeat_region 4752766..4752840 FT /rpt_family="MIR" FT repeat_region 4752843..4753448 FT /rpt_family="ERVL" FT repeat_region 4753580..4753862 FT /rpt_family="L1" FT repeat_region 4755375..4755601 FT /rpt_family="MER1_type" FT repeat_region 4755776..4755913 FT /rpt_family="MIR" FT repeat_region 4756142..4756291 FT /rpt_family="MIR" FT repeat_region 4756940..4757067 FT /rpt_family="MIR" FT repeat_region 4757967..4758097 FT /rpt_family="MIR" FT repeat_region 4759786..4759896 FT /rpt_family="MIR" FT repeat_region 4762898..4762947 FT /rpt_family="A-rich" FT repeat_region 4763656..4763798 FT /rpt_family="MIR" FT repeat_region 4764376..4764488 FT /rpt_family="MER1_type" FT repeat_region 4764724..4764765 FT /rpt_family="L2" FT repeat_region 4764820..4764871 FT /rpt_family="MIR" FT repeat_region 4766238..4766628 FT /rpt_family="L1" FT repeat_region 4766635..4766939 FT /rpt_family="Alu" FT repeat_region 4767935..4768166 FT /rpt_family="L2" FT repeat_region 4768614..4768684 FT /rpt_family="MIR" FT repeat_region 4768777..4769504 FT /rpt_family="L1" FT repeat_region 4769511..4769788 FT /rpt_family="Alu" FT repeat_region 4769900..4770109 FT /rpt_family="MIR" FT repeat_region 4771006..4771084 FT /rpt_family="MIR" FT repeat_region 4771451..4771504 FT /rpt_family="MIR" FT repeat_region 4771622..4771793 FT /rpt_family="MIR" FT repeat_region 4771836..4771978 FT /rpt_family="(CAT)n" FT repeat_region 4772032..4772209 FT /rpt_family="(CAT)n" FT repeat_region 4772239..4772579 FT /rpt_family="(CAT)n" FT repeat_region 4772592..4772747 FT /rpt_family="(CAT)n" FT repeat_region 4773166..4773581 FT /rpt_family="MaLR" FT repeat_region 4773607..4773831 FT /rpt_family="MIR" FT repeat_region 4773954..4774067 FT /rpt_family="MER1_type" FT repeat_region 4774068..4774205 FT /rpt_family="(CTATG)n" FT repeat_region 4774206..4774735 FT /rpt_family="MER1_type" FT repeat_region 4774736..4775025 FT /rpt_family="Alu" FT repeat_region 4775026..4775754 FT /rpt_family="MER1_type" FT repeat_region 4775755..4776059 FT /rpt_family="Alu" FT repeat_region 4776060..4776100 FT /rpt_family="MER1_type" FT repeat_region 4776107..4776180 FT /rpt_family="MIR" FT repeat_region 4776226..4776543 FT /rpt_family="ERVL" FT repeat_region 4777062..4777137 FT /rpt_family="MIR" FT repeat_region 4777837..4777971 FT /rpt_family="CR1" FT repeat_region 4778268..4778304 FT /rpt_family="L2" FT repeat_region 4778403..4778567 FT /rpt_family="MIR" FT repeat_region 4779040..4779199 FT /rpt_family="MIR" FT repeat_region 4779444..4779789 FT /rpt_family="CR1" FT repeat_region 4779817..4780210 FT /rpt_family="MaLR" FT repeat_region 4780249..4780352 FT /rpt_family="L2" FT repeat_region 4780473..4780534 FT /rpt_family="MIR" FT repeat_region 4780998..4781089 FT /rpt_family="MIR" FT repeat_region 4781311..4781444 FT /rpt_family="MIR" FT repeat_region 4782036..4782162 FT /rpt_family="L2" FT repeat_region 4782176..4782293 FT /rpt_family="MIR" FT repeat_region 4782703..4782841 FT /rpt_family="MIR" FT repeat_region 4782891..4783001 FT /rpt_family="L2" FT repeat_region 4783004..4783043 FT /rpt_family="L2" FT repeat_region 4783139..4783213 FT /rpt_family="MIR" FT repeat_region 4783294..4783709 FT /rpt_family="MaLR" FT repeat_region 4783908..4784045 FT /rpt_family="MIR" FT repeat_region 4784371..4784657 FT /rpt_family="L1" FT repeat_region 4784701..4785363 FT /rpt_family="MER2_type" FT repeat_region 4785386..4785435 FT /rpt_family="(CATATA)n" FT repeat_region 4785456..4785583 FT /rpt_family="L1" FT repeat_region 4785589..4785615 FT /rpt_family="AT_rich" FT repeat_region 4786043..4786085 FT /rpt_family="(CA)n" FT repeat_region 4786847..4786920 FT /rpt_family="L2" FT repeat_region 4787210..4787299 FT /rpt_family="MIR" FT repeat_region 4787653..4787823 FT /rpt_family="MER1_type" FT repeat_region 4787856..4787970 FT /rpt_family="MIR" FT repeat_region 4788209..4788260 FT /rpt_family="MIR" FT repeat_region 4788564..4788926 FT /rpt_family="MaLR" FT repeat_region 4789191..4789559 FT /rpt_family="MaLR" FT repeat_region 4789563..4791164 FT /rpt_family="MaLR" FT repeat_region 4791177..4791554 FT /rpt_family="MaLR" FT repeat_region 4791579..4791786 FT /rpt_family="MaLR" FT repeat_region 4791787..4791922 FT /rpt_family="Alu" FT repeat_region 4791923..4792065 FT /rpt_family="MaLR" FT repeat_region 4792678..4792715 FT /rpt_family="L2" FT repeat_region 4792777..4792854 FT /rpt_family="MIR" FT repeat_region 4792890..4793174 FT /rpt_family="L2" FT repeat_region 4794811..4795001 FT /rpt_family="MIR" FT repeat_region 4795014..4795426 FT /rpt_family="(ATGGTG)n" FT repeat_region 4795408..4795583 FT /rpt_family="(TGG)n" FT repeat_region 4795585..4795631 FT /rpt_family="(ATG)n" FT repeat_region 4795641..4795876 FT /rpt_family="MIR" FT repeat_region 4796077..4796181 FT /rpt_family="L2" FT repeat_region 4796248..4796362 FT /rpt_family="L2" FT repeat_region 4796509..4796689 FT /rpt_family="MIR" FT repeat_region 4797080..4797381 FT /rpt_family="Alu" FT repeat_region 4797675..4797780 FT /rpt_family="MIR" FT repeat_region 4798083..4798510 FT /rpt_family="MaLR" FT repeat_region 4798759..4798869 FT /rpt_family="MIR" FT repeat_region 4798879..4799114 FT /rpt_family="L1" FT repeat_region 4799115..4799474 FT /rpt_family="MaLR" FT repeat_region 4799475..4801232 FT /rpt_family="L1" FT repeat_region 4801236..4801787 FT /rpt_family="L1" FT repeat_region 4801788..4802083 FT /rpt_family="Alu" FT repeat_region 4802084..4802790 FT /rpt_family="L1" FT repeat_region 4802936..4803187 FT /rpt_family="MIR" FT repeat_region 4803742..4804056 FT /rpt_family="Alu" FT repeat_region 4804411..4804893 FT /rpt_family="MaLR" FT repeat_region 4805060..4805340 FT /rpt_family="ERVL" FT repeat_region 4805658..4805843 FT /rpt_family="MaLR" FT repeat_region 4805974..4806141 FT /rpt_family="MIR" FT repeat_region 4806168..4806255 FT /rpt_family="L2" FT repeat_region 4806729..4806836 FT /rpt_family="MIR" FT repeat_region 4806984..4807102 FT /rpt_family="L2" FT repeat_region 4807147..4807230 FT /rpt_family="L2" FT repeat_region 4807282..4807463 FT /rpt_family="L2" FT repeat_region 4807468..4807646 FT /rpt_family="L2" FT repeat_region 4808014..4808134 FT /rpt_family="L1" FT repeat_region 4808481..4808764 FT /rpt_family="L2" FT repeat_region 4809143..4809270 FT /rpt_family="MIR" FT repeat_region 4810119..4810184 FT /rpt_family="MIR" FT repeat_region 4810918..4810983 FT /rpt_family="MIR" FT repeat_region 4811157..4811382 FT /rpt_family="L2" FT repeat_region 4811383..4811739 FT /rpt_family="MaLR" FT repeat_region 4811770..4811800 FT /rpt_family="(TGAA)n" FT repeat_region 4811802..4811936 FT /rpt_family="MIR" FT repeat_region 4812879..4813313 FT /rpt_family="L2" FT repeat_region 4813382..4813550 FT /rpt_family="MIR" FT repeat_region 4813996..4814047 FT /rpt_family="L1" FT repeat_region 4814054..4814163 FT /rpt_family="GA-rich" FT repeat_region 4814181..4814358 FT /rpt_family="MIR" FT repeat_region 4815397..4817416 FT /rpt_family="L1" FT repeat_region 4817496..4817576 FT /rpt_family="MIR" FT repeat_region 4817888..4817983 FT /rpt_family="MIR" FT repeat_region 4818013..4818279 FT /rpt_family="MaLR" FT repeat_region 4818280..4818654 FT /rpt_family="MaLR" FT repeat_region 4818655..4818782 FT /rpt_family="MaLR" FT repeat_region 4819217..4819325 FT /rpt_family="L2" FT repeat_region 4821115..4821212 FT /rpt_family="MIR" FT repeat_region 4821586..4821762 FT /rpt_family="MIR" FT repeat_region 4822586..4822688 FT /rpt_family="MIR" FT repeat_region 4822731..4822856 FT /rpt_family="MIR" FT repeat_region 4822865..4823246 FT /rpt_family="MaLR" FT repeat_region 4823247..4824883 FT /rpt_family="MaLR" FT repeat_region 4824884..4825260 FT /rpt_family="MaLR" FT repeat_region 4825285..4825507 FT /rpt_family="MIR" FT repeat_region 4825890..4825915 FT /rpt_family="(TTCA)n" FT repeat_region 4825999..4826765 FT /rpt_family="L1" FT repeat_region 4826919..4827284 FT /rpt_family="MaLR" FT repeat_region 4827353..4827439 FT /rpt_family="MER1_type" FT repeat_region 4827547..4827589 FT /rpt_family="ERVL" FT repeat_region 4827593..4827647 FT /rpt_family="(TC)n" FT repeat_region 4827645..4827793 FT /rpt_family="(TCCA)n" FT repeat_region 4827768..4827952 FT /rpt_family="(TCTA)n" FT repeat_region 4827992..4828287 FT /rpt_family="Alu" FT repeat_region 4828295..4828684 FT /rpt_family="ERVL" FT repeat_region 4828692..4828848 FT /rpt_family="MIR" FT repeat_region 4829443..4829861 FT /rpt_family="MaLR" FT repeat_region 4830079..4830148 FT /rpt_family="L2" FT repeat_region 4830472..4830702 FT /rpt_family="CT-rich" FT repeat_region 4831729..4831841 FT /rpt_family="MIR" FT repeat_region 4831848..4831913 FT /rpt_family="CR1" FT repeat_region 4831944..4832207 FT /rpt_family="L1" FT repeat_region 4832224..4832265 FT /rpt_family="MIR" FT repeat_region 4832379..4832661 FT /rpt_family="Alu" FT repeat_region 4832732..4832900 FT /rpt_family="MaLR" FT repeat_region 4832901..4833169 FT /rpt_family="Alu" FT repeat_region 4833170..4833374 FT /rpt_family="MaLR" FT repeat_region 4833376..4833498 FT /rpt_family="L1" FT repeat_region 4833680..4833793 FT /rpt_family="MIR" FT repeat_region 4833982..4834028 FT /rpt_family="MER1_type" FT repeat_region 4834039..4834122 FT /rpt_family="L1" FT repeat_region 4834127..4834426 FT /rpt_family="L1" FT repeat_region 4834436..4834631 FT /rpt_family="L1" FT repeat_region 4834890..4835097 FT /rpt_family="MIR" FT repeat_region 4835213..4836433 FT /rpt_family="L1" FT repeat_region 4836434..4836794 FT /rpt_family="MaLR" FT repeat_region 4836795..4837330 FT /rpt_family="L1" FT repeat_region 4837331..4837640 FT /rpt_family="Alu" FT repeat_region 4837641..4837923 FT /rpt_family="L1" FT repeat_region 4837934..4838164 FT /rpt_family="MaLR" FT repeat_region 4838165..4838457 FT /rpt_family="Alu" FT repeat_region 4838458..4838511 FT /rpt_family="MaLR" FT repeat_region 4838865..4838968 FT /rpt_family="MIR" FT repeat_region 4839115..4839229 FT /rpt_family="MER1_type" FT repeat_region 4839395..4839653 FT /rpt_family="(TG)n" FT repeat_region 4840516..4840578 FT /rpt_family="(CAGAGA)n" FT repeat_region 4840583..4840633 FT /rpt_family="GA-rich" FT repeat_region 4841229..4841396 FT /rpt_family="MIR" FT repeat_region 4841528..4841679 FT /rpt_family="MER1_type" FT repeat_region 4841869..4842032 FT /rpt_family="MIR" FT repeat_region 4842041..4842303 FT /rpt_family="MaLR" FT repeat_region 4842793..4842954 FT /rpt_family="MER1_type" FT repeat_region 4842950..4843050 FT /rpt_family="MIR" FT repeat_region 4843557..4843832 FT /rpt_family="Alu" FT repeat_region 4844512..4844550 FT /rpt_family="L2" FT repeat_region 4844560..4844617 FT /rpt_family="MIR" FT repeat_region 4844984..4845028 FT /rpt_family="(TGGG)n" FT repeat_region 4845612..4845712 FT /rpt_family="MIR" FT repeat_region 4846071..4846117 FT /rpt_family="MIR" FT repeat_region 4846310..4846795 FT /rpt_family="MaLR" FT repeat_region 4846984..4847294 FT /rpt_family="Alu" FT repeat_region 4847372..4847668 FT /rpt_family="Alu" FT repeat_region 4848148..4848287 FT /rpt_family="MIR" FT repeat_region 4848407..4848491 FT /rpt_family="MIR" FT repeat_region 4849202..4849375 FT /rpt_family="MIR" FT repeat_region 4849514..4849673 FT /rpt_family="MIR" FT repeat_region 4849720..4849836 FT /rpt_family="Alu" FT repeat_region 4849837..4850355 FT /rpt_family="L2" FT repeat_region 4850537..4850631 FT /rpt_family="MIR" FT repeat_region 4850669..4850858 FT /rpt_family="MIR" FT repeat_region 4851513..4851599 FT /rpt_family="MIR" FT repeat_region 4851615..4851921 FT /rpt_family="Alu" FT repeat_region 4852397..4852527 FT /rpt_family="MIR" FT repeat_region 4853000..4853153 FT /rpt_family="MIR" FT repeat_region 4853451..4853604 FT /rpt_family="MIR" FT repeat_region 4853606..4853644 FT /rpt_family="(TTTTG)n" FT repeat_region 4855751..4856055 FT /rpt_family="Alu" FT repeat_region 4856126..4856373 FT /rpt_family="MIR" FT repeat_region 4858786..4858809 FT /rpt_family="(C)n" FT repeat_region 4859283..4859397 FT /rpt_family="Alu" FT repeat_region 4859398..4859513 FT /rpt_family="GA-rich" FT repeat_region 4860242..4860262 FT /rpt_family="(TTA)n" FT repeat_region 4861035..4861082 FT /rpt_family="G-rich" FT misc_feature 4861228..4862241 FT /note="CpG_island (%GC=76.2, o/e=0.70, #CpGs=115)" FT repeat_region 4861488..4861537 FT /rpt_family="GC_rich" FT repeat_region 4861695..4861740 FT /rpt_family="GC_rich" FT repeat_region 4863040..4863068 FT /rpt_family="GC_rich" FT repeat_region 4863188..4863230 FT /rpt_family="T-rich" FT repeat_region 4863624..4863648 FT /rpt_family="(CA)n" FT repeat_region 4864203..4864354 FT /rpt_family="MIR" FT repeat_region 4865049..4865196 FT /rpt_family="MIR" FT repeat_region 4865280..4865331 FT /rpt_family="(A)n" FT repeat_region 4865491..4865512 FT /rpt_family="AT_rich" FT repeat_region 4865592..4865653 FT /rpt_family="AT_rich" FT misc_feature 4866439..4869511 FT /note="CpG_island (%GC=61.0, o/e=0.70, #CpGs=210)" FT repeat_region 4867235..4867352 FT /rpt_family="MIR" FT repeat_region 4867675..4867759 FT /rpt_family="GC_rich" FT repeat_region 4868266..4868382 FT /rpt_family="MIR" FT repeat_region 4869059..4869095 FT /rpt_family="GC_rich" FT repeat_region 4869476..4869655 FT /rpt_family="(CA)n" FT repeat_region 4870490..4870636 FT /rpt_family="MIR" FT repeat_region 4871697..4871923 FT /rpt_family="MIR" FT repeat_region 4872293..4872395 FT /rpt_family="MIR" FT repeat_region 4872664..4872757 FT /rpt_family="MIR" FT repeat_region 4872808..4873056 FT /rpt_family="L2" FT repeat_region 4873680..4873827 FT /rpt_family="MIR" FT repeat_region 4873846..4873916 FT /rpt_family="MER1_type?" FT repeat_region 4874175..4874354 FT /rpt_family="MIR" FT repeat_region 4875930..4876808 FT /rpt_family="AcHobo" FT repeat_region 4877375..4877555 FT /rpt_family="L2" FT repeat_region 4877687..4877822 FT /rpt_family="L2" FT repeat_region 4877862..4878025 FT /rpt_family="MIR" FT repeat_region 4878065..4878234 FT /rpt_family="L1" FT repeat_region 4878258..4878570 FT /rpt_family="Alu" FT repeat_region 4878576..4878698 FT /rpt_family="MIR" FT repeat_region 4878760..4879253 FT /rpt_family="L2" FT repeat_region 4879257..4879567 FT /rpt_family="Alu" FT repeat_region 4880183..4880436 FT /rpt_family="MIR" FT repeat_region 4880590..4880751 FT /rpt_family="MIR" FT repeat_region 4881174..4881464 FT /rpt_family="Alu" FT repeat_region 4881475..4881655 FT /rpt_family="MIR" FT repeat_region 4882203..4882258 FT /rpt_family="AT_rich" FT repeat_region 4882344..4883224 FT /rpt_family="L1" FT repeat_region 4883257..4883455 FT /rpt_family="L1" FT repeat_region 4883459..4883858 FT /rpt_family="MER2_type" FT repeat_region 4883859..4884154 FT /rpt_family="Alu" FT repeat_region 4884155..4884645 FT /rpt_family="MER2_type" FT repeat_region 4884646..4884770 FT /rpt_family="Alu" FT repeat_region 4885001..4885168 FT /rpt_family="Alu" FT repeat_region 4885169..4885359 FT /rpt_family="Alu" FT repeat_region 4885382..4885797 FT /rpt_family="MER2_type" FT repeat_region 4885833..4885950 FT /rpt_family="Alu" FT repeat_region 4885953..4886016 FT /rpt_family="MER2_type" FT repeat_region 4886017..4886318 FT /rpt_family="Alu" FT repeat_region 4886319..4887165 FT /rpt_family="MER2_type" FT repeat_region 4887204..4887462 FT /rpt_family="Alu" FT repeat_region 4887473..4887781 FT /rpt_family="MER2_type" FT repeat_region 4887782..4888084 FT /rpt_family="Alu" FT repeat_region 4888085..4888292 FT /rpt_family="MER2_type" FT repeat_region 4888293..4888650 FT /rpt_family="MaLR" FT repeat_region 4888651..4888709 FT /rpt_family="MER2_type" FT repeat_region 4888729..4889394 FT /rpt_family="L1" FT repeat_region 4889695..4889775 FT /rpt_family="MaLR" FT repeat_region 4890223..4890331 FT /rpt_family="MIR" FT repeat_region 4890859..4891185 FT /rpt_family="MaLR" FT repeat_region 4891817..4891899 FT /rpt_family="MIR" FT repeat_region 4892052..4892161 FT /rpt_family="L2" FT repeat_region 4893069..4893229 FT /rpt_family="MIR" FT repeat_region 4893268..4893297 FT /rpt_family="(TG)n" FT repeat_region 4894151..4894226 FT /rpt_family="Alu" FT repeat_region 4894227..4894398 FT /rpt_family="Alu" FT repeat_region 4894666..4894884 FT /rpt_family="MIR" FT repeat_region 4894887..4895337 FT /rpt_family="MaLR" FT repeat_region 4896999..4897058 FT /rpt_family="MaLR" FT repeat_region 4897281..4897401 FT /rpt_family="MaLR" FT repeat_region 4897404..4897846 FT /rpt_family="ERVL" FT repeat_region 4897851..4897918 FT /rpt_family="MaLR" FT repeat_region 4897922..4898290 FT /rpt_family="MaLR" FT repeat_region 4898384..4898754 FT /rpt_family="MaLR" FT repeat_region 4898791..4898843 FT /rpt_family="MaLR" FT repeat_region 4898844..4899211 FT /rpt_family="MaLR" FT repeat_region 4899212..4899255 FT /rpt_family="MaLR" FT repeat_region 4899361..4899517 FT /rpt_family="MIR" FT repeat_region 4899637..4899880 FT /rpt_family="MaLR" FT repeat_region 4899946..4900023 FT /rpt_family="MaLR" FT repeat_region 4900690..4901053 FT /rpt_family="MaLR" FT repeat_region 4901893..4902328 FT /rpt_family="MaLR" FT repeat_region 4902389..4902489 FT /rpt_family="ERVL" FT repeat_region 4902632..4902785 FT /rpt_family="MIR" FT repeat_region 4903005..4903651 FT /rpt_family="L1" FT repeat_region 4903652..4904051 FT /rpt_family="MaLR" FT repeat_region 4904052..4904110 FT /rpt_family="L1" FT repeat_region 4904111..4904418 FT /rpt_family="Alu" FT repeat_region 4904419..4904549 FT /rpt_family="L1" FT repeat_region 4904747..4904835 FT /rpt_family="GA-rich" FT repeat_region 4905041..4905500 FT /rpt_family="MaLR" FT repeat_region 4905592..4905668 FT /rpt_family="ERVL" FT repeat_region 4905707..4906632 FT /rpt_family="ERVL" FT repeat_region 4906713..4907688 FT /rpt_family="L1" FT repeat_region 4907689..4907720 FT /rpt_family="(TTA)n" FT repeat_region 4907721..4908183 FT /rpt_family="L1" FT repeat_region 4908183..4910239 FT /rpt_family="L1" FT repeat_region 4910240..4910439 FT /rpt_family="Alu" FT repeat_region 4910440..4910538 FT /rpt_family="L1" FT repeat_region 4910687..4911360 FT /rpt_family="ERVL" FT repeat_region 4911802..4912140 FT /rpt_family="MER1_type" FT repeat_region 4912209..4912276 FT /rpt_family="MaLR" FT repeat_region 4912277..4912517 FT /rpt_family="Alu" FT repeat_region 4912552..4912865 FT /rpt_family="MaLR" FT repeat_region 4912868..4913068 FT /rpt_family="ERVL" FT repeat_region 4913076..4913203 FT /rpt_family="MaLR" FT repeat_region 4913656..4913772 FT /rpt_family="Alu" FT repeat_region 4913773..4913837 FT /rpt_family="(CA)n" FT repeat_region 4913838..4913995 FT /rpt_family="Alu" FT repeat_region 4914136..4914366 FT /rpt_family="ERVL" FT repeat_region 4914613..4914778 FT /rpt_family="MIR" FT repeat_region 4915434..4915623 FT /rpt_family="MIR" FT repeat_region 4916112..4916540 FT /rpt_family="ERVL" FT repeat_region 4916603..4916760 FT /rpt_family="MER1_type" FT repeat_region 4916863..4916956 FT /rpt_family="MIR" FT repeat_region 4917920..4918010 FT /rpt_family="L2" FT repeat_region 4918011..4918048 FT /rpt_family="MaLR" FT repeat_region 4918037..4918160 FT /rpt_family="MaLR" FT repeat_region 4918161..4919041 FT /rpt_family="MaLR" FT repeat_region 4919030..4919322 FT /rpt_family="MaLR" FT repeat_region 4919323..4919679 FT /rpt_family="MaLR" FT repeat_region 4919682..4919812 FT /rpt_family="L2" FT repeat_region 4921742..4921784 FT /rpt_family="L2" FT repeat_region 4922195..4922276 FT /rpt_family="MIR" FT repeat_region 4922563..4922791 FT /rpt_family="7SK" FT repeat_region 4922896..4922986 FT /rpt_family="L2" FT repeat_region 4923438..4923708 FT /rpt_family="Alu" FT repeat_region 4924298..4924452 FT /rpt_family="MIR" FT repeat_region 4924950..4925106 FT /rpt_family="MIR" FT repeat_region 4925286..4925339 FT /rpt_family="MIR" FT repeat_region 4925379..4925737 FT /rpt_family="MaLR" FT repeat_region 4925796..4926054 FT /rpt_family="ERVL" FT repeat_region 4926265..4926316 FT /rpt_family="MIR" FT repeat_region 4926336..4926467 FT /rpt_family="MaLR" FT repeat_region 4926598..4927464 FT /rpt_family="L1" FT repeat_region 4927465..4927967 FT /rpt_family="L1" FT repeat_region 4927968..4928477 FT /rpt_family="ERVK" FT repeat_region 4928478..4932376 FT /rpt_family="L1" FT repeat_region 4932718..4932760 FT /rpt_family="(TTTTTG)n" FT repeat_region 4933141..4933161 FT /rpt_family="AT_rich" FT repeat_region 4933191..4933303 FT /rpt_family="MIR" FT repeat_region 4933304..4933414 FT /rpt_family="AcHobo" FT repeat_region 4933415..4933482 FT /rpt_family="MIR" FT repeat_region 4933505..4933593 FT /rpt_family="MIR" FT repeat_region 4933878..4934185 FT /rpt_family="Alu" FT repeat_region 4934272..4934322 FT /rpt_family="(TC)n" FT repeat_region 4934674..4934945 FT /rpt_family="MaLR" FT repeat_region 4934978..4935091 FT /rpt_family="L1" FT repeat_region 4935103..4935182 FT /rpt_family="MaLR" FT repeat_region 4935322..4935748 FT /rpt_family="MaLR" FT repeat_region 4935969..4936090 FT /rpt_family="MIR" FT repeat_region 4936089..4936205 FT /rpt_family="L2" FT repeat_region 4936240..4936385 FT /rpt_family="MER53" FT repeat_region 4936401..4936709 FT /rpt_family="Alu" FT repeat_region 4936733..4936743 FT /rpt_family="L2" FT repeat_region 4936744..4937050 FT /rpt_family="Alu" FT repeat_region 4937051..4937368 FT /rpt_family="L2" FT repeat_region 4937361..4937443 FT /rpt_family="MIR" FT repeat_region 4937552..4937770 FT /rpt_family="MIR" FT repeat_region 4937783..4937937 FT /rpt_family="L2" FT repeat_region 4937938..4938234 FT /rpt_family="Alu" FT repeat_region 4938235..4938453 FT /rpt_family="L2" FT repeat_region 4938600..4938635 FT /rpt_family="L2" FT repeat_region 4938861..4939009 FT /rpt_family="MIR" FT repeat_region 4939200..4939259 FT /rpt_family="(TTCA)n" FT repeat_region 4939714..4939757 FT /rpt_family="L2" FT repeat_region 4939920..4939949 FT /rpt_family="AcHobo" FT repeat_region 4939950..4940600 FT /rpt_family="L1" FT repeat_region 4940601..4940684 FT /rpt_family="AcHobo" FT repeat_region 4940685..4940987 FT /rpt_family="Alu" FT repeat_region 4940988..4941790 FT /rpt_family="AcHobo" FT repeat_region 4942977..4943055 FT /rpt_family="MIR" FT repeat_region 4943709..4943905 FT /rpt_family="MaLR" FT repeat_region 4943970..4944121 FT /rpt_family="MIR" FT repeat_region 4944333..4944434 FT /rpt_family="MER2_type" FT repeat_region 4944542..4944574 FT /rpt_family="(TGAA)n" FT repeat_region 4944923..4945036 FT /rpt_family="MIR" FT repeat_region 4945341..4945441 FT /rpt_family="MIR" FT repeat_region 4945459..4945486 FT /rpt_family="(TC)n" FT repeat_region 4945486..4945525 FT /rpt_family="(CA)n" FT repeat_region 4946131..4946215 FT /rpt_family="MIR" FT repeat_region 4946450..4946540 FT /rpt_family="MIR" FT repeat_region 4946597..4946693 FT /rpt_family="MIR" FT repeat_region 4946756..4946788 FT /rpt_family="(TC)n" FT repeat_region 4947054..4947416 FT /rpt_family="MaLR" FT repeat_region 4947762..4947824 FT /rpt_family="L2" FT repeat_region 4947891..4947937 FT /rpt_family="MIR" FT repeat_region 4947938..4948351 FT /rpt_family="MaLR" FT repeat_region 4948352..4948456 FT /rpt_family="MIR" FT repeat_region 4948618..4948937 FT /rpt_family="Alu" FT repeat_region 4949157..4949404 FT /rpt_family="MIR" FT repeat_region 4949473..4949495 FT /rpt_family="AT_rich" FT repeat_region 4950666..4950773 FT /rpt_family="AcHobo" FT repeat_region 4951133..4951271 FT /rpt_family="MIR" FT repeat_region 4951507..4951611 FT /rpt_family="MIR" FT repeat_region 4951586..4951654 FT /rpt_family="MIR" FT repeat_region 4951684..4951755 FT /rpt_family="MIR" FT repeat_region 4951859..4951980 FT /rpt_family="MER53" FT repeat_region 4952396..4952557 FT /rpt_family="MER1_type" FT repeat_region 4952562..4952693 FT /rpt_family="MIR" FT repeat_region 4953805..4953922 FT /rpt_family="L2" FT repeat_region 4954015..4954453 FT /rpt_family="L1" FT repeat_region 4954454..4954741 FT /rpt_family="Alu" FT repeat_region 4954742..4955175 FT /rpt_family="L1" FT repeat_region 4955158..4955653 FT /rpt_family="L1" FT repeat_region 4961648..4961777 FT /rpt_family="L1" FT repeat_region 4961778..4961870 FT /rpt_family="MaLR" FT repeat_region 4961872..4962215 FT /rpt_family="L1" FT repeat_region 4962216..4962517 FT /rpt_family="Alu" FT repeat_region 4962518..4964014 FT /rpt_family="L1" FT repeat_region 4964015..4964042 FT /rpt_family="(TTTA)n" FT repeat_region 4964047..4964342 FT /rpt_family="Alu" FT repeat_region 4964343..4965287 FT /rpt_family="L1" FT repeat_region 4965310..4965451 FT /rpt_family="L1" FT repeat_region 4965498..4965866 FT /rpt_family="MaLR" FT repeat_region 4965870..4966303 FT /rpt_family="MaLR" FT repeat_region 4966306..4966761 FT /rpt_family="MaLR" FT repeat_region 4966767..4967121 FT /rpt_family="L1" FT repeat_region 4967671..4967827 FT /rpt_family="(TA)n" FT repeat_region 4968060..4968484 FT /rpt_family="MaLR" FT repeat_region 4968528..4968680 FT /rpt_family="Alu" FT repeat_region 4969111..4969422 FT /rpt_family="Alu" FT repeat_region 4969795..4970176 FT /rpt_family="ERVL" FT repeat_region 4970524..4970789 FT /rpt_family="ERVL" FT repeat_region 4970797..4970966 FT /rpt_family="MIR" FT repeat_region 4971744..4971853 FT /rpt_family="MIR" FT repeat_region 4972438..4972652 FT /rpt_family="L1" FT repeat_region 4972773..4972877 FT /rpt_family="(TCTA)n" FT repeat_region 4972879..4973005 FT /rpt_family="MaLR" FT repeat_region 4973050..4973849 FT /rpt_family="ERV1" FT repeat_region 4973850..4974127 FT /rpt_family="MaLR" FT repeat_region 4974422..4974729 FT /rpt_family="L1" FT repeat_region 4974881..4975265 FT /rpt_family="L1" FT repeat_region 4975266..4975291 FT /rpt_family="(TG)n" FT repeat_region 4975292..4975329 FT /rpt_family="L1" FT repeat_region 4975330..4975700 FT /rpt_family="MaLR" FT repeat_region 4975703..4977349 FT /rpt_family="MaLR" FT repeat_region 4977350..4977735 FT /rpt_family="MaLR" FT repeat_region 4977736..4978736 FT /rpt_family="L1" FT repeat_region 4978796..4979339 FT /rpt_family="ERV1" FT repeat_region 4979958..4980354 FT /rpt_family="ERV1" FT repeat_region 4980365..4980673 FT /rpt_family="Alu" FT repeat_region 4980762..4980799 FT /rpt_family="ERVL" FT repeat_region 4980826..4981044 FT /rpt_family="MaLR" FT repeat_region 4981088..4981263 FT /rpt_family="MaLR" FT repeat_region 4981264..4981363 FT /rpt_family="ERVL" FT repeat_region 4981364..4981787 FT /rpt_family="MaLR" FT repeat_region 4981788..4981839 FT /rpt_family="ERVL" FT repeat_region 4981963..4982071 FT /rpt_family="MIR" FT repeat_region 4982109..4982239 FT /rpt_family="MIR" FT repeat_region 4983181..4983255 FT /rpt_family="MIR" FT repeat_region 4983374..4983531 FT /rpt_family="L2" FT repeat_region 4983657..4983783 FT /rpt_family="ERVL" FT repeat_region 4983797..4984303 FT /rpt_family="ERVL" FT repeat_region 4984311..4984590 FT /rpt_family="Alu" FT repeat_region 4984591..4984616 FT /rpt_family="(TAA)n" FT repeat_region 4984717..4984870 FT /rpt_family="ERVL" FT repeat_region 4985689..4985700 FT /rpt_family="L2" FT repeat_region 4985701..4986108 FT /rpt_family="MaLR" FT repeat_region 4986109..4986293 FT /rpt_family="L2" FT repeat_region 4986314..4986359 FT /rpt_family="(TG)n" FT repeat_region 4986631..4986702 FT /rpt_family="CT-rich" FT repeat_region 4987216..4987236 FT /rpt_family="AT_rich" FT repeat_region 4987718..4987820 FT /rpt_family="MIR" FT repeat_region 4987821..4988119 FT /rpt_family="Alu" FT repeat_region 4988120..4988181 FT /rpt_family="MIR" FT repeat_region 4988213..4988518 FT /rpt_family="Alu" FT repeat_region 4988520..4988926 FT /rpt_family="ERVL" FT repeat_region 4989114..4989240 FT /rpt_family="MIR" FT repeat_region 4989328..4989470 FT /rpt_family="L2" FT repeat_region 4989871..4990270 FT /rpt_family="MER2_type" FT repeat_region 4990336..4990447 FT /rpt_family="L1" FT repeat_region 4990779..4990889 FT /rpt_family="MIR" FT repeat_region 4991088..4991167 FT /rpt_family="MIR" FT repeat_region 4991426..4991556 FT /rpt_family="MIR" FT repeat_region 4992284..4992372 FT /rpt_family="MIR" FT repeat_region 4992603..4992816 FT /rpt_family="MER1_type" FT repeat_region 4993617..4993816 FT /rpt_family="CR1" FT repeat_region 4993817..4994120 FT /rpt_family="Alu" FT repeat_region 4994121..4994233 FT /rpt_family="CR1" FT repeat_region 4994234..4994544 FT /rpt_family="Alu" FT repeat_region 4994545..4994780 FT /rpt_family="CR1" FT repeat_region 4995058..4995233 FT /rpt_family="L2" FT repeat_region 4995286..4995582 FT /rpt_family="Alu" FT repeat_region 4996036..4996716 FT /rpt_family="L2" FT repeat_region 4998051..4998230 FT /rpt_family="MIR" FT repeat_region 5004280..5004309 FT /rpt_family="(TTTTTG)n" FT repeat_region 5004534..5004834 FT /rpt_family="Alu" FT repeat_region 5006720..5006797 FT /rpt_family="MIR" FT repeat_region 5006893..5006931 FT /rpt_family="A-rich" FT repeat_region 5007284..5007503 FT /rpt_family="L1" FT repeat_region 5007534..5008010 FT /rpt_family="L1" FT repeat_region 5008011..5008439 FT /rpt_family="MaLR" FT repeat_region 5008440..5008654 FT /rpt_family="L1" FT repeat_region 5008656..5008710 FT /rpt_family="ERV1" FT repeat_region 5008711..5009036 FT /rpt_family="ERV1" FT repeat_region 5009037..5009058 FT /rpt_family="AT_rich" FT repeat_region 5009059..5009509 FT /rpt_family="L1" FT repeat_region 5009530..5009796 FT /rpt_family="L1" FT repeat_region 5009838..5010164 FT /rpt_family="L1" FT repeat_region 5010185..5010386 FT /rpt_family="L1" FT repeat_region 5010447..5010661 FT /rpt_family="L1" FT repeat_region 5010684..5011407 FT /rpt_family="L1" FT repeat_region 5012099..5012410 FT /rpt_family="L2" FT repeat_region 5012413..5012666 FT /rpt_family="L2" FT repeat_region 5013248..5013484 FT /rpt_family="MIR" FT repeat_region 5014390..5014718 FT /rpt_family="L1" FT repeat_region 5014796..5014982 FT /rpt_family="MIR" FT repeat_region 5015034..5015064 FT /rpt_family="(TGG)n" FT repeat_region 5015133..5015589 FT /rpt_family="MaLR" FT repeat_region 5015863..5015989 FT /rpt_family="MIR" FT repeat_region 5017615..5017689 FT /rpt_family="MIR" FT repeat_region 5017690..5018079 FT /rpt_family="MaLR" FT repeat_region 5018080..5018170 FT /rpt_family="MIR" FT repeat_region 5019341..5019384 FT /rpt_family="AT_rich" FT repeat_region 5019585..5019721 FT /rpt_family="MIR" FT repeat_region 5019880..5019928 FT /rpt_family="L1" FT repeat_region 5019929..5019955 FT /rpt_family="(CA)n" FT repeat_region 5019956..5020123 FT /rpt_family="L1" FT repeat_region 5020402..5020586 FT /rpt_family="MIR" FT repeat_region 5020714..5020754 FT /rpt_family="(T)n" FT repeat_region 5021940..5022126 FT /rpt_family="MIR" FT repeat_region 5022212..5022338 FT /rpt_family="MIR" FT repeat_region 5022545..5022610 FT /rpt_family="MIR" FT repeat_region 5022801..5022967 FT /rpt_family="MIR" FT repeat_region 5023853..5024030 FT /rpt_family="L2" FT repeat_region 5024492..5024571 FT /rpt_family="L2" FT repeat_region 5024729..5024769 FT /rpt_family="(TG)n" FT repeat_region 5024788..5025012 FT /rpt_family="MaLR" FT repeat_region 5025037..5025239 FT /rpt_family="CR1" FT repeat_region 5025842..5026243 FT /rpt_family="ERVL" FT repeat_region 5026337..5026545 FT /rpt_family="ERVL" FT repeat_region 5026546..5027220 FT /rpt_family="ERVL" FT repeat_region 5027221..5027498 FT /rpt_family="ERVL" FT repeat_region 5028034..5028385 FT /rpt_family="MaLR" FT repeat_region 5029734..5029819 FT /rpt_family="MaLR" FT repeat_region 5029869..5030042 FT /rpt_family="Alu" FT repeat_region 5030071..5030479 FT /rpt_family="MaLR" FT repeat_region 5030485..5030506 FT /rpt_family="MaLR" FT repeat_region 5030507..5030898 FT /rpt_family="MaLR" FT repeat_region 5030899..5031527 FT /rpt_family="MaLR" FT repeat_region 5031528..5031900 FT /rpt_family="MaLR" FT repeat_region 5031901..5031928 FT /rpt_family="MaLR" FT repeat_region 5032288..5032472 FT /rpt_family="MIR" FT repeat_region 5032685..5033037 FT /rpt_family="ERVL" FT repeat_region 5033038..5033100 FT /rpt_family="MIR" FT repeat_region 5033118..5033333 FT /rpt_family="Alu" FT repeat_region 5033895..5033918 FT /rpt_family="(A)n" FT repeat_region 5033919..5034231 FT /rpt_family="Alu" FT repeat_region 5034232..5034254 FT /rpt_family="(A)n" FT repeat_region 5034354..5034568 FT /rpt_family="L1" FT repeat_region 5034614..5034810 FT /rpt_family="MIR" FT repeat_region 5035913..5035953 FT /rpt_family="L2" FT repeat_region 5036931..5036993 FT /rpt_family="L2" FT repeat_region 5037403..5037508 FT /rpt_family="AcHobo" FT repeat_region 5037509..5037808 FT /rpt_family="Alu" FT repeat_region 5037809..5037849 FT /rpt_family="AcHobo" FT repeat_region 5037966..5038062 FT /rpt_family="L2" FT repeat_region 5038387..5038692 FT /rpt_family="Alu" FT repeat_region 5038781..5039002 FT /rpt_family="MER1_type" FT repeat_region 5039123..5039169 FT /rpt_family="MIR" FT repeat_region 5039544..5039650 FT /rpt_family="L2" FT repeat_region 5039805..5039900 FT /rpt_family="CR1" FT repeat_region 5040087..5040704 FT /rpt_family="MER2_type" FT repeat_region 5040705..5041025 FT /rpt_family="Alu" FT repeat_region 5041026..5041606 FT /rpt_family="MER2_type" FT repeat_region 5041610..5041764 FT /rpt_family="MaLR" FT repeat_region 5041819..5042011 FT /rpt_family="MaLR" FT repeat_region 5042014..5042110 FT /rpt_family="MIR" FT repeat_region 5042116..5042414 FT /rpt_family="Alu" FT repeat_region 5042528..5042762 FT /rpt_family="MER2_type" FT repeat_region complement(5237833..5238065) FT /rpt_family="CR1" FT repeat_region complement(5237006..5237229) FT /rpt_family="MIR" FT repeat_region complement(5236807..5236957) FT /rpt_family="MIR" FT repeat_region complement(5236484..5236552) FT /rpt_family="MIR" FT repeat_region complement(5236155..5236258) FT /rpt_family="L2" FT repeat_region complement(5235927..5236097) FT /rpt_family="MIR" FT repeat_region complement(5235729..5235799) FT /rpt_family="(CAGGT)n" FT repeat_region complement(5234715..5234862) FT /rpt_family="ERVL" FT repeat_region complement(5234471..5234538) FT /rpt_family="ERVL" FT repeat_region complement(5233845..5234297) FT /rpt_family="MER1_type" FT repeat_region complement(5233704..5233824) FT /rpt_family="L2" FT repeat_region complement(5233056..5233371) FT /rpt_family="Alu" FT repeat_region complement(5232928..5233031) FT /rpt_family="L2" FT repeat_region complement(5232217..5232390) FT /rpt_family="MER1_type" FT repeat_region complement(5231906..5232216) FT /rpt_family="Alu" FT repeat_region complement(5231850..5231905) FT /rpt_family="MER1_type" FT repeat_region complement(5231711..5231849) FT /rpt_family="Alu" FT repeat_region complement(5231137..5231710) FT /rpt_family="MER1_type" FT repeat_region complement(5231028..5231136) FT /rpt_family="L1" FT repeat_region complement(5230935..5231027) FT /rpt_family="MER1_type" FT repeat_region complement(5230798..5230937) FT /rpt_family="MER2_type" FT repeat_region complement(5230709..5230818) FT /rpt_family="MER2_type" FT repeat_region complement(5230413..5230708) FT /rpt_family="Alu" FT repeat_region complement(5230302..5230412) FT /rpt_family="MER2_type" FT repeat_region complement(5228635..5230295) FT /rpt_family="MER1_type" FT repeat_region complement(5228076..5228627) FT /rpt_family="MER2_type" FT repeat_region complement(5227215..5227273) FT /rpt_family="MER2_type" FT repeat_region complement(5227158..5227214) FT /rpt_family="MER1_type" FT repeat_region complement(5226864..5227157) FT /rpt_family="Alu" FT repeat_region complement(5226741..5226863) FT /rpt_family="MER1_type" FT repeat_region complement(5226557..5226657) FT /rpt_family="MIR" FT repeat_region complement(5226172..5226406) FT /rpt_family="ERVL" FT repeat_region complement(5225946..5226036) FT /rpt_family="MaLR" FT repeat_region complement(5225563..5225945) FT /rpt_family="MaLR" FT repeat_region complement(5225259..5225562) FT /rpt_family="Alu" FT repeat_region complement(5223958..5225258) FT /rpt_family="MaLR" FT repeat_region complement(5223604..5223957) FT /rpt_family="MaLR" FT repeat_region complement(5223379..5223603) FT /rpt_family="Alu" FT repeat_region complement(5223337..5223378) FT /rpt_family="MaLR" FT repeat_region complement(5222296..5222569) FT /rpt_family="L2" FT repeat_region complement(5221962..5222259) FT /rpt_family="L2" FT repeat_region complement(5221248..5221296) FT /rpt_family="MIR" FT repeat_region complement(5219997..5220209) FT /rpt_family="L2" FT repeat_region complement(5219842..5219994) FT /rpt_family="MaLR" FT repeat_region complement(5218034..5218206) FT /rpt_family="L2" FT repeat_region complement(5217816..5218004) FT /rpt_family="MER1_type" FT repeat_region complement(5217481..5217782) FT /rpt_family="CR1" FT repeat_region complement(5216371..5216488) FT /rpt_family="L1" FT repeat_region complement(5216160..5216367) FT /rpt_family="L1" FT repeat_region complement(5215778..5216159) FT /rpt_family="MaLR" FT repeat_region complement(5215513..5215777) FT /rpt_family="L1" FT repeat_region complement(5214867..5215135) FT /rpt_family="L2" FT repeat_region complement(5213841..5214051) FT /rpt_family="MIR" FT repeat_region complement(5213746..5213812) FT /rpt_family="L2" FT repeat_region complement(5212823..5212953) FT /rpt_family="MER103" FT repeat_region complement(5212525..5212817) FT /rpt_family="Alu" FT repeat_region complement(5212291..5212405) FT /rpt_family="L2" FT repeat_region complement(5211931..5211992) FT /rpt_family="GA-rich" FT repeat_region complement(5210946..5211250) FT /rpt_family="Alu" FT repeat_region complement(5210154..5210347) FT /rpt_family="MIR" FT repeat_region complement(5209720..5209891) FT /rpt_family="MaLR" FT repeat_region complement(5208948..5209318) FT /rpt_family="MaLR" FT repeat_region complement(5208727..5208902) FT /rpt_family="MER1_type" FT repeat_region complement(5207431..5207459) FT /rpt_family="(CA)n" FT repeat_region complement(5206599..5207145) FT /rpt_family="ERVL" FT repeat_region complement(5206185..5206493) FT /rpt_family="Alu" FT repeat_region complement(5206126..5206178) FT /rpt_family="(CAAAAA)n" FT repeat_region complement(5206028..5206106) FT /rpt_family="MIR" FT repeat_region complement(5205594..5205886) FT /rpt_family="ERVL" FT repeat_region complement(5205308..5205405) FT /rpt_family="L2" FT repeat_region complement(5205034..5205067) FT /rpt_family="(TGAA)n" FT repeat_region complement(5204707..5204933) FT /rpt_family="MIR" FT repeat_region complement(5203649..5204501) FT /rpt_family="MaLR" FT repeat_region complement(5203293..5203648) FT /rpt_family="MaLR" FT repeat_region complement(5202516..5202651) FT /rpt_family="MER1_type" FT repeat_region complement(5202040..5202082) FT /rpt_family="A-rich" FT repeat_region complement(5201766..5201889) FT /rpt_family="MIR" FT repeat_region complement(5199913..5200078) FT /rpt_family="L1" FT repeat_region complement(5199458..5199651) FT /rpt_family="L1" FT repeat_region complement(5199170..5199300) FT /rpt_family="L2" FT repeat_region complement(5198812..5198871) FT /rpt_family="MER1_type" FT repeat_region complement(5198168..5198491) FT /rpt_family="Alu" FT repeat_region complement(5198062..5198086) FT /rpt_family="(A)n" FT repeat_region complement(5198010..5198053) FT /rpt_family="GA-rich" FT repeat_region complement(5197521..5197875) FT /rpt_family="MER1_type?" FT repeat_region complement(5197138..5197423) FT /rpt_family="Alu" FT repeat_region complement(5196785..5196923) FT /rpt_family="Alu" FT repeat_region complement(5196360..5196774) FT /rpt_family="MaLR" FT repeat_region complement(5195767..5196031) FT /rpt_family="L2" FT repeat_region complement(5195084..5195212) FT /rpt_family="MIR" FT repeat_region complement(5194298..5194677) FT /rpt_family="L1" FT repeat_region complement(5192984..5193280) FT /rpt_family="Alu" FT repeat_region complement(5192531..5192701) FT /rpt_family="MIR" FT repeat_region complement(5192234..5192327) FT /rpt_family="L2" FT repeat_region complement(5191994..5192153) FT /rpt_family="MIR" FT repeat_region complement(5191625..5191712) FT /rpt_family="L2" FT repeat_region complement(5190769..5191624) FT /rpt_family="L1" FT repeat_region complement(5190547..5190753) FT /rpt_family="L1" FT repeat_region complement(5190191..5190432) FT /rpt_family="L2" FT repeat_region complement(5189361..5189512) FT /rpt_family="MER1_type" FT repeat_region complement(5189269..5189309) FT /rpt_family="MER1_type" FT repeat_region complement(5189117..5189267) FT /rpt_family="MIR" FT repeat_region complement(5187782..5187904) FT /rpt_family="L2" FT repeat_region complement(5187378..5187776) FT /rpt_family="L2" FT repeat_region complement(5186442..5186667) FT /rpt_family="MER2_type" FT repeat_region complement(5186167..5186441) FT /rpt_family="Alu" FT repeat_region complement(5185388..5186166) FT /rpt_family="MER2_type" FT repeat_region complement(5185306..5185379) FT /rpt_family="MER2_type" FT repeat_region complement(5185238..5185298) FT /rpt_family="MER2_type" FT repeat_region complement(5184923..5185237) FT /rpt_family="Alu" FT repeat_region complement(5184486..5184922) FT /rpt_family="MER2_type" FT repeat_region complement(5184180..5184485) FT /rpt_family="Alu" FT repeat_region complement(5183269..5184179) FT /rpt_family="MER2_type" FT repeat_region complement(5183096..5183241) FT /rpt_family="MaLR" FT repeat_region complement(5183057..5183095) FT /rpt_family="(TG)n" FT repeat_region complement(5182874..5183056) FT /rpt_family="MaLR" FT repeat_region complement(5182110..5182209) FT /rpt_family="MIR" FT repeat_region complement(5181672..5181810) FT /rpt_family="MaLR" FT repeat_region complement(5181556..5181652) FT /rpt_family="MaLR" FT repeat_region complement(5181436..5181521) FT /rpt_family="MaLR" FT repeat_region complement(5181196..5181353) FT /rpt_family="(TCTA)n" FT repeat_region complement(5180730..5181110) FT /rpt_family="MaLR" FT repeat_region complement(5178828..5179201) FT /rpt_family="MaLR" FT repeat_region complement(5178643..5178754) FT /rpt_family="MIR" FT repeat_region complement(5178166..5178470) FT /rpt_family="Alu" FT repeat_region complement(5171515..5171912) FT /rpt_family="L1" FT repeat_region complement(5170996..5171040) FT /rpt_family="L2" FT repeat_region complement(5169674..5169838) FT /rpt_family="L2" FT repeat_region complement(5169204..5169655) FT /rpt_family="ERVL" FT repeat_region complement(5168952..5169145) FT /rpt_family="MIR" FT repeat_region complement(5168114..5168523) FT /rpt_family="MaLR" FT repeat_region complement(5168035..5168086) FT /rpt_family="MIR" FT repeat_region complement(5166684..5166794) FT /rpt_family="MIR" FT repeat_region complement(5166414..5166488) FT /rpt_family="MIR" FT repeat_region complement(5166214..5166400) FT /rpt_family="MaLR" FT repeat_region complement(5165839..5166213) FT /rpt_family="MaLR" FT repeat_region complement(5165266..5165308) FT /rpt_family="(CA)n" FT repeat_region complement(5163143..5163350) FT /rpt_family="MaLR" FT repeat_region complement(5163019..5163152) FT /rpt_family="MaLR" FT repeat_region complement(5162844..5162907) FT /rpt_family="L2" FT repeat_region complement(5162372..5162699) FT /rpt_family="L2" FT repeat_region complement(5162035..5162098) FT /rpt_family="MIR" FT repeat_region complement(5161572..5161894) FT /rpt_family="ERVL" FT repeat_region complement(5161370..5161539) FT /rpt_family="(CATATA)n" FT repeat_region complement(5161211..5161389) FT /rpt_family="(TA)n" FT repeat_region complement(5161131..5161189) FT /rpt_family="ERVL" FT repeat_region complement(5160305..5160682) FT /rpt_family="MaLR" FT repeat_region complement(5159512..5159575) FT /rpt_family="MIR" FT repeat_region complement(5159379..5159433) FT /rpt_family="L2" FT repeat_region complement(5159053..5159348) FT /rpt_family="L2" FT repeat_region complement(5159027..5159047) FT /rpt_family="(T)n" FT repeat_region complement(5157977..5158055) FT /rpt_family="(TTTA)n" FT repeat_region complement(5157924..5158033) FT /rpt_family="(TATATG)n" FT repeat_region complement(5157740..5157909) FT /rpt_family="(TATATG)n" FT repeat_region complement(5157660..5157704) FT /rpt_family="(TATATG)n" FT repeat_region complement(5157262..5157618) FT /rpt_family="MaLR" FT repeat_region complement(5157153..5157247) FT /rpt_family="(TATATG)n" FT repeat_region complement(5156649..5157143) FT /rpt_family="L2" FT repeat_region complement(5156442..5156558) FT /rpt_family="L2" FT repeat_region complement(5155939..5156241) FT /rpt_family="Alu" FT repeat_region complement(5155208..5155882) FT /rpt_family="L1" FT repeat_region complement(5154738..5154784) FT /rpt_family="MIR" FT repeat_region complement(5154619..5154660) FT /rpt_family="MaLR" FT repeat_region complement(5154133..5154453) FT /rpt_family="ERVL" FT repeat_region complement(5154057..5154115) FT /rpt_family="MER1_type?" FT repeat_region complement(5153471..5153536) FT /rpt_family="MIR" FT repeat_region complement(5151945..5152422) FT /rpt_family="L1" FT repeat_region complement(5150870..5151924) FT /rpt_family="L1" FT repeat_region complement(5148428..5150809) FT /rpt_family="L1" FT repeat_region complement(5147853..5148426) FT /rpt_family="ERVL" FT repeat_region complement(5147405..5147786) FT /rpt_family="L1" FT repeat_region complement(5147085..5147403) FT /rpt_family="L1" FT repeat_region complement(5146565..5146725) FT /rpt_family="L2" FT repeat_region complement(5146504..5146561) FT /rpt_family="(TGGA)n" FT repeat_region complement(5145964..5146102) FT /rpt_family="MIR" FT repeat_region complement(5144879..5144922) FT /rpt_family="ERVL" FT repeat_region complement(5144817..5144878) FT /rpt_family="(CAGA)n" FT repeat_region complement(5144447..5144816) FT /rpt_family="ERVL" FT repeat_region complement(5143459..5143640) FT /rpt_family="MaLR" FT repeat_region complement(5142977..5143448) FT /rpt_family="L2" FT repeat_region complement(5142770..5142976) FT /rpt_family="MER1_type" FT repeat_region complement(5142510..5142769) FT /rpt_family="L2" FT repeat_region complement(5142241..5142365) FT /rpt_family="MIR" FT repeat_region complement(5140760..5140955) FT /rpt_family="L2" FT repeat_region complement(5140260..5140389) FT /rpt_family="L2" FT repeat_region complement(5140168..5140241) FT /rpt_family="L2" FT repeat_region complement(5139323..5139450) FT /rpt_family="MIR" FT repeat_region complement(5138239..5138344) FT /rpt_family="AcHobo" FT repeat_region complement(5137664..5137814) FT /rpt_family="MER1_type" FT repeat_region complement(5137300..5137631) FT /rpt_family="MaLR" FT repeat_region complement(5136927..5137108) FT /rpt_family="MIR" FT repeat_region complement(5135935..5136313) FT /rpt_family="MaLR" FT repeat_region complement(5135802..5135879) FT /rpt_family="MER1_type" FT repeat_region complement(5135592..5135690) FT /rpt_family="MIR" FT repeat_region complement(5135422..5135489) FT /rpt_family="MIR" FT repeat_region complement(5134825..5134978) FT /rpt_family="L2" FT repeat_region complement(5134525..5134824) FT /rpt_family="Alu" FT repeat_region complement(5134498..5134524) FT /rpt_family="L2" FT repeat_region complement(5134220..5134491) FT /rpt_family="MaLR" FT repeat_region complement(5134007..5134219) FT /rpt_family="L1" FT repeat_region complement(5133753..5134026) FT /rpt_family="L1" FT repeat_region complement(5133571..5133752) FT /rpt_family="MaLR" FT repeat_region complement(5133157..5133548) FT /rpt_family="L2" FT repeat_region complement(5131612..5132168) FT /rpt_family="L2" FT repeat_region complement(5131422..5131477) FT /rpt_family="MIR" FT repeat_region complement(5130955..5130975) FT /rpt_family="AT_rich" FT repeat_region complement(5129830..5130018) FT /rpt_family="MaLR" FT repeat_region complement(5129467..5129829) FT /rpt_family="MaLR" FT repeat_region complement(5129261..5129466) FT /rpt_family="MaLR" FT repeat_region complement(5127997..5128052) FT /rpt_family="GA-rich" FT repeat_region complement(5127678..5127949) FT /rpt_family="L1" FT repeat_region complement(5126648..5127080) FT /rpt_family="MaLR" FT repeat_region complement(5126402..5126469) FT /rpt_family="(CATA)n" FT repeat_region complement(5125649..5125740) FT /rpt_family="MIR" FT repeat_region complement(5125573..5125597) FT /rpt_family="(TGG)n" FT repeat_region complement(5125181..5125563) FT /rpt_family="MaLR" FT repeat_region complement(5124162..5124426) FT /rpt_family="(TGAG)n" FT repeat_region complement(5123977..5124153) FT /rpt_family="(TGAA)n" FT repeat_region complement(5123755..5123970) FT /rpt_family="(TGAG)n" FT repeat_region complement(5123093..5123185) FT /rpt_family="MIR" FT repeat_region complement(5122660..5123092) FT /rpt_family="L1" FT repeat_region complement(5122544..5122628) FT /rpt_family="(TTATA)n" FT repeat_region complement(5121662..5122358) FT /rpt_family="MER2_type" FT repeat_region complement(5120655..5120830) FT /rpt_family="MER1_type" FT repeat_region complement(5120132..5120537) FT /rpt_family="L2" FT repeat_region complement(5119537..5120131) FT /rpt_family="L1" FT repeat_region complement(5119158..5119377) FT /rpt_family="L1" FT repeat_region complement(5118252..5119138) FT /rpt_family="L1" FT repeat_region complement(5118105..5118251) FT /rpt_family="L1" FT repeat_region complement(5117962..5118102) FT /rpt_family="AcHobo" FT repeat_region complement(5117908..5117934) FT /rpt_family="(TG)n" FT repeat_region complement(5117590..5117701) FT /rpt_family="MIR" FT repeat_region complement(5115839..5116287) FT /rpt_family="L2" FT repeat_region complement(5115456..5115838) FT /rpt_family="MaLR" FT repeat_region complement(5115349..5115455) FT /rpt_family="L2" FT repeat_region complement(5115149..5115288) FT /rpt_family="MaLR" FT repeat_region complement(5114784..5115148) FT /rpt_family="MaLR" FT repeat_region complement(5114753..5114783) FT /rpt_family="MaLR" FT repeat_region complement(5114612..5114748) FT /rpt_family="L2" FT repeat_region complement(5113967..5114439) FT /rpt_family="ERVL" FT repeat_region complement(5113526..5113908) FT /rpt_family="ERVL" FT repeat_region complement(5111211..5113497) FT /rpt_family="L1" FT repeat_region complement(5111011..5111039) FT /rpt_family="(TGAA)n" FT repeat_region complement(5110889..5110973) FT /rpt_family="MIR" FT repeat_region complement(5110155..5110401) FT /rpt_family="L1" FT repeat_region complement(5109617..5110169) FT /rpt_family="L1" FT repeat_region complement(5109250..5109606) FT /rpt_family="L1" FT repeat_region complement(5108738..5109203) FT /rpt_family="MER1_type" FT repeat_region complement(5108267..5108647) FT /rpt_family="L1" FT repeat_region complement(5108175..5108265) FT /rpt_family="L1" FT repeat_region complement(5107748..5108035) FT /rpt_family="Alu" FT repeat_region complement(5107590..5107649) FT /rpt_family="L1" FT repeat_region complement(5107298..5107589) FT /rpt_family="Alu" FT repeat_region complement(5107072..5107297) FT /rpt_family="L1" FT repeat_region complement(5106915..5107060) FT /rpt_family="Alu" FT repeat_region complement(5106683..5106913) FT /rpt_family="L1" FT repeat_region complement(5106252..5106658) FT /rpt_family="L1" FT repeat_region complement(5106175..5106246) FT /rpt_family="L1" FT repeat_region complement(5105814..5106174) FT /rpt_family="MaLR" FT repeat_region complement(5105697..5105813) FT /rpt_family="L1" FT repeat_region complement(5105148..5105704) FT /rpt_family="L1" FT repeat_region complement(5104580..5104711) FT /rpt_family="GA-rich" FT repeat_region complement(5104281..5104569) FT /rpt_family="Alu" FT repeat_region complement(5104136..5104274) FT /rpt_family="(GGAA)n" FT repeat_region complement(5104013..5104098) FT /rpt_family="CR1" FT repeat_region complement(5103864..5103938) FT /rpt_family="MIR" FT repeat_region complement(5103081..5103153) FT /rpt_family="CT-rich" FT repeat_region complement(5102621..5102922) FT /rpt_family="Alu" FT repeat_region complement(5102422..5102609) FT /rpt_family="(GGAA)n" FT repeat_region complement(5102114..5102421) FT /rpt_family="GA-rich" FT repeat_region complement(5102039..5102084) FT /rpt_family="GA-rich" FT repeat_region complement(5101791..5101854) FT /rpt_family="MIR" FT repeat_region complement(5101571..5101790) FT /rpt_family="MER1_type" FT repeat_region complement(5101307..5101421) FT /rpt_family="L2" FT repeat_region complement(5101160..5101199) FT /rpt_family="(CA)n" FT repeat_region complement(5100643..5101090) FT /rpt_family="MaLR" FT repeat_region complement(5100268..5100438) FT /rpt_family="MIR" FT repeat_region complement(5099513..5099957) FT /rpt_family="MaLR" FT repeat_region complement(5098605..5098801) FT /rpt_family="MIR" FT repeat_region complement(5098035..5098056) FT /rpt_family="AT_rich" FT repeat_region complement(5097691..5097824) FT /rpt_family="L1" FT repeat_region complement(5097370..5097475) FT /rpt_family="L2" FT repeat_region complement(5097060..5097346) FT /rpt_family="Alu" FT repeat_region complement(5096637..5096762) FT /rpt_family="L2" FT repeat_region complement(5096387..5096577) FT /rpt_family="MER2_type" FT repeat_region complement(5096103..5096378) FT /rpt_family="Alu" FT repeat_region complement(5095449..5096099) FT /rpt_family="MER2_type" FT repeat_region complement(5095167..5095448) FT /rpt_family="L1" FT repeat_region complement(5094725..5095166) FT /rpt_family="MER2_type" FT repeat_region complement(5094289..5094618) FT /rpt_family="MaLR" FT repeat_region complement(5093977..5094288) FT /rpt_family="Alu" FT repeat_region complement(5093936..5093976) FT /rpt_family="MaLR" FT repeat_region complement(5092886..5093935) FT /rpt_family="L1" FT repeat_region complement(5092603..5092879) FT /rpt_family="L1" FT repeat_region complement(5092390..5092602) FT /rpt_family="L1" FT repeat_region complement(5092098..5092389) FT /rpt_family="Alu" FT repeat_region complement(5090937..5092097) FT /rpt_family="L1" FT repeat_region complement(5090496..5090936) FT /rpt_family="L1" FT repeat_region complement(5090256..5090488) FT /rpt_family="L1" FT repeat_region complement(5090063..5090255) FT /rpt_family="L1" FT repeat_region complement(5089984..5090066) FT /rpt_family="L1" FT repeat_region complement(5088143..5089986) FT /rpt_family="L1" FT repeat_region complement(5087328..5088155) FT /rpt_family="L1" FT repeat_region complement(5087057..5087186) FT /rpt_family="MER103" FT repeat_region complement(5086846..5087036) FT /rpt_family="MIR" FT repeat_region complement(5086495..5086518) FT /rpt_family="AT_rich" FT repeat_region complement(5086079..5086243) FT /rpt_family="L1" FT repeat_region complement(5085468..5085763) FT /rpt_family="Alu" FT repeat_region complement(5085145..5085295) FT /rpt_family="MIR" FT repeat_region complement(5084422..5084899) FT /rpt_family="L1" FT repeat_region complement(5082972..5084236) FT /rpt_family="L1" FT repeat_region complement(5082362..5082971) FT /rpt_family="L1" FT repeat_region complement(5081812..5082237) FT /rpt_family="L2" FT repeat_region complement(5081527..5081805) FT /rpt_family="L1" FT repeat_region complement(5081287..5081519) FT /rpt_family="L2" FT repeat_region complement(5080881..5081143) FT /rpt_family="L1" FT repeat_region complement(5079575..5080036) FT /rpt_family="MaLR" FT repeat_region complement(5079164..5079256) FT /rpt_family="MER1_type" FT repeat_region complement(5078801..5078921) FT /rpt_family="L2" FT repeat_region complement(5078018..5078254) FT /rpt_family="L1" FT repeat_region complement(5077626..5077717) FT /rpt_family="MaLR" FT repeat_region complement(5076663..5076834) FT /rpt_family="L1" FT repeat_region complement(5076421..5076488) FT /rpt_family="L1" FT repeat_region complement(5075948..5076331) FT /rpt_family="L1" FT repeat_region complement(5075916..5075947) FT /rpt_family="(CA)n" FT repeat_region complement(5074332..5075915) FT /rpt_family="L1" FT repeat_region complement(5073949..5074180) FT /rpt_family="L2" FT repeat_region complement(5072401..5072833) FT /rpt_family="AcHobo" FT repeat_region complement(5072230..5072427) FT /rpt_family="MaLR" FT repeat_region complement(5071506..5071718) FT /rpt_family="MIR" FT repeat_region complement(5071233..5071467) FT /rpt_family="MIR" FT repeat_region complement(5070913..5071020) FT /rpt_family="Alu" FT repeat_region complement(5070594..5070719) FT /rpt_family="L1" FT repeat_region complement(5070336..5070572) FT /rpt_family="MER1_type?" FT repeat_region complement(5070168..5070276) FT /rpt_family="MIR" FT repeat_region complement(5069917..5070165) FT /rpt_family="L1" FT repeat_region complement(5069861..5069916) FT /rpt_family="Mariner" FT repeat_region complement(5069807..5069850) FT /rpt_family="Mariner" FT repeat_region complement(5069787..5069805) FT /rpt_family="L1" FT repeat_region complement(5069399..5069786) FT /rpt_family="MaLR" FT repeat_region complement(5069367..5069398) FT /rpt_family="L1" FT repeat_region complement(5069084..5069188) FT /rpt_family="L2" FT repeat_region complement(5068718..5069083) FT /rpt_family="MaLR" FT repeat_region complement(5068448..5068542) FT /rpt_family="L2" FT repeat_region complement(5067752..5068331) FT /rpt_family="L2" FT repeat_region complement(5067456..5067750) FT /rpt_family="Alu" FT repeat_region complement(5067246..5067428) FT /rpt_family="ERVL" FT repeat_region complement(5066870..5067138) FT /rpt_family="ERVL" FT repeat_region complement(5066666..5066846) FT /rpt_family="L2" FT repeat_region complement(5066582..5066607) FT /rpt_family="AT_rich" FT repeat_region complement(5066073..5066581) FT /rpt_family="(TA)n" FT repeat_region complement(5065932..5066048) FT /rpt_family="(TA)n" FT repeat_region complement(5065541..5065921) FT /rpt_family="L1" FT repeat_region complement(5065340..5065532) FT /rpt_family="MER1_type" FT repeat_region complement(5065072..5065339) FT /rpt_family="Alu" FT repeat_region complement(5065026..5065071) FT /rpt_family="MER1_type" FT repeat_region complement(5064533..5064970) FT /rpt_family="L1" FT repeat_region complement(5064227..5064532) FT /rpt_family="Alu" FT repeat_region complement(5064092..5064226) FT /rpt_family="L1" FT repeat_region complement(5062362..5063098) FT /rpt_family="L1" FT repeat_region complement(5061993..5062318) FT /rpt_family="L1" FT repeat_region complement(5061707..5061992) FT /rpt_family="Alu" FT repeat_region complement(5061013..5061706) FT /rpt_family="L1" FT repeat_region complement(5060923..5060998) FT /rpt_family="MaLR" FT repeat_region complement(5060778..5060921) FT /rpt_family="Alu" FT repeat_region complement(5060505..5060777) FT /rpt_family="Alu" FT repeat_region complement(5060491..5060504) FT /rpt_family="Alu" FT repeat_region complement(5060452..5060490) FT /rpt_family="(TAAA)n" FT repeat_region complement(5060283..5060451) FT /rpt_family="Alu" FT repeat_region complement(5059947..5060259) FT /rpt_family="MaLR" FT repeat_region complement(5058719..5058860) FT /rpt_family="L2" FT repeat_region complement(5058219..5058652) FT /rpt_family="MaLR" FT repeat_region complement(5058178..5058205) FT /rpt_family="(TTCA)n" FT repeat_region complement(5058055..5058176) FT /rpt_family="L2" FT repeat_region complement(5057695..5058030) FT /rpt_family="MER1_type" FT repeat_region complement(5057070..5057675) FT /rpt_family="L2" FT repeat_region complement(5056840..5057039) FT /rpt_family="Alu" FT repeat_region complement(5056645..5056759) FT /rpt_family="Tc2" FT repeat_region complement(5056050..5056421) FT /rpt_family="L2" FT repeat_region complement(5055428..5055742) FT /rpt_family="Alu" FT repeat_region complement(5054316..5054454) FT /rpt_family="MIR" FT misc_feature complement(5052937..5054092) FT /note="CpG_island (%GC=68.3, o/e=0.90, #CpGs=120)" FT repeat_region complement(5053133..5053229) FT /rpt_family="GA-rich" FT repeat_region complement(5052650..5052732) FT /rpt_family="MIR" FT repeat_region complement(5052139..5052166) FT /rpt_family="(CAAAA)n" FT repeat_region complement(5051909..5052048) FT /rpt_family="MIR" FT repeat_region complement(5051627..5051794) FT /rpt_family="MIR" FT repeat_region complement(5051442..5051613) FT /rpt_family="Alu" FT repeat_region complement(5051081..5051441) FT /rpt_family="ERV1" FT repeat_region complement(5050916..5051069) FT /rpt_family="Alu" FT repeat_region complement(5050507..5050627) FT /rpt_family="MIR" FT repeat_region complement(5050324..5050454) FT /rpt_family="Alu" FT repeat_region complement(5050024..5050323) FT /rpt_family="Alu" FT repeat_region complement(5049849..5050023) FT /rpt_family="Alu" FT repeat_region complement(5049501..5049848) FT /rpt_family="MaLR" FT repeat_region complement(5049306..5049376) FT /rpt_family="L2" FT repeat_region complement(5047696..5049204) FT /rpt_family="L1" FT repeat_region complement(5047176..5047682) FT /rpt_family="L1" FT repeat_region complement(5046659..5047175) FT /rpt_family="L2" FT repeat_region complement(5046355..5046658) FT /rpt_family="Alu" FT repeat_region complement(5045882..5046354) FT /rpt_family="L2" FT repeat_region complement(5045736..5045829) FT /rpt_family="MIR" FT repeat_region complement(5045571..5045644) FT /rpt_family="L2" FT repeat_region complement(5045467..5045558) FT /rpt_family="MaLR" FT repeat_region complement(5044864..5044891) FT /rpt_family="MER2_type" FT repeat_region complement(5044552..5044863) FT /rpt_family="Alu" FT repeat_region complement(5044514..5044551) FT /rpt_family="MER2_type" FT repeat_region 5238093..5238715 FT /rpt_family="L1" FT repeat_region 5238905..5238990 FT /rpt_family="MaLR" FT repeat_region 5239190..5239278 FT /rpt_family="CR1" FT repeat_region 5239694..5239789 FT /rpt_family="MIR" FT repeat_region 5239820..5240289 FT /rpt_family="MaLR" FT repeat_region 5240310..5240438 FT /rpt_family="CR1" FT repeat_region 5240488..5241041 FT /rpt_family="L2" FT repeat_region 5241526..5241668 FT /rpt_family="L2" FT repeat_region 5241738..5241800 FT /rpt_family="CT-rich" FT repeat_region 5241802..5241931 FT /rpt_family="L1" FT repeat_region 5242066..5242181 FT /rpt_family="L1" FT repeat_region 5242182..5242486 FT /rpt_family="Alu" FT repeat_region 5242487..5242539 FT /rpt_family="L1" FT repeat_region 5242575..5242730 FT /rpt_family="L1" FT repeat_region 5242778..5242947 FT /rpt_family="L1" FT repeat_region 5243120..5243276 FT /rpt_family="L1" FT repeat_region 5243277..5243300 FT /rpt_family="(TTTTA)n" FT repeat_region 5249446..5249768 FT /rpt_family="L1" FT repeat_region 5249858..5249982 FT /rpt_family="MIR" FT repeat_region 5250370..5250814 FT /rpt_family="L1" FT repeat_region 5250484..5250814 FT /rpt_family="L1" FT repeat_region 5250803..5250823 FT /rpt_family="AT_rich" FT repeat_region 5251150..5251280 FT /rpt_family="(TTCC)n" FT repeat_region 5251484..5252034 FT /rpt_family="L1" FT repeat_region 5252035..5252057 FT /rpt_family="(T)n" FT repeat_region 5252340..5253555 FT /rpt_family="L1" FT repeat_region 5253312..5253332 FT /rpt_family="AT_rich" FT repeat_region 5254395..5254613 FT /rpt_family="MIR" FT repeat_region 5255096..5255400 FT /rpt_family="Alu" FT repeat_region 5255097..5255119 FT /rpt_family="(TTG)n" FT repeat_region 5255402..5255611 FT /rpt_family="L1" FT repeat_region 5255663..5255811 FT /rpt_family="Alu" FT repeat_region 5255817..5256466 FT /rpt_family="L1" FT repeat_region 5256685..5256841 FT /rpt_family="L2" FT repeat_region 5257142..5257166 FT /rpt_family="AT_rich" FT repeat_region 5257156..5257664 FT /rpt_family="L1" FT repeat_region 5257817..5257930 FT /rpt_family="MIR" FT misc_feature 5258118..5258401 FT /note="match to EST BE164492 (NID:g8627122)" FT repeat_region 5258566..5258683 FT /rpt_family="L2" FT repeat_region 5258661..5258938 FT /rpt_family="(TGAG)n" FT repeat_region 5258975..5259154 FT /rpt_family="(TGAG)n" FT repeat_region 5259180..5259373 FT /rpt_family="L2" FT repeat_region 5259386..5259698 FT /rpt_family="Alu" FT repeat_region 5259670..5259698 FT /rpt_family="(A)n" FT repeat_region 5259722..5259892 FT /rpt_family="MIR" FT repeat_region 5259972..5260144 FT /rpt_family="MIR" FT repeat_region 5260265..5261068 FT /rpt_family="L2" FT repeat_region 5261115..5261368 FT /rpt_family="MIR" FT repeat_region 5261493..5261717 FT /rpt_family="L2" FT repeat_region 5261788..5261838 FT /rpt_family="ERV1" FT repeat_region 5261794..5261843 FT /rpt_family="(CA)n" FT repeat_region 5262102..5262392 FT /rpt_family="L2" FT repeat_region 5262448..5262903 FT /rpt_family="ERVL" FT repeat_region 5262936..5263186 FT /rpt_family="L2" FT repeat_region 5263290..5263376 FT /rpt_family="MIR" FT repeat_region 5263461..5263518 FT /rpt_family="(TTA)n" FT repeat_region 5264073..5264367 FT /rpt_family="Alu" FT repeat_region 5264479..5264646 FT /rpt_family="L1" FT repeat_region 5265462..5266231 FT /rpt_family="L1" FT repeat_region 5266232..5266528 FT /rpt_family="Alu" FT repeat_region 5266529..5266932 FT /rpt_family="L1" FT repeat_region 5266933..5267138 FT /rpt_family="ERVL" FT misc_feature 5267115..5267442 FT /note="match to EST AW195183 (NID:g6474227) xn36a07.x1" FT repeat_region 5267512..5267812 FT /rpt_family="L1" FT repeat_region 5269255..5269367 FT /rpt_family="MIR" FT repeat_region 5269990..5270181 FT /rpt_family="L2" FT repeat_region 5270261..5270311 FT /rpt_family="(TG)n" FT repeat_region 5270373..5270447 FT /rpt_family="L2" FT repeat_region 5270511..5271193 FT /rpt_family="L1" FT repeat_region 5271213..5271488 FT /rpt_family="L1" FT repeat_region 5271478..5271851 FT /rpt_family="L1" FT repeat_region 5271852..5272298 FT /rpt_family="ERVL" FT repeat_region 5272299..5272685 FT /rpt_family="L1" FT repeat_region 5272686..5272962 FT /rpt_family="Alu" FT repeat_region 5272963..5273136 FT /rpt_family="L1" FT repeat_region 5274320..5275731 FT /rpt_family="L1" FT repeat_region 5275719..5275757 FT /rpt_family="(A)n" FT repeat_region 5275756..5276077 FT /rpt_family="L1" FT repeat_region 5276079..5276152 FT /rpt_family="L2" FT repeat_region 5276153..5276930 FT /rpt_family="ERV1" FT repeat_region 5276931..5276959 FT /rpt_family="L2" FT misc_feature 5277501..5278014 FT /note="match to EST AA613186 (NID:g2464224) no18h06.s1" FT repeat_region 5277734..5278032 FT /rpt_family="Alu" FT repeat_region 5278457..5278534 FT /rpt_family="MIR" FT repeat_region 5279618..5279664 FT /rpt_family="L2" FT repeat_region 5279866..5280374 FT /rpt_family="L1" FT repeat_region 5280397..5280771 FT /rpt_family="MaLR" FT repeat_region 5280772..5281900 FT /rpt_family="MaLR" FT repeat_region 5281936..5282298 FT /rpt_family="MaLR" FT repeat_region 5282301..5282339 FT /rpt_family="MaLR" FT repeat_region 5282340..5282648 FT /rpt_family="Alu" FT repeat_region 5282625..5282664 FT /rpt_family="(CAAAAA)n" FT repeat_region 5282649..5283013 FT /rpt_family="MaLR" FT repeat_region 5283044..5283344 FT /rpt_family="L1" FT repeat_region 5283323..5283372 FT /rpt_family="AT_rich" FT repeat_region 5283367..5283660 FT /rpt_family="L1" FT repeat_region 5283651..5283710 FT /rpt_family="AT_rich" FT repeat_region 5283700..5283855 FT /rpt_family="L1" FT repeat_region 5283865..5283968 FT /rpt_family="MER2_type" FT repeat_region 5283977..5284109 FT /rpt_family="MER2_type" FT repeat_region 5284123..5284688 FT /rpt_family="MER2_type" FT repeat_region 5284689..5285024 FT /rpt_family="L1" FT repeat_region 5285019..5286015 FT /rpt_family="L1" FT repeat_region 5286203..5286737 FT /rpt_family="MER2_type" FT repeat_region 5286791..5287044 FT /rpt_family="MER2_type" FT repeat_region 5287358..5287459 FT /rpt_family="L1" FT repeat_region 5287559..5287927 FT /rpt_family="MaLR" FT repeat_region 5288057..5288521 FT /rpt_family="L1" FT repeat_region 5288522..5288542 FT /rpt_family="(T)n" FT repeat_region 5288822..5289181 FT /rpt_family="L1" FT repeat_region 5289105..5289126 FT /rpt_family="AT_rich" FT repeat_region 5289363..5289468 FT /rpt_family="L1" FT repeat_region 5289479..5290728 FT /rpt_family="L1" FT repeat_region 5290729..5291187 FT /rpt_family="MER2_type" FT repeat_region 5291057..5291089 FT /rpt_family="(TGAG)n" FT repeat_region 5291167..5291212 FT /rpt_family="Alu" FT repeat_region 5291215..5291236 FT /rpt_family="AT_rich" FT repeat_region 5291224..5291312 FT /rpt_family="L1" FT repeat_region 5291315..5291571 FT /rpt_family="Alu" FT repeat_region 5291413..5291442 FT /rpt_family="(T)n" FT repeat_region 5291580..5291865 FT /rpt_family="L1" FT repeat_region 5291876..5291917 FT /rpt_family="L1" FT repeat_region 5291918..5292224 FT /rpt_family="MER2_type" FT repeat_region 5291986..5292025 FT /rpt_family="AT_rich" FT repeat_region 5292212..5292315 FT /rpt_family="MER2_type" FT repeat_region 5292317..5292351 FT /rpt_family="AT_rich" FT repeat_region 5292369..5292415 FT /rpt_family="L1" FT repeat_region 5292421..5292670 FT /rpt_family="L1" FT repeat_region 5292737..5293581 FT /rpt_family="L1" FT repeat_region 5293506..5293538 FT /rpt_family="(TTTG)n" FT repeat_region 5293585..5293716 FT /rpt_family="L1" FT repeat_region 5293717..5294498 FT /rpt_family="L1" FT repeat_region 5301121..5301493 FT /rpt_family="L1" FT repeat_region 5301497..5302671 FT /rpt_family="L1" FT repeat_region 5302682..5303631 FT /rpt_family="L1" FT repeat_region 5303138..5303162 FT /rpt_family="AT_rich" FT repeat_region 5303379..5303405 FT /rpt_family="(T)n" FT repeat_region 5303612..5303873 FT /rpt_family="L1" FT repeat_region 5303899..5304022 FT /rpt_family="L1" FT repeat_region 5304006..5304311 FT /rpt_family="L1" FT repeat_region 5304045..5304087 FT /rpt_family="AT_rich" FT repeat_region 5304332..5304353 FT /rpt_family="AT_rich" FT repeat_region 5304336..5304702 FT /rpt_family="L1" FT repeat_region 5304693..5304780 FT /rpt_family="(TG)n" FT repeat_region 5304704..5304772 FT /rpt_family="ERV1" FT repeat_region 5309940..5310135 FT /rpt_family="L1" FT repeat_region 5310141..5310246 FT /rpt_family="MIR" FT repeat_region 5310334..5310461 FT /rpt_family="L2" FT repeat_region 5310470..5311610 FT /rpt_family="L1" FT repeat_region 5311611..5311911 FT /rpt_family="Alu" FT repeat_region 5311912..5313105 FT /rpt_family="L1" FT repeat_region 5313106..5313628 FT /rpt_family="L1" FT repeat_region 5313627..5313671 FT /rpt_family="AT_rich" FT repeat_region 5313866..5313984 FT /rpt_family="L1" FT repeat_region 5313985..5314006 FT /rpt_family="AT_rich" FT repeat_region 5314013..5314680 FT /rpt_family="L1" FT repeat_region 5314683..5314808 FT /rpt_family="L1" FT repeat_region 5314809..5314869 FT /rpt_family="Mariner" FT repeat_region 5314870..5315377 FT /rpt_family="L1" FT repeat_region 5315315..5315357 FT /rpt_family="AT_rich" FT repeat_region 5315463..5316114 FT /rpt_family="L1" FT repeat_region 5316115..5316406 FT /rpt_family="Alu" FT repeat_region 5316407..5316482 FT /rpt_family="L1" FT repeat_region 5316571..5316607 FT /rpt_family="AT_rich" FT repeat_region 5316634..5317058 FT /rpt_family="L1" FT repeat_region 5317139..5317212 FT /rpt_family="MIR" FT repeat_region 5317391..5317424 FT /rpt_family="(T)n" FT repeat_region 5317395..5317730 FT /rpt_family="Alu" FT repeat_region 5317834..5317855 FT /rpt_family="AT_rich" FT repeat_region 5317861..5318037 FT /rpt_family="(TA)n" FT repeat_region 5318041..5318076 FT /rpt_family="AT_rich" FT repeat_region 5318078..5318672 FT /rpt_family="(TA)n" FT repeat_region 5318678..5318860 FT /rpt_family="(TATAA)n" FT repeat_region 5318863..5319286 FT /rpt_family="(TA)n" FT repeat_region 5319598..5319779 FT /rpt_family="MER1_type" FT repeat_region 5319813..5319846 FT /rpt_family="(TG)n" FT repeat_region 5319892..5320331 FT /rpt_family="L2" FT repeat_region 5320353..5320458 FT /rpt_family="L2" FT repeat_region 5320533..5320830 FT /rpt_family="Alu" FT repeat_region 5320831..5320977 FT /rpt_family="MIR" FT repeat_region 5321064..5321377 FT /rpt_family="L2" FT repeat_region 5321406..5321599 FT /rpt_family="ERVL" FT repeat_region 5321655..5321750 FT /rpt_family="ERVL" FT repeat_region 5321904..5322014 FT /rpt_family="L2" FT repeat_region 5322107..5322179 FT /rpt_family="Mariner" FT repeat_region 5322837..5322966 FT /rpt_family="MIR" FT misc_feature 5323740..5323748 FT /note="match to EST AW195183 (NID:g6474227) xn36a07.x1" FT repeat_region 5323780..5323901 FT /rpt_family="Alu" FT repeat_region 5324701..5324791 FT /rpt_family="MIR" FT repeat_region 5325453..5325554 FT /rpt_family="L2" FT repeat_region 5325609..5325798 FT /rpt_family="MIR" FT repeat_region 5325799..5326100 FT /rpt_family="Alu" FT repeat_region 5326101..5326163 FT /rpt_family="MIR" FT repeat_region 5326174..5326225 FT /rpt_family="L2" FT repeat_region 5326242..5326451 FT /rpt_family="MER1_type" FT repeat_region 5327324..5327350 FT /rpt_family="AT_rich" FT repeat_region 5328070..5328263 FT /rpt_family="MaLR" FT repeat_region 5330654..5330711 FT /rpt_family="Alu" FT repeat_region 5331293..5331459 FT /rpt_family="L2" FT repeat_region 5331781..5331953 FT /rpt_family="MIR" FT repeat_region 5332141..5332491 FT /rpt_family="MaLR" FT repeat_region 5332805..5332929 FT /rpt_family="MIR" FT misc_feature 5332935..5333120 FT /note="match to EST AA960957 (NID:g3127511) on92e04.s1" FT misc_feature 5332942..5333120 FT /note="match to EST BE893061 (NID:g10354042)" FT repeat_region 5333195..5333299 FT /rpt_family="MER1_type?" FT repeat_region 5333857..5334208 FT /rpt_family="L1" FT repeat_region 5334203..5334238 FT /rpt_family="T-rich" FT repeat_region 5337670..5338092 FT /rpt_family="L1" FT repeat_region 5338100..5338695 FT /rpt_family="L1" FT repeat_region 5338696..5338722 FT /rpt_family="(TTTTTG)n" FT repeat_region 5339049..5339957 FT /rpt_family="L1" FT repeat_region 5340069..5340121 FT /rpt_family="MIR" FT repeat_region 5340566..5341074 FT /rpt_family="ERVL" FT misc_feature 5341134..5341580 FT /note="match to EST AA972684 (NID:g3147864) op91b11.s1" FT repeat_region 5341319..5341370 FT /rpt_family="Mariner" FT repeat_region 5341396..5341581 FT /rpt_family="MIR" FT repeat_region 5341620..5341822 FT /rpt_family="Mariner" FT repeat_region 5342476..5342614 FT /rpt_family="(CATATA)n" FT repeat_region 5342602..5342783 FT /rpt_family="MIR" FT repeat_region 5342871..5343003 FT /rpt_family="MIR" FT repeat_region 5343324..5343576 FT /rpt_family="MaLR" FT repeat_region 5343577..5343757 FT /rpt_family="L1" FT repeat_region 5343760..5344238 FT /rpt_family="L1" FT repeat_region 5344239..5344435 FT /rpt_family="MaLR" FT repeat_region 5344441..5344562 FT /rpt_family="L2" FT repeat_region 5344677..5345296 FT /rpt_family="L1" FT repeat_region 5345297..5345519 FT /rpt_family="L1" FT repeat_region 5346566..5346751 FT /rpt_family="Alu" FT repeat_region 5346761..5346787 FT /rpt_family="AT_rich" FT misc_feature 5347055..5347181 FT /note="match to EST AA960957 (NID:g3127511) on92e04.s1" FT repeat_region 5347246..5347409 FT /rpt_family="MIR" FT repeat_region 5348361..5348483 FT /rpt_family="MIR" FT repeat_region 5348491..5348868 FT /rpt_family="MaLR" FT repeat_region 5349088..5349273 FT /rpt_family="MaLR" FT repeat_region 5349330..5349703 FT /rpt_family="MaLR" FT repeat_region 5352800..5352820 FT /rpt_family="(CAA)n" FT misc_feature 5354343..5354358 FT /note="match to EST AA972684 (NID:g3147864) op91b11.s1" FT repeat_region 5355271..5355295 FT /rpt_family="AT_rich" FT repeat_region 5356008..5356290 FT /rpt_family="Alu" FT repeat_region 5356550..5356594 FT /rpt_family="AT_rich" FT repeat_region 5356608..5356877 FT /rpt_family="MaLR" FT repeat_region 5356881..5356966 FT /rpt_family="MIR" FT repeat_region 5357267..5357491 FT /rpt_family="MER1_type" FT repeat_region 5357920..5358194 FT /rpt_family="MaLR" FT repeat_region 5358443..5358725 FT /rpt_family="Alu" FT repeat_region 5358740..5358861 FT /rpt_family="ERV1" FT repeat_region 5358750..5358853 FT /rpt_family="(CA)n" FT repeat_region 5360412..5360468 FT /rpt_family="(CA)n" FT repeat_region 5361028..5361144 FT /rpt_family="(TCCA)n" FT repeat_region 5361163..5361778 FT /rpt_family="L2" FT repeat_region 5362379..5362561 FT /rpt_family="Alu" FT repeat_region 5362569..5363105 FT /rpt_family="L1" FT repeat_region 5363091..5363129 FT /rpt_family="(TTTTTA)n" FT repeat_region 5363134..5363337 FT /rpt_family="Alu" FT repeat_region 5364177..5364544 FT /rpt_family="ERVL" FT repeat_region 5364846..5364884 FT /rpt_family="L2" FT repeat_region 5365752..5365900 FT /rpt_family="L2" FT repeat_region 5366102..5366346 FT /rpt_family="MaLR" FT repeat_region 5366589..5366620 FT /rpt_family="AT_rich" FT repeat_region 5366620..5366902 FT /rpt_family="Alu" FT repeat_region 5367012..5367123 FT /rpt_family="L2" FT repeat_region 5368124..5368228 FT /rpt_family="MIR" FT repeat_region 5368541..5368775 FT /rpt_family="MIR" FT repeat_region 5369913..5370038 FT /rpt_family="MIR" FT repeat_region 5370039..5370119 FT /rpt_family="MIR" FT repeat_region 5370120..5370200 FT /rpt_family="MIR" FT repeat_region 5370201..5370327 FT /rpt_family="MIR" FT repeat_region 5370644..5371103 FT /rpt_family="MaLR" FT repeat_region 5371591..5371900 FT /rpt_family="Alu" FT repeat_region 5371963..5372070 FT /rpt_family="L2" FT repeat_region 5372303..5372405 FT /rpt_family="MIR" FT repeat_region 5372405..5372432 FT /rpt_family="AT_rich" FT repeat_region 5372415..5372437 FT /rpt_family="L1" FT repeat_region 5372438..5372698 FT /rpt_family="Alu" FT repeat_region 5372530..5372553 FT /rpt_family="AT_rich" FT repeat_region 5372699..5372773 FT /rpt_family="L1" FT repeat_region 5372701..5372790 FT /rpt_family="(TA)n" FT repeat_region 5372788..5373244 FT /rpt_family="ERV1" FT repeat_region 5373368..5373571 FT /rpt_family="MER1_type" FT repeat_region 5374922..5375355 FT /rpt_family="ERVL" FT repeat_region 5375625..5375999 FT /rpt_family="MaLR" FT repeat_region 5376003..5376181 FT /rpt_family="MER1_type?" FT repeat_region 5376182..5376538 FT /rpt_family="MaLR" FT repeat_region 5376539..5376755 FT /rpt_family="MER1_type?" FT repeat_region 5377079..5377539 FT /rpt_family="L1" FT repeat_region 5378114..5378167 FT /rpt_family="CT-rich" FT repeat_region 5379172..5379284 FT /rpt_family="MER1_type?" FT repeat_region 5379285..5379654 FT /rpt_family="MaLR" FT repeat_region 5379655..5379922 FT /rpt_family="MER1_type?" FT repeat_region 5380026..5380143 FT /rpt_family="MER1_type" FT repeat_region 5380334..5380435 FT /rpt_family="L1" FT repeat_region 5380907..5380935 FT /rpt_family="MIR" FT repeat_region 5381221..5381597 FT /rpt_family="MaLR" FT repeat_region 5382361..5382502 FT /rpt_family="AcHobo" FT repeat_region 5382516..5382621 FT /rpt_family="MIR" FT repeat_region 5382749..5382898 FT /rpt_family="L2" FT repeat_region 5382999..5383093 FT /rpt_family="MIR" FT repeat_region 5383487..5383549 FT /rpt_family="MIR" FT repeat_region 5383550..5383984 FT /rpt_family="ERVL" FT repeat_region 5383602..5383631 FT /rpt_family="(GGAA)n" FT repeat_region 5383985..5384141 FT /rpt_family="MIR" FT repeat_region 5384464..5384677 FT /rpt_family="MIR" FT repeat_region 5385503..5385981 FT /rpt_family="L2" FT repeat_region 5386035..5386123 FT /rpt_family="L2" FT repeat_region 5386110..5386933 FT /rpt_family="L2" FT repeat_region 5387505..5387791 FT /rpt_family="C-rich" FT repeat_region 5388161..5388331 FT /rpt_family="MIR" FT misc_feature 5388213..5388276 FT /note="match to EST AA757216 (NID:g2805079) ah56f04.s1" FT repeat_region 5388378..5388541 FT /rpt_family="MIR" FT misc_feature 5388451..5388914 FT /note="match to EST AA757216 (NID:g2805079) ah56f04.s1" FT gene complement(5564147..5687206) FT /gene="EVC2" FT mRNA complement(join(5564147..5564842,5566985..5567086, FT 5570171..5570367,5576412..5576499,5577967..5578181, FT 5586350..5586577,5617149..5617271,5620205..5620409, FT 5624264..5624718,5627476..5627635,5630286..5630461, FT 5633520..5633759,5642241..5642565,5664834..5664973, FT 5667242..5667376,5682987..5683040,5687097..5687206)) FT /gene="EVC2" FT CDS complement(join(5564575..5564842,5566985..5567086, FT 5570171..5570367,5576412..5576499,5577967..5578181, FT 5586350..5586577,5617149..5617271,5620205..5620409, FT 5624264..5624718,5627476..5627635,5630286..5630461, FT 5633520..5633759,5642241..5642565,5664834..5664973, FT 5667242..5667376,5682987..5683040,5687097..>5687206)) FT /codon_start=3 FT /gene="EVC2" FT /product="unknown" FT /note="Homo sapiens Ellis van Creveld syndrome 2 (limbin) FT (EVC2), mRNA.; H_MS2192M01.1 This gene was based on FT gi(31377586) Continued from H_FH0900I15.1" FT /protein_id="AAY41034.1" FT /translation="GDAFAVSYAATLQAGDLGNGESLKLPAQLTFQSSSRNRTQLKVLF FT SITAEENVTVLPHHGLHAAGFFIAFLLSLVLTWAALFLMVRYQCLKGNMLTRHRVWQYE FT SKLEPLPFTSADGVNEDLSLNDQMIDILSSEDPGSMLQALEELEIATLNRADADLEACR FT TQISKDIIALLLKNLTSSGHLSPQVERKMSAVFKKQFLLLENEIQEEYDRKMVALTAEC FT DLETRKKMENQYQREMMAMEEAEELLKRAGERSAVECSNLLRTLHGLEQEHLRKSLALQ FT QEEDFAKAHRQLAVFQRNELHSIFFTQIKSAIFKGELKPEAAKMLLQNYSKIQENVEEL FT MDFFQASKRYHLSKRFGHREYLVQNLQSSETRVQGLLSTAAAQLTHLIQKHERAGYLDE FT DQMEMLLERAQTEVFSIKQKLDNDLKQEKKKLHQKLITKRRRELLQKHREQRREQASVG FT EAFRTVEDAGQYLHQKRSLMEEHGATLEELQERLDQAALDDLRTLTLSLFEKATDELRR FT LQNSAMTQELLKRGVPWLFLQQILEEHGKEMAARAEQLEGEERDRDQEGVQSVRQRLKD FT DAPEAVTEEQAELRRWEHLIFMKLCSSVFSLSEEELLRMRQEVHGCFAQMDRSLALPKI FT RARVLLQQFQTAWREAEFVKLDQAVAAPELQQQSKVRKSRSKSKSKGELLKKCIEDKIH FT LCEEQASEDLVEKVRGELLRERVQRMEAQEGGFAQSLVALQFQKASRVTETLSAYTALL FT SIQDLLLEELSASEMLTKSACTQILESHSRELQELERKLEDQLVQQEAAQQQQALASWQ FT QWVADGPGILNEPGEVDSERQVSTVLHQALSKSQTLLEQHQQCLREEQQNSVVLEDLLE FT NMEADTFATLCSQELRLASYLARMAMVPGATLRRLLSVVLPTASQPQLLALLDSATERH FT VDHAAESDGGAEQADVGRRRKHQSWWQALDGKLRGDLISRGLEKMLWARKRKQSILKKT FT CLPLRERMIFSGKGSWPHLSLEPIGELAPVPIVGAETIDLLNTGEKLFIFRNPKEPEIS FT LHVPPRKKKNFLNAKKAMRALGMD" FT misc_feature 5570136..5570351 FT /note="CpG_island (%GC=70.4, o/e=0.64, #CpGs=18)" FT gene complement(5690884..5711275) FT /gene="EVC2" FT mRNA complement(join(5690884..5691070,5692992..5693060, FT 5696062..5696228,5699320..5699374,5710556..5711275)) FT /gene="EVC2" FT CDS complement(join(<5690884..5691070,5692992..5693060, FT 5696062..5696228,5699320..5699362)) FT /codon_start=1 FT /gene="EVC2" FT /product="unknown" FT /note="Homo sapiens Ellis van Creveld syndrome 2 (limbin) FT (EVC2), mRNA.; H_FH0900I15.1 This gene was based on FT gi(31377586) Continues as H_MS2192M01.1" FT /protein_id="AAY41048.1" FT /translation="MIWPKVECCHFKTAVEAPLGMKLDKKMEVFIPLSTSAASSGPWAH FT SLFAFIPSWPKKNLFKRESPITHRLYGDISREVQGTSENGVIFQKCALVSGSSEAQTAR FT IWLLVNNTKTTSSANLSELLLLDSIAGLTIWDSVGNRTSEGFQAFSKKFLQ" FT misc_feature 5694316..5694596 FT /note="CpG_island (%GC=62.3, o/e=0.83, #CpGs=24)" FT misc_feature 5709679..5710679 FT /note="CpG_island (%GC=67.5, o/e=0.84, #CpGs=87)" FT unsure 5710646..5710740 FT /note="Sequence derived from one plasmid subclone." FT misc_feature 5712805..5713451 FT /note="CpG_island (%GC=76.4, o/e=0.75, #CpGs=80)" FT gene 5712924..5731117 FT /gene="EVC" FT mRNA join(5712924..5713281,5720975..5721100,5731034..5731117) FT /gene="EVC" FT CDS join(5713108..5713281,5720975..5721100,5731034..>5731117) FT /codon_start=1 FT /gene="EVC" FT /product="unknown" FT /note="Homo sapiens Ellis van Creveld syndrome (EVC), FT transcript variant 1, mRNA.; H_FH0900I15.2 This gene was FT based on gi(24497529) Continues as H_NH0069D13.1" FT /protein_id="AAY41049.1" FT /translation="MARGGAACKSDARLLLGRDALRPAPALLAPAVLLGAALGLGLGLW FT LGCRAGRQRTRHQKDDTQNLLKNLESNAQTPSETGSPSRRRKREVQMSKDKEAVDECEP FT PSNSNITAFALKAKVIYPINQKFR" FT gene 5733152..5830784 FT /gene="EVC" FT mRNA join(5733152..5733384,5735078..5735162,5743443..5743541, FT 5746931..5747068,5749875..5750033,5754563..5754779, FT 5755512..5755660,5757991..5758089,5785279..5785491, FT 5795335..5795444,5798749..5798959,5800313..5800519, FT 5803677..5803821,5806457..5806568,5809928..5810054, FT 5811245..5811338,5812066..5812177,5812680..5815889, FT 5819938..5819981,5825344..5825547,5830246..5830784) FT /gene="EVC" FT CDS join(<5733152..5733384,5735078..5735162,5743443..5743541, FT 5746931..5747068,5749875..5750033,5754563..5754779, FT 5755512..5755660,5757991..5758089,5785279..5785491, FT 5795335..5795444,5798749..5798959,5800313..5800519, FT 5803677..5803821,5806457..5806568,5809928..5810054, FT 5811245..5811338,5812066..5812177,5812680..5812764) FT /codon_start=1 FT /gene="EVC" FT /product="unknown" FT /note="Homo sapiens Ellis van Creveld syndrome (EVC), FT transcript variant 1, mRNA.; H_NH0069D13.1 This gene was FT based on gi(24497529) Continued from H_FH0900I15.2" FT /protein_id="AAY40958.1" FT /translation="PLADGSSNPSLHENLKQAVLPHQPVEASPSSSLGSLSQGEKDDCS FT SSSSVHSATSDDRFLSRTFLRVNAFPEVLACESVDVDLCIYSLHLKDLLHLDTALRQEK FT HMMFIQIFKMCLLDLLPKKKSDDELYQKILSKQEKDLEELEKGLQVKLSNTEMSGAGDS FT EYITLADVEKKEREYSEQLIDNMEAFWKQMANIQHFLVDQFKCSSSKARQLMMTLTERM FT IAAEGLLCDSQELQALDALERTMGRAHMAKVIEFLKLQVQEETRCRLAAISHGLELLAG FT EGKLSGRQKEELLTQQHKAFWQEAERFSREFVQRGKDLVTASLAHQVEGTAKLTLAQEE FT EQRSFLAEAQPTADPEKFLEAFHEVLERQRLMQCDLEEEENVRATEAVVALCQELYFST FT VDTFQKFVDALFLQTLPGMTGLPPEECDYLRQEVQENAAWQLGKSNRFRRQQWKLFQEL FT LEQDQQVWMEECALSSVLQTHLREDHEGTIRGVLGRLGGLTEESTRCVLQGHDLLLRSA FT LRRLALRGNALATLTQMRLSGKKHLLQELREQRALEQGSSQCLDEHQWQLLRALEARVL FT EEASRLEEEAQQTRLQLQQRLLAEAQEVGQLLQQHMECAIGQALLVHARNAATKSRAKD FT RDDFKRTLMEAAVESVYVTSAGVSRLVQAYYQQIGRIMEDHEERKLQHLKTLQGERMEN FT YKLRKKQELSNPSSGSRTAGGAHETSQAVHQRMLSQQKRFLAQFPVHQQMRLHAQQQQA FT GVMDLLEAQLETQLQEAEQNFISELAALARVPLAESKLLPAKRGLLEKPLRTKRKKPLP FT QERGDLGVPNNEDLASGDQTSGSLSSKRLSQQESEAGDSGNSKKMLKRRSNL" FT gene complement(5822510..5890208) FT /gene="CRMP1" FT mRNA complement(join(5822510..5823578,5827221..5827386, FT 5830216..5830395,5837642..5837812,5838492..5838633, FT 5841249..5841405,5843035..5843155,5844820..5844888, FT 5851119..5851199,5853135..5853196,5857870..5858034, FT 5862753..5862937,5868395..5868483,5889955..5890208)) FT /gene="CRMP1" FT CDS complement(join(5823487..5823578,5827221..5827386, FT 5830216..5830395,5837642..5837812,5838492..5838633, FT 5841249..5841405,5843035..5843155,5844820..5844888, FT 5851119..5851199,5853135..5853196,5857870..5858034, FT 5862753..5862937,5868395..5868483,5889955..5889993)) FT /codon_start=1 FT /gene="CRMP1" FT /product="unknown" FT /note="Homo sapiens collapsin response mediator protein 1 FT (CRMP1), mRNA.; H_NH0069D13.2 This gene was based on FT gi(21359849)" FT /protein_id="AAY40959.1" FT /translation="MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQI FT GENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMI FT IDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNS FT FQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEG FT HALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAA FT SLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQ FT KAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKG FT RIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGN FT INVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAP FT SAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG" FT misc_feature 5834916..5835189 FT /note="CpG_island (%GC=62.4, o/e=0.92, #CpGs=24)" FT misc_feature 5889204..5890645 FT /note="CpG_island (%GC=72.4, o/e=0.86, #CpGs=145)" FT misc_feature 5891982..5892767 FT /note="CpG_island (%GC=66.3, o/e=0.64, #CpGs=58)" FT misc_feature 5894072..5895116 FT /note="CpG_island (%GC=79.1, o/e=0.94, #CpGs=163)" FT repeat_region 5909183..5909382 FT /rpt_family="L1" FT repeat_region 5909395..5909614 FT /rpt_family="L2" FT repeat_region 5909626..5909756 FT /rpt_family="CR1" FT repeat_region 5909757..5909790 FT /rpt_family="(TTCA)n" FT repeat_region 5909804..5910023 FT /rpt_family="L2" FT repeat_region 5910220..5910260 FT /rpt_family="L2" FT repeat_region 5910652..5910971 FT /rpt_family="L2" FT repeat_region 5911054..5911847 FT /rpt_family="L1" FT repeat_region 5912627..5912935 FT /rpt_family="Alu" FT repeat_region 5912977..5913119 FT /rpt_family="CR1" FT repeat_region 5913420..5913472 FT /rpt_family="MER1_type" FT repeat_region 5913498..5913801 FT /rpt_family="Alu" FT repeat_region 5913822..5913977 FT /rpt_family="MER1_type" FT repeat_region 5913984..5914021 FT /rpt_family="(TG)n" FT repeat_region 5914045..5914074 FT /rpt_family="(TGAA)n" FT repeat_region 5914278..5914845 FT /rpt_family="ERVL" FT repeat_region 5914852..5914956 FT /rpt_family="MIR" FT repeat_region 5915052..5915109 FT /rpt_family="L2" FT repeat_region 5915566..5915694 FT /rpt_family="L1" FT repeat_region 5915743..5915932 FT /rpt_family="L1" FT repeat_region 5915933..5916230 FT /rpt_family="Alu" FT repeat_region 5916231..5916304 FT /rpt_family="L1" FT repeat_region 5916806..5916880 FT /rpt_family="L2" FT repeat_region 5917277..5917525 FT /rpt_family="MaLR" FT repeat_region 5918302..5918435 FT /rpt_family="ERVL" FT repeat_region 5918859..5918927 FT /rpt_family="MIR" FT repeat_region 5919130..5919429 FT /rpt_family="Alu" FT repeat_region 5920006..5920135 FT /rpt_family="MIR" FT repeat_region 5920517..5920692 FT /rpt_family="MER1_type" FT repeat_region 5920714..5920760 FT /rpt_family="MIR" FT repeat_region 5921578..5921916 FT /rpt_family="MER2_type" FT repeat_region 5921938..5922159 FT /rpt_family="MIR" FT repeat_region 5922203..5922502 FT /rpt_family="Alu" FT repeat_region 5924173..5924249 FT /rpt_family="L2" FT repeat_region 5924851..5925022 FT /rpt_family="MIR" FT repeat_region 5925465..5926012 FT /rpt_family="ERVL" FT repeat_region 5926485..5926559 FT /rpt_family="L2" FT repeat_region 5927882..5928352 FT /rpt_family="L1" FT repeat_region 5928596..5928726 FT /rpt_family="L2" FT repeat_region 5929000..5929166 FT /rpt_family="L2" FT repeat_region 5929167..5929554 FT /rpt_family="MaLR" FT repeat_region 5929555..5929608 FT /rpt_family="L2" FT repeat_region 5930072..5930126 FT /rpt_family="(CA)n" FT repeat_region 5930708..5930803 FT /rpt_family="L2" FT repeat_region 5930816..5930916 FT /rpt_family="L1" FT repeat_region 5931914..5931991 FT /rpt_family="MIR" FT repeat_region 5932493..5932586 FT /rpt_family="L2" FT repeat_region 5933187..5933303 FT /rpt_family="MIR" FT repeat_region 5934207..5934464 FT /rpt_family="Alu" FT repeat_region 5934531..5934668 FT /rpt_family="MIR" FT repeat_region 5935614..5935718 FT /rpt_family="GA-rich" FT repeat_region 5935831..5935951 FT /rpt_family="MIR" FT repeat_region 5936094..5936327 FT /rpt_family="L2" FT repeat_region 5936586..5936817 FT /rpt_family="MIR" FT repeat_region 5936989..5937162 FT /rpt_family="L1" FT repeat_region 5937205..5937232 FT /rpt_family="L1" FT repeat_region 5937233..5937537 FT /rpt_family="Alu" FT repeat_region 5937538..5937672 FT /rpt_family="L1" FT repeat_region 5937701..5937930 FT /rpt_family="MIR" FT repeat_region 5937931..5938010 FT /rpt_family="L1" FT repeat_region 5938011..5938316 FT /rpt_family="Alu" FT repeat_region 5938317..5938858 FT /rpt_family="L1" FT repeat_region 5939062..5939259 FT /rpt_family="L1" FT repeat_region 5939308..5940082 FT /rpt_family="L1" FT repeat_region 5940275..5940375 FT /rpt_family="MIR" FT repeat_region 5940509..5940534 FT /rpt_family="(T)n" FT repeat_region 5940687..5940999 FT /rpt_family="Alu" FT repeat_region 5941593..5942018 FT /rpt_family="ERV1" FT repeat_region 5942311..5942853 FT /rpt_family="MaLR" FT repeat_region 5942893..5943141 FT /rpt_family="MIR" FT repeat_region 5943276..5943428 FT /rpt_family="L2" FT repeat_region 5943455..5943510 FT /rpt_family="MIR" FT repeat_region 5944009..5944237 FT /rpt_family="MIR" FT repeat_region 5944284..5944501 FT /rpt_family="MIR" FT repeat_region 5944584..5944731 FT /rpt_family="L1" FT repeat_region 5945209..5945368 FT /rpt_family="MIR" FT repeat_region 5946663..5946760 FT /rpt_family="MIR" FT repeat_region 5947305..5947372 FT /rpt_family="MIR" FT repeat_region 5947597..5947802 FT /rpt_family="ERVL" FT repeat_region 5948112..5948669 FT /rpt_family="ERV1" FT repeat_region 5949981..5950109 FT /rpt_family="L1" FT repeat_region 5950110..5950241 FT /rpt_family="Alu" FT repeat_region 5950242..5950538 FT /rpt_family="Alu" FT repeat_region 5950539..5950716 FT /rpt_family="Alu" FT repeat_region 5950717..5951015 FT /rpt_family="L1" FT repeat_region 5951018..5951431 FT /rpt_family="L1" FT repeat_region 5951432..5951733 FT /rpt_family="Alu" FT repeat_region 5951734..5951763 FT /rpt_family="L1" FT repeat_region 5951764..5951852 FT /rpt_family="Mariner" FT repeat_region 5951853..5951883 FT /rpt_family="L1" FT repeat_region 5951884..5952271 FT /rpt_family="L1" FT repeat_region 5952277..5952315 FT /rpt_family="MIR" FT repeat_region 5952522..5952587 FT /rpt_family="L2" FT repeat_region 5952596..5952643 FT /rpt_family="(TGAA)n" FT repeat_region 5953110..5953207 FT /rpt_family="MIR" FT repeat_region 5953807..5953887 FT /rpt_family="L2" FT repeat_region 5953958..5954012 FT /rpt_family="(TAGA)n" FT repeat_region 5954932..5955051 FT /rpt_family="MaLR" FT repeat_region 5955072..5955122 FT /rpt_family="MIR" FT repeat_region 5955523..5955584 FT /rpt_family="Tip100" FT repeat_region 5955649..5955751 FT /rpt_family="Tip100" FT repeat_region 5956913..5957045 FT /rpt_family="MIR" FT repeat_region 5957594..5957776 FT /rpt_family="L1" FT repeat_region 5957777..5957859 FT /rpt_family="MER2_type" FT repeat_region 5957966..5958112 FT /rpt_family="L2" FT repeat_region 5959582..5959707 FT /rpt_family="L1" FT repeat_region 5960126..5960444 FT /rpt_family="L2" FT repeat_region 5960629..5960833 FT /rpt_family="MER1_type" FT repeat_region 5961444..5961594 FT /rpt_family="MIR" FT repeat_region 5962292..5962504 FT /rpt_family="L2" FT repeat_region 5962605..5962715 FT /rpt_family="Alu" FT repeat_region 5962871..5963052 FT /rpt_family="Alu" FT repeat_region 5963074..5963150 FT /rpt_family="Mariner" FT repeat_region 5963152..5963378 FT /rpt_family="MIR" FT repeat_region 5963891..5963957 FT /rpt_family="L2" FT repeat_region 5964340..5964516 FT /rpt_family="MIR" FT repeat_region 5964717..5965021 FT /rpt_family="Alu" FT repeat_region 5965178..5965332 FT /rpt_family="MIR" FT repeat_region 5965454..5965649 FT /rpt_family="MIR" FT repeat_region 5966215..5966517 FT /rpt_family="Alu" FT repeat_region 5966597..5966703 FT /rpt_family="L1" FT repeat_region 5967264..5967355 FT /rpt_family="MIR" FT repeat_region 5967544..5967617 FT /rpt_family="MIR" FT repeat_region 5967806..5967848 FT /rpt_family="L1" FT repeat_region 5967921..5968227 FT /rpt_family="Alu" FT repeat_region 5968387..5968674 FT /rpt_family="Alu" FT repeat_region 5968802..5968946 FT /rpt_family="L1" FT repeat_region 5969891..5970027 FT /rpt_family="L2" FT repeat_region 5970227..5970411 FT /rpt_family="L2" FT repeat_region 5970664..5970847 FT /rpt_family="MIR" FT repeat_region 5971341..5971438 FT /rpt_family="MIR" FT repeat_region 5973736..5974029 FT /rpt_family="Alu" FT repeat_region 5974164..5974318 FT /rpt_family="MIR" FT repeat_region 5974575..5974702 FT /rpt_family="MIR" FT repeat_region 5974745..5975126 FT /rpt_family="L2" FT repeat_region 5975818..5975908 FT /rpt_family="MIR" FT repeat_region 5976204..5976372 FT /rpt_family="MIR" FT repeat_region 5976584..5976896 FT /rpt_family="Alu" FT repeat_region 5977223..5977515 FT /rpt_family="Alu" FT repeat_region 5977891..5978212 FT /rpt_family="Alu" FT repeat_region 5978296..5978537 FT /rpt_family="MIR" FT repeat_region 5978542..5978993 FT /rpt_family="MaLR" FT repeat_region 5979233..5979445 FT /rpt_family="L1" FT repeat_region 5979593..5979955 FT /rpt_family="L1" FT repeat_region 5979979..5980265 FT /rpt_family="L1" FT repeat_region 5980305..5980500 FT /rpt_family="L1" FT repeat_region 5980689..5981184 FT /rpt_family="L1" FT repeat_region 5981282..5981339 FT /rpt_family="L1" FT repeat_region 5981354..5981398 FT /rpt_family="Alu" FT repeat_region 5981399..5981599 FT /rpt_family="L1" FT repeat_region 5982797..5982847 FT /rpt_family="(CA)n" FT repeat_region 5982855..5982882 FT /rpt_family="AT_rich" FT repeat_region 5983128..5983430 FT /rpt_family="Alu" FT repeat_region 5984294..5984498 FT /rpt_family="AcHobo" FT repeat_region 5984703..5984774 FT /rpt_family="L2" FT repeat_region 5984888..5985258 FT /rpt_family="L2" FT repeat_region 5985259..5987414 FT /rpt_family="L1" FT repeat_region 5987415..5987718 FT /rpt_family="Alu" FT repeat_region 5987719..5988172 FT /rpt_family="L1" FT repeat_region 5988266..5988563 FT /rpt_family="Alu" FT repeat_region 5988664..5988864 FT /rpt_family="L1" FT repeat_region 5988865..5989165 FT /rpt_family="Alu" FT repeat_region 5989166..5989264 FT /rpt_family="L1" FT repeat_region 5989279..5989439 FT /rpt_family="GA-rich" FT repeat_region 5989556..5989670 FT /rpt_family="MIR" FT repeat_region 5989823..5990012 FT /rpt_family="MIR" FT repeat_region 5992668..5992944 FT /rpt_family="L2" FT repeat_region 5992945..5993125 FT /rpt_family="MER1_type" FT repeat_region 5993126..5993232 FT /rpt_family="L2" FT repeat_region 5993757..5993819 FT /rpt_family="MIR" FT repeat_region 5994030..5994122 FT /rpt_family="MIR" FT repeat_region 5994872..5994975 FT /rpt_family="MIR" FT repeat_region 5995262..5995573 FT /rpt_family="Alu" FT repeat_region 5995574..5995596 FT /rpt_family="AT_rich" FT repeat_region 5995850..5996016 FT /rpt_family="MIR" FT repeat_region 5996307..5996338 FT /rpt_family="MIR" FT repeat_region 5996519..5996833 FT /rpt_family="MER1_type" FT repeat_region 5997202..5997245 FT /rpt_family="(CA)n" FT repeat_region 5997364..5997464 FT /rpt_family="L2" FT repeat_region 5997522..5997617 FT /rpt_family="L2" FT repeat_region 5998429..5998523 FT /rpt_family="MER1_type" FT repeat_region 5998698..5998854 FT /rpt_family="GA-rich" FT repeat_region 5998987..5999102 FT /rpt_family="L2" FT repeat_region 5999141..5999282 FT /rpt_family="MIR" FT repeat_region 5999372..5999886 FT /rpt_family="L1" FT repeat_region 6000970..6001107 FT /rpt_family="MIR" FT repeat_region 6002576..6002659 FT /rpt_family="MaLR" FT repeat_region 6002879..6003094 FT /rpt_family="Alu" FT repeat_region 6003400..6003554 FT /rpt_family="L2" FT repeat_region 6003751..6004181 FT /rpt_family="MaLR" FT repeat_region 6004564..6004686 FT /rpt_family="MIR" FT repeat_region 6005136..6005385 FT /rpt_family="(ATGGTG)n" FT repeat_region 6005386..6005740 FT /rpt_family="(ATG)n" FT repeat_region 6005766..6005813 FT /rpt_family="(ATG)n" FT repeat_region 6005814..6005991 FT /rpt_family="(ATG)n" FT repeat_region 6006242..6006601 FT /rpt_family="(ATGGTG)n" FT repeat_region 6006602..6006823 FT /rpt_family="MIR" FT repeat_region 6007306..6007432 FT /rpt_family="MIR" FT repeat_region 6008178..6008374 FT /rpt_family="MIR" FT repeat_region 6008421..6008474 FT /rpt_family="MIR" FT repeat_region 6008570..6008640 FT /rpt_family="L2" FT repeat_region 6008759..6008817 FT /rpt_family="L2" FT repeat_region 6008954..6009314 FT /rpt_family="MaLR" FT repeat_region 6009402..6009574 FT /rpt_family="(TGGG)n" FT repeat_region 6010124..6010237 FT /rpt_family="(CCG)n" FT repeat_region 6010316..6010489 FT /rpt_family="MER1_type" FT repeat_region 6012157..6012397 FT /rpt_family="MER1_type" FT repeat_region 6012601..6012802 FT /rpt_family="MIR" FT repeat_region 6014004..6014193 FT /rpt_family="MIR" FT repeat_region 6014731..6014880 FT /rpt_family="MIR" FT repeat_region 6015209..6015636 FT /rpt_family="MaLR" FT repeat_region 6015733..6016027 FT /rpt_family="Alu" FT repeat_region 6016028..6016124 FT /rpt_family="MIR" FT repeat_region 6016408..6016476 FT /rpt_family="MIR" FT repeat_region 6016867..6017212 FT /rpt_family="MaLR" FT repeat_region 6017218..6017346 FT /rpt_family="MER2_type" FT repeat_region 6017363..6017684 FT /rpt_family="MaLR" FT repeat_region 6017664..6017993 FT /rpt_family="MER2_type" FT repeat_region 6017994..6018305 FT /rpt_family="Alu" FT repeat_region 6018306..6018382 FT /rpt_family="MER2_type" FT repeat_region 6018847..6019124 FT /rpt_family="ERVL" FT repeat_region 6019125..6019562 FT /rpt_family="ERVL" FT repeat_region 6019563..6019732 FT /rpt_family="ERVL" FT repeat_region 6020663..6020861 FT /rpt_family="MIR" FT repeat_region 6021328..6022011 FT /rpt_family="ERV1" FT repeat_region 6022097..6022291 FT /rpt_family="MIR" FT repeat_region 6023747..6023827 FT /rpt_family="AcHobo" FT repeat_region 6027010..6027103 FT /rpt_family="L2" FT repeat_region 6027981..6028059 FT /rpt_family="A-rich" FT repeat_region 6028486..6028709 FT /rpt_family="MER1_type" FT repeat_region 6029064..6029191 FT /rpt_family="MIR" FT repeat_region 6030312..6030459 FT /rpt_family="CR1" FT repeat_region 6030618..6030731 FT /rpt_family="L2" FT repeat_region 6030864..6030945 FT /rpt_family="MIR" FT repeat_region 6031573..6031827 FT /rpt_family="L1" FT repeat_region 6032070..6032164 FT /rpt_family="AcHobo" FT repeat_region 6032514..6032696 FT /rpt_family="MER1_type" FT repeat_region 6032878..6033159 FT /rpt_family="Alu" FT repeat_region 6033222..6033293 FT /rpt_family="L2" FT repeat_region 6033377..6033439 FT /rpt_family="L2" FT repeat_region 6033497..6033560 FT /rpt_family="MIR" FT repeat_region 6033791..6033877 FT /rpt_family="MIR" FT repeat_region 6034079..6034264 FT /rpt_family="MIR" FT repeat_region 6034266..6034306 FT /rpt_family="L2" FT repeat_region 6034377..6034435 FT /rpt_family="(CAAAA)n" FT repeat_region 6035199..6035415 FT /rpt_family="MIR" FT repeat_region 6035922..6036115 FT /rpt_family="MIR" FT repeat_region 6036178..6036250 FT /rpt_family="ERVL" FT repeat_region 6036251..6036550 FT /rpt_family="Alu" FT repeat_region 6036551..6036869 FT /rpt_family="ERVL" FT repeat_region 6036937..6037101 FT /rpt_family="MIR" FT repeat_region 6042980..6043144 FT /rpt_family="MIR" FT repeat_region 6043311..6043443 FT /rpt_family="MIR" FT repeat_region 6043583..6043705 FT /rpt_family="L2" FT repeat_region 6044280..6044478 FT /rpt_family="MIR" FT repeat_region 6045710..6046052 FT /rpt_family="L2" FT repeat_region 6047318..6047607 FT /rpt_family="Alu" FT repeat_region 6047797..6047908 FT /rpt_family="AcHobo" FT repeat_region 6049281..6049342 FT /rpt_family="MIR" FT repeat_region 6049739..6050350 FT /rpt_family="L1" FT repeat_region 6050744..6051062 FT /rpt_family="Alu" FT repeat_region 6051904..6052054 FT /rpt_family="MIR" FT repeat_region 6052768..6052936 FT /rpt_family="MIR" FT repeat_region 6052937..6053266 FT /rpt_family="Alu" FT repeat_region 6053935..6053973 FT /rpt_family="A-rich" FT repeat_region 6054092..6054401 FT /rpt_family="Alu" FT repeat_region 6055626..6055656 FT /rpt_family="(GAAA)n" FT repeat_region 6056075..6056165 FT /rpt_family="L2" FT repeat_region 6056166..6056235 FT /rpt_family="MIR" FT repeat_region 6056927..6057099 FT /rpt_family="L1" FT repeat_region 6058918..6059035 FT /rpt_family="L2" FT repeat_region 6059366..6059583 FT /rpt_family="MaLR" FT repeat_region 6059655..6059773 FT /rpt_family="MaLR" FT repeat_region 6059938..6060536 FT /rpt_family="ERV1" FT repeat_region 6060711..6060865 FT /rpt_family="MIR" FT repeat_region 6062684..6063008 FT /rpt_family="MER1_type" FT repeat_region 6063258..6063422 FT /rpt_family="MIR" FT repeat_region 6063477..6063680 FT /rpt_family="CR1" FT repeat_region 6064592..6064882 FT /rpt_family="Alu" FT repeat_region 6066947..6067044 FT /rpt_family="MIR" FT repeat_region 6067533..6067679 FT /rpt_family="L2" FT repeat_region 6068205..6068524 FT /rpt_family="L2" FT repeat_region 6068565..6068958 FT /rpt_family="L2" FT repeat_region 6070277..6070596 FT /rpt_family="Alu" FT repeat_region 6071194..6071498 FT /rpt_family="Alu" FT repeat_region 6073659..6074098 FT /rpt_family="ERV1" FT repeat_region 6074559..6074824 FT /rpt_family="Alu" FT repeat_region 6075386..6075489 FT /rpt_family="MIR" FT repeat_region 6076259..6076445 FT /rpt_family="MER2_type" FT repeat_region 6076446..6076769 FT /rpt_family="MER2_type" FT repeat_region 6076770..6076814 FT /rpt_family="MER2_type" FT repeat_region 6076819..6076919 FT /rpt_family="Alu" FT repeat_region 6076920..6077033 FT /rpt_family="MER2_type" FT repeat_region 6077444..6077530 FT /rpt_family="L2" FT repeat_region 6077622..6077935 FT /rpt_family="Alu" FT repeat_region 6078036..6078202 FT /rpt_family="MIR" FT repeat_region 6078381..6078742 FT /rpt_family="MER2_type" FT repeat_region 6078814..6079204 FT /rpt_family="MaLR" FT repeat_region 6079205..6079510 FT /rpt_family="Alu" FT repeat_region 6079511..6079577 FT /rpt_family="MaLR" FT repeat_region 6079658..6079840 FT /rpt_family="MER1_type" FT repeat_region 6079841..6080063 FT /rpt_family="Alu" FT repeat_region 6080064..6080124 FT /rpt_family="MER1_type" FT repeat_region 6080986..6081105 FT /rpt_family="(TGGA)n" FT repeat_region 6081525..6081554 FT /rpt_family="(CCAA)n" FT repeat_region 6082168..6082520 FT /rpt_family="MaLR" FT repeat_region 6082712..6082741 FT /rpt_family="(CA)n" FT repeat_region 6083000..6083119 FT /rpt_family="MIR" FT repeat_region 6083615..6083720 FT /rpt_family="MIR" FT repeat_region 6084246..6084518 FT /rpt_family="Alu" FT repeat_region 6084529..6084709 FT /rpt_family="L1" FT repeat_region 6084848..6085145 FT /rpt_family="Alu" FT repeat_region 6085763..6086068 FT /rpt_family="Alu" FT repeat_region 6086086..6086385 FT /rpt_family="L1" FT repeat_region 6086695..6086721 FT /rpt_family="(A)n" FT repeat_region 6087026..6087050 FT /rpt_family="(TGAA)n" FT repeat_region 6087679..6088239 FT /rpt_family="L2" FT repeat_region 6088388..6088812 FT /rpt_family="MaLR" FT repeat_region 6088971..6089175 FT /rpt_family="MIR" FT repeat_region 6089819..6090006 FT /rpt_family="L2" FT repeat_region 6090672..6091069 FT /rpt_family="MaLR" FT repeat_region 6091228..6091332 FT /rpt_family="MIR" FT repeat_region 6091512..6091684 FT /rpt_family="MaLR" FT repeat_region 6091685..6091971 FT /rpt_family="Alu" FT repeat_region 6091972..6092248 FT /rpt_family="MaLR" FT repeat_region 6093180..6093371 FT /rpt_family="MIR" FT repeat_region 6093578..6093769 FT /rpt_family="CR1" FT repeat_region 6094800..6094899 FT /rpt_family="L2" FT repeat_region 6096439..6096740 FT /rpt_family="Alu" FT repeat_region 6096763..6097114 FT /rpt_family="GA-rich" FT repeat_region 6097400..6097498 FT /rpt_family="L1" FT repeat_region 6097515..6097863 FT /rpt_family="L2" FT repeat_region 6097936..6098135 FT /rpt_family="L1" FT repeat_region 6098412..6098735 FT /rpt_family="MER2_type" FT repeat_region 6098736..6099019 FT /rpt_family="Alu" FT repeat_region 6099020..6099121 FT /rpt_family="MER2_type" FT repeat_region 6099123..6099363 FT /rpt_family="MER2_type" FT repeat_region 6099877..6100169 FT /rpt_family="Alu" FT repeat_region 6100170..6100205 FT /rpt_family="(GGGA)n" FT repeat_region 6100200..6100515 FT /rpt_family="(GAAA)n" FT repeat_region 6100533..6100809 FT /rpt_family="L1" FT repeat_region 6100827..6101606 FT /rpt_family="L1" FT repeat_region 6101641..6101727 FT /rpt_family="L1" FT repeat_region 6101870..6102986 FT /rpt_family="L1" FT repeat_region 6102987..6103011 FT /rpt_family="(TG)n" FT repeat_region 6103012..6103331 FT /rpt_family="L1" FT repeat_region 6103332..6103648 FT /rpt_family="Alu" FT repeat_region 6103649..6104009 FT /rpt_family="L1" FT repeat_region 6104010..6104372 FT /rpt_family="MaLR" FT repeat_region 6104373..6104449 FT /rpt_family="L1" FT repeat_region 6104450..6104721 FT /rpt_family="Alu" FT repeat_region 6104728..6104752 FT /rpt_family="(TTTTA)n" FT repeat_region 6104753..6105861 FT /rpt_family="L1" FT repeat_region 6105896..6106346 FT /rpt_family="L1" FT repeat_region 6107075..6107123 FT /rpt_family="L2" FT repeat_region 6108244..6108297 FT /rpt_family="(TC)n" FT repeat_region 6109105..6109539 FT /rpt_family="ERVL" FT repeat_region 6109543..6109633 FT /rpt_family="MIR" FT repeat_region 6110405..6110851 FT /rpt_family="L1" FT repeat_region 6110852..6111152 FT /rpt_family="Alu" FT repeat_region 6111153..6111208 FT /rpt_family="L1" FT repeat_region 6111833..6112193 FT /rpt_family="MaLR" FT repeat_region 6112194..6112299 FT /rpt_family="MIR" FT repeat_region 6112360..6112540 FT /rpt_family="MIR" FT repeat_region 6112602..6112646 FT /rpt_family="(CCCCAG)n" FT repeat_region 6113231..6113426 FT /rpt_family="MIR" FT repeat_region 6113641..6113809 FT /rpt_family="ERV1" FT repeat_region 6113826..6114189 FT /rpt_family="ERV1" FT repeat_region 6114190..6114292 FT /rpt_family="MIR" FT repeat_region 6114871..6114991 FT /rpt_family="MER1_type" FT repeat_region 6115089..6115223 FT /rpt_family="MER1_type" FT repeat_region 6115260..6115351 FT /rpt_family="MIR" FT repeat_region 6115490..6115662 FT /rpt_family="L2" FT repeat_region 6115683..6115874 FT /rpt_family="MIR" FT repeat_region 6115867..6116129 FT /rpt_family="L2" FT repeat_region 6116854..6117159 FT /rpt_family="Alu" FT repeat_region 6117213..6117317 FT /rpt_family="L2" FT repeat_region 6118460..6118562 FT /rpt_family="L2" FT repeat_region 6118671..6118840 FT /rpt_family="AcHobo" FT repeat_region 6118933..6120008 FT /rpt_family="ERVK" FT repeat_region 6120517..6120959 FT /rpt_family="MaLR" FT repeat_region 6120989..6121301 FT /rpt_family="Alu" FT repeat_region 6121514..6121634 FT /rpt_family="MIR" FT repeat_region 6122028..6122229 FT /rpt_family="L1" FT repeat_region 6122547..6122639 FT /rpt_family="MIR" FT repeat_region 6122646..6122944 FT /rpt_family="Alu" FT repeat_region 6123196..6123235 FT /rpt_family="L1" FT repeat_region 6123450..6123616 FT /rpt_family="MER1_type" FT repeat_region 6123679..6123744 FT /rpt_family="(TATATG)n" FT repeat_region 6123790..6124072 FT /rpt_family="Alu" FT repeat_region 6124495..6124737 FT /rpt_family="MIR" FT repeat_region 6125266..6125571 FT /rpt_family="Alu" FT repeat_region 6125777..6125834 FT /rpt_family="MIR" FT repeat_region 6126684..6126760 FT /rpt_family="MIR" FT unsure 6127288..6128204 FT /note="Unresolved tandem repeat." FT repeat_region 6127294..6127460 FT /rpt_family="(CA)n" FT repeat_region 6127511..6127676 FT /rpt_family="(CA)n" FT repeat_region 6127710..6128162 FT /rpt_family="(CA)n" FT repeat_region 6128212..6128366 FT /rpt_family="(CA)n" FT misc_feature 6128252..6128253 FT /note="Bacterial transposon insertion in clone excised FT here." FT repeat_region 6128397..6128568 FT /rpt_family="(CA)n" FT repeat_region 6128611..6128760 FT /rpt_family="(CA)n" FT repeat_region 6129009..6129044 FT /rpt_family="MIR" FT repeat_region 6129385..6129676 FT /rpt_family="CR1" FT repeat_region 6129713..6129953 FT /rpt_family="MIR" FT repeat_region 6129872..6129995 FT /rpt_family="MIR" FT repeat_region 6131968..6132182 FT /rpt_family="L1" FT repeat_region 6132187..6132618 FT /rpt_family="L1" FT repeat_region 6132619..6132902 FT /rpt_family="Alu" FT repeat_region 6132903..6133174 FT /rpt_family="L1" FT repeat_region 6133175..6133465 FT /rpt_family="Alu" FT repeat_region 6133466..6134086 FT /rpt_family="L1" FT repeat_region 6134087..6134393 FT /rpt_family="Alu" FT repeat_region 6134394..6134608 FT /rpt_family="L1" FT repeat_region 6134749..6134770 FT /rpt_family="AT_rich" FT repeat_region 6135476..6135541 FT /rpt_family="MaLR" FT repeat_region 6135524..6135573 FT /rpt_family="MaLR" FT repeat_region 6135720..6136092 FT /rpt_family="MaLR" FT repeat_region 6136150..6136464 FT /rpt_family="L2" FT repeat_region 6136858..6137238 FT /rpt_family="MaLR" FT repeat_region 6137691..6137966 FT /rpt_family="Alu" FT repeat_region 6137968..6137993 FT /rpt_family="(TAAA)n" FT repeat_region 6138200..6138311 FT /rpt_family="MIR" FT repeat_region 6138661..6138697 FT /rpt_family="MIR" FT repeat_region 6139397..6139466 FT /rpt_family="ERVL" FT repeat_region 6139964..6140263 FT /rpt_family="Alu" FT repeat_region 6140457..6140576 FT /rpt_family="MIR" FT repeat_region 6140783..6140832 FT /rpt_family="(CA)n" FT repeat_region 6141043..6141212 FT /rpt_family="MaLR" FT repeat_region 6141213..6141531 FT /rpt_family="Alu" FT repeat_region 6141532..6141805 FT /rpt_family="MaLR" FT repeat_region 6141962..6141993 FT /rpt_family="(T)n" FT repeat_region 6142639..6142747 FT /rpt_family="MIR" FT repeat_region 6142881..6143192 FT /rpt_family="Alu" FT repeat_region 6143630..6143866 FT /rpt_family="L1" FT repeat_region 6144754..6144941 FT /rpt_family="MIR" FT repeat_region 6145332..6145498 FT /rpt_family="MER1_type" FT repeat_region 6145994..6146842 FT /rpt_family="L1" FT repeat_region 6146951..6147141 FT /rpt_family="MIR" FT repeat_region 6147221..6147359 FT /rpt_family="L1" FT repeat_region 6147360..6147741 FT /rpt_family="MaLR" FT repeat_region 6147742..6148026 FT /rpt_family="L1" FT repeat_region 6148027..6148320 FT /rpt_family="Alu" FT repeat_region 6148321..6148435 FT /rpt_family="L1" FT repeat_region 6148465..6148516 FT /rpt_family="MER1_type" FT repeat_region 6148685..6148988 FT /rpt_family="Alu" FT repeat_region 6149005..6149037 FT /rpt_family="T-rich" FT repeat_region 6149608..6149720 FT /rpt_family="L2" FT repeat_region 6149721..6149813 FT /rpt_family="L2" FT repeat_region 6151772..6151861 FT /rpt_family="L2" FT repeat_region 6152124..6152242 FT /rpt_family="L2" FT repeat_region 6152931..6153113 FT /rpt_family="MIR" FT repeat_region 6153488..6153643 FT /rpt_family="MIR" FT repeat_region 6153785..6153911 FT /rpt_family="GA-rich" FT repeat_region 6154387..6154516 FT /rpt_family="Alu" FT repeat_region 6154517..6154551 FT /rpt_family="(TA)n" FT repeat_region 6154552..6154714 FT /rpt_family="Alu" FT repeat_region 6155046..6155174 FT /rpt_family="MIR" FT repeat_region 6156507..6156624 FT /rpt_family="L2" FT repeat_region 6157045..6157225 FT /rpt_family="MIR" FT repeat_region 6157542..6157667 FT /rpt_family="MER1_type" FT repeat_region 6157730..6157788 FT /rpt_family="L2" FT repeat_region 6158008..6158150 FT /rpt_family="Tc2" FT repeat_region 6158654..6159017 FT /rpt_family="MaLR" FT repeat_region 6160435..6160533 FT /rpt_family="L1" FT repeat_region 6160534..6160840 FT /rpt_family="Alu" FT repeat_region 6160841..6161039 FT /rpt_family="L1" FT repeat_region 6161181..6161551 FT /rpt_family="L1" FT repeat_region 6162515..6162811 FT /rpt_family="(CACCT)n" FT repeat_region 6162844..6163009 FT /rpt_family="(CACCT)n" FT repeat_region 6163418..6163820 FT /rpt_family="L2" FT repeat_region 6164341..6164555 FT /rpt_family="MIR" FT repeat_region 6164849..6164882 FT /rpt_family="MaLR" FT repeat_region 6167008..6167327 FT /rpt_family="Alu" FT repeat_region 6167528..6167937 FT /rpt_family="MaLR" FT repeat_region 6168539..6168601 FT /rpt_family="MIR" FT repeat_region 6168693..6168837 FT /rpt_family="MIR" FT repeat_region 6169207..6169330 FT /rpt_family="Tip100" FT repeat_region 6169726..6170335 FT /rpt_family="L1" FT repeat_region 6170336..6170651 FT /rpt_family="Alu" FT repeat_region 6170652..6170891 FT /rpt_family="L1" FT repeat_region 6170903..6171329 FT /rpt_family="MaLR" FT repeat_region 6171331..6171368 FT /rpt_family="(TG)n" FT repeat_region 6171429..6171622 FT /rpt_family="MIR" FT unsure 6171689..6172861 FT /note="Unresolved tandem repeat." FT repeat_region 6171689..6171865 FT /rpt_family="(CCA)n" FT repeat_region 6171879..6172057 FT /rpt_family="(CCA)n" FT repeat_region 6172074..6172397 FT /rpt_family="(CCA)n" FT repeat_region 6172427..6172782 FT /rpt_family="(CACCAT)n" FT repeat_region 6172818..6172984 FT /rpt_family="(CACCAT)n" FT repeat_region 6173009..6173188 FT /rpt_family="(CCA)n" FT repeat_region 6174690..6174753 FT /rpt_family="L2" FT repeat_region 6175276..6175520 FT /rpt_family="L1" FT repeat_region 6175521..6175757 FT /rpt_family="Alu" FT repeat_region 6175758..6175778 FT /rpt_family="L1" FT repeat_region 6175779..6175813 FT /rpt_family="(CATA)n" FT repeat_region 6175814..6175910 FT /rpt_family="L1" FT repeat_region 6176264..6176373 FT /rpt_family="MIR" FT repeat_region 6176940..6177022 FT /rpt_family="MIR" FT repeat_region 6177754..6177815 FT /rpt_family="L2" FT repeat_region 6178331..6178438 FT /rpt_family="MIR" FT repeat_region 6178477..6178767 FT /rpt_family="Alu" FT repeat_region 6178959..6179117 FT /rpt_family="MIR" FT repeat_region 6179226..6179336 FT /rpt_family="MIR" FT repeat_region 6180006..6180153 FT /rpt_family="MaLR" FT repeat_region 6180311..6180484 FT /rpt_family="MaLR" FT repeat_region 6180614..6180687 FT /rpt_family="L2" FT repeat_region 6181461..6181676 FT /rpt_family="MIR" FT repeat_region 6181677..6181729 FT /rpt_family="L2" FT repeat_region 6182278..6182451 FT /rpt_family="MIR" FT repeat_region 6183431..6183452 FT /rpt_family="(TTCA)n" FT repeat_region 6183463..6183713 FT /rpt_family="L2" FT repeat_region 6183737..6183859 FT /rpt_family="MaLR" FT repeat_region 6183860..6184165 FT /rpt_family="Alu" FT repeat_region 6184166..6184412 FT /rpt_family="MaLR" FT repeat_region 6184720..6184741 FT /rpt_family="(CAGCT)n" FT repeat_region 6184924..6185254 FT /rpt_family="Alu" FT repeat_region 6185891..6185931 FT /rpt_family="MIR" FT repeat_region 6186462..6187004 FT /rpt_family="ERVL" FT repeat_region 6187029..6187092 FT /rpt_family="MER1_type" FT repeat_region 6187093..6187386 FT /rpt_family="Alu" FT repeat_region 6187387..6187507 FT /rpt_family="MER1_type" FT repeat_region 6188202..6188554 FT /rpt_family="L1" FT repeat_region 6188555..6188856 FT /rpt_family="Alu" FT repeat_region 6188857..6189134 FT /rpt_family="L1" FT repeat_region 6189135..6189491 FT /rpt_family="MaLR" FT repeat_region 6189492..6189681 FT /rpt_family="L1" FT repeat_region 6191127..6191260 FT /rpt_family="CR1" FT repeat_region 6191273..6191600 FT /rpt_family="L2" FT repeat_region 6191958..6192164 FT /rpt_family="L1" FT repeat_region 6193261..6193361 FT /rpt_family="MIR" FT repeat_region 6193422..6193640 FT /rpt_family="MER1_type" FT repeat_region 6193641..6193959 FT /rpt_family="Alu" FT repeat_region 6193960..6194061 FT /rpt_family="MER1_type" FT repeat_region 6194243..6194370 FT /rpt_family="MIR" FT repeat_region 6194354..6194497 FT /rpt_family="L2" FT repeat_region 6194618..6195172 FT /rpt_family="ERVL" FT repeat_region 6195173..6195299 FT /rpt_family="L2" FT repeat_region 6195567..6196033 FT /rpt_family="L1" FT repeat_region 6196806..6196949 FT /rpt_family="MIR" FT repeat_region 6197018..6197155 FT /rpt_family="L1" FT repeat_region 6197177..6197302 FT /rpt_family="L1" FT repeat_region 6197494..6197661 FT /rpt_family="MER1_type" FT repeat_region 6197931..6197966 FT /rpt_family="Mariner" FT repeat_region 6198299..6198607 FT /rpt_family="Alu" FT repeat_region 6198870..6199004 FT /rpt_family="MIR" FT repeat_region 6199179..6199324 FT /rpt_family="MIR" FT repeat_region 6199413..6199512 FT /rpt_family="MIR" FT misc_feature 6200844..6202822 FT /note="CpG_island (%GC=72.2, o/e=0.80, #CpGs=204)" FT repeat_region 6201451..6201480 FT /rpt_family="GC_rich" FT repeat_region 6202390..6202415 FT /rpt_family="(CCCCCG)n" FT repeat_region 6202733..6202849 FT /rpt_family="MIR" FT repeat_region 6202967..6203094 FT /rpt_family="L2" FT repeat_region 6203338..6203652 FT /rpt_family="MaLR" FT repeat_region 6203918..6204374 FT /rpt_family="MaLR" FT repeat_region 6204389..6204749 FT /rpt_family="MaLR" FT repeat_region 6204750..6205046 FT /rpt_family="Alu" FT repeat_region 6205047..6205147 FT /rpt_family="MaLR" FT repeat_region 6205155..6205660 FT /rpt_family="Tip100" FT repeat_region 6205769..6205889 FT /rpt_family="MER1_type" FT repeat_region 6205983..6206279 FT /rpt_family="Tip100" FT repeat_region 6206281..6206636 FT /rpt_family="MaLR" FT repeat_region 6206633..6206740 FT /rpt_family="Tip100" FT repeat_region 6206990..6207047 FT /rpt_family="CR1" FT repeat_region 6207147..6207332 FT /rpt_family="MIR" FT repeat_region 6207340..6207747 FT /rpt_family="MaLR" FT repeat_region 6208112..6208258 FT /rpt_family="L2" FT repeat_region 6208259..6208576 FT /rpt_family="Alu" FT repeat_region 6208577..6208705 FT /rpt_family="L2" FT repeat_region 6209172..6209471 FT /rpt_family="Alu" FT repeat_region 6209501..6209571 FT /rpt_family="MIR" FT repeat_region 6209594..6209703 FT /rpt_family="MIR" FT repeat_region 6209704..6210007 FT /rpt_family="Alu" FT repeat_region 6210008..6210128 FT /rpt_family="MIR" FT repeat_region 6210179..6210325 FT /rpt_family="MIR" FT repeat_region 6210342..6210524 FT /rpt_family="MIR" FT repeat_region 6210714..6211088 FT /rpt_family="L1" FT repeat_region 6211242..6211558 FT /rpt_family="Alu" FT repeat_region 6211712..6211887 FT /rpt_family="L1" FT repeat_region 6212040..6212065 FT /rpt_family="(CATA)n" FT repeat_region 6212318..6212372 FT /rpt_family="L1" FT repeat_region 6212374..6212681 FT /rpt_family="Alu" FT repeat_region 6212709..6212871 FT /rpt_family="L1" FT repeat_region 6212891..6213205 FT /rpt_family="Alu" FT repeat_region 6213303..6213407 FT /rpt_family="L1" FT repeat_region 6213408..6213523 FT /rpt_family="(TA)n" FT repeat_region 6214114..6214162 FT /rpt_family="(CA)n" FT repeat_region 6214625..6214704 FT /rpt_family="L1" FT repeat_region 6214705..6214910 FT /rpt_family="MER1_type" FT repeat_region 6214911..6215012 FT /rpt_family="L1" FT repeat_region 6215022..6215354 FT /rpt_family="MaLR" FT repeat_region 6215357..6215446 FT /rpt_family="L1" FT repeat_region 6215472..6215782 FT /rpt_family="Alu" FT repeat_region 6215785..6215871 FT /rpt_family="L1" FT repeat_region 6215872..6216169 FT /rpt_family="Alu" FT repeat_region 6216170..6216912 FT /rpt_family="L1" FT repeat_region 6216936..6217057 FT /rpt_family="L1" FT repeat_region 6217058..6217079 FT /rpt_family="L1" FT repeat_region 6217080..6217426 FT /rpt_family="MaLR" FT repeat_region 6217427..6218156 FT /rpt_family="L1" FT repeat_region 6218157..6218731 FT /rpt_family="L1" FT repeat_region 6218865..6219055 FT /rpt_family="L1" FT repeat_region 6219087..6219307 FT /rpt_family="L1" FT repeat_region 6219307..6220038 FT /rpt_family="L1" FT repeat_region 6220070..6220152 FT /rpt_family="L1" FT repeat_region 6220178..6220338 FT /rpt_family="Tc2" FT repeat_region 6220449..6220768 FT /rpt_family="L1" FT repeat_region 6220769..6220920 FT /rpt_family="Alu" FT repeat_region 6220921..6221467 FT /rpt_family="L1" FT repeat_region 6221749..6222046 FT /rpt_family="L1" FT repeat_region 6222237..6222339 FT /rpt_family="MIR" FT repeat_region 6222409..6222698 FT /rpt_family="Alu" FT repeat_region 6222776..6222873 FT /rpt_family="MIR" FT repeat_region 6223011..6223219 FT /rpt_family="MIR" FT repeat_region 6224266..6224460 FT /rpt_family="MaLR" FT repeat_region 6224646..6224827 FT /rpt_family="MIR" FT repeat_region 6224952..6225173 FT /rpt_family="Alu" FT repeat_region 6225190..6225556 FT /rpt_family="MaLR" FT repeat_region 6226245..6226339 FT /rpt_family="Mariner" FT repeat_region 6226441..6226531 FT /rpt_family="Alu" FT repeat_region 6227375..6227405 FT /rpt_family="L2" FT repeat_region 6227826..6227954 FT /rpt_family="L2" FT repeat_region 6228072..6228273 FT /rpt_family="MIR" FT repeat_region 6228420..6228492 FT /rpt_family="MIR" FT repeat_region 6229391..6229449 FT /rpt_family="MIR" FT repeat_region 6230196..6230316 FT /rpt_family="L2" FT repeat_region 6231219..6231270 FT /rpt_family="CR1" FT repeat_region 6231271..6231448 FT /rpt_family="CR1" FT repeat_region 6231960..6232103 FT /rpt_family="MER1_type" FT repeat_region 6232350..6232454 FT /rpt_family="ERVL" FT repeat_region 6233015..6233234 FT /rpt_family="MIR" FT repeat_region 6233312..6233514 FT /rpt_family="MER1_type" FT repeat_region 6235124..6235407 FT /rpt_family="L2" FT repeat_region 6235748..6235869 FT /rpt_family="MIR" FT repeat_region 6235897..6236013 FT /rpt_family="L2" FT repeat_region 6236066..6236246 FT /rpt_family="(CA)n" FT repeat_region 6236922..6236968 FT /rpt_family="MIR" FT repeat_region 6237002..6237212 FT /rpt_family="L1" FT repeat_region 6237320..6237496 FT /rpt_family="MIR" FT repeat_region 6237690..6238380 FT /rpt_family="L1" FT repeat_region 6238381..6238698 FT /rpt_family="Alu" FT repeat_region 6238699..6238740 FT /rpt_family="L1" FT repeat_region 6239352..6239558 FT /rpt_family="MIR" FT repeat_region 6239609..6239733 FT /rpt_family="L1" FT repeat_region 6239761..6240067 FT /rpt_family="Alu" FT repeat_region 6240073..6240107 FT /rpt_family="L1" FT repeat_region 6240108..6240411 FT /rpt_family="Alu" FT repeat_region 6240241..6240411 FT /rpt_family="Alu" FT repeat_region 6240539..6240650 FT /rpt_family="(TCTA)n" FT repeat_region 6240653..6240695 FT /rpt_family="GA-rich" FT repeat_region 6240743..6240855 FT /rpt_family="L1" FT repeat_region 6240856..6241109 FT /rpt_family="Alu" FT repeat_region 6241110..6241251 FT /rpt_family="L1" FT repeat_region 6241294..6241488 FT /rpt_family="MIR" FT repeat_region 6242070..6242153 FT /rpt_family="MIR" FT repeat_region 6242225..6242480 FT /rpt_family="Alu" FT repeat_region 6242516..6242793 FT /rpt_family="L1" FT repeat_region 6243132..6243209 FT /rpt_family="L2" FT repeat_region 6243609..6243910 FT /rpt_family="Alu" FT repeat_region 6245227..6245338 FT /rpt_family="L2" FT repeat_region 6245779..6245864 FT /rpt_family="(TG)n" FT repeat_region 6246258..6246338 FT /rpt_family="ERVL" FT repeat_region 6246364..6246863 FT /rpt_family="ERV1" FT repeat_region 6246907..6247074 FT /rpt_family="ERVL" FT repeat_region 6248185..6248266 FT /rpt_family="MER53" FT repeat_region 6248268..6248913 FT /rpt_family="ERV1" FT repeat_region 6248897..6248981 FT /rpt_family="MER53" FT repeat_region 6248982..6249420 FT /rpt_family="ERVL" FT repeat_region 6249421..6249452 FT /rpt_family="MER53" FT repeat_region 6249458..6249561 FT /rpt_family="MIR" FT repeat_region 6249872..6250059 FT /rpt_family="MIR" FT repeat_region 6250626..6250827 FT /rpt_family="MER1_type" FT repeat_region 6251001..6252087 FT /rpt_family="Tip100" FT repeat_region 6252196..6252283 FT /rpt_family="MIR" FT repeat_region 6252389..6252538 FT /rpt_family="MER1_type" FT repeat_region 6252857..6253160 FT /rpt_family="Alu" FT repeat_region 6253263..6253442 FT /rpt_family="MIR" FT repeat_region 6253715..6253823 FT /rpt_family="MIR" FT repeat_region 6254220..6254508 FT /rpt_family="Alu" FT repeat_region 6254683..6255265 FT /rpt_family="L2" FT repeat_region 6255284..6255445 FT /rpt_family="L2" FT repeat_region 6255641..6255722 FT /rpt_family="MER1_type" FT repeat_region 6255768..6255872 FT /rpt_family="MIR" FT repeat_region 6256203..6256353 FT /rpt_family="MER1_type" FT repeat_region 6256354..6256440 FT /rpt_family="MER1_type" FT repeat_region 6256707..6256923 FT /rpt_family="MIR" FT repeat_region 6256924..6257251 FT /rpt_family="MaLR" FT repeat_region 6257273..6257441 FT /rpt_family="Alu" FT repeat_region 6257442..6257807 FT /rpt_family="MaLR" FT repeat_region 6257808..6257921 FT /rpt_family="Alu" FT repeat_region 6257938..6258045 FT /rpt_family="CR1" FT repeat_region 6258352..6258419 FT /rpt_family="MaLR" FT repeat_region 6258438..6258506 FT /rpt_family="ERV1" FT repeat_region 6258509..6258556 FT /rpt_family="MaLR" FT repeat_region 6258557..6258854 FT /rpt_family="Alu" FT repeat_region 6258855..6259111 FT /rpt_family="MaLR" FT repeat_region 6259295..6259604 FT /rpt_family="L2" FT repeat_region 6259612..6259643 FT /rpt_family="(TTCA)n" FT repeat_region 6259728..6259838 FT /rpt_family="L2" FT repeat_region 6260033..6260331 FT /rpt_family="Alu" FT repeat_region 6260334..6260480 FT /rpt_family="Alu" FT repeat_region 6260837..6260884 FT /rpt_family="MIR" FT repeat_region 6260949..6261244 FT /rpt_family="Alu" FT repeat_region 6261245..6261538 FT /rpt_family="Alu" FT repeat_region 6262523..6262827 FT /rpt_family="Alu" FT repeat_region 6262888..6263217 FT /rpt_family="Alu" FT repeat_region 6263429..6263554 FT /rpt_family="MIR" FT repeat_region 6263779..6264360 FT /rpt_family="L1" FT repeat_region 6264373..6264638 FT /rpt_family="Alu" FT repeat_region 6266151..6266278 FT /rpt_family="Alu" FT repeat_region 6266282..6266449 FT /rpt_family="MER1_type" FT repeat_region 6266470..6266573 FT /rpt_family="MER1_type" FT repeat_region 6266620..6266997 FT /rpt_family="Alu" FT repeat_region 6267009..6267290 FT /rpt_family="Alu" FT repeat_region 6267327..6267704 FT /rpt_family="MaLR" FT repeat_region 6267771..6267845 FT /rpt_family="L2" FT repeat_region 6267861..6268173 FT /rpt_family="Alu" FT repeat_region 6268385..6268417 FT /rpt_family="(TCCA)n" FT repeat_region 6268566..6268941 FT /rpt_family="L1" FT repeat_region 6269423..6270055 FT /rpt_family="L1" FT repeat_region 6270285..6270375 FT /rpt_family="L1" FT repeat_region 6270396..6270535 FT /rpt_family="MIR" FT misc_feature 6271281..6272182 FT /note="CpG_island (%GC=75.6, o/e=0.90, #CpGs=113)" FT repeat_region 6271310..6271342 FT /rpt_family="GC_rich" FT repeat_region 6271965..6272082 FT /rpt_family="GC_rich" FT repeat_region 6272538..6272660 FT /rpt_family="MIR" FT repeat_region 6273605..6273979 FT /rpt_family="L2" FT repeat_region 6274347..6274491 FT /rpt_family="L1" FT repeat_region 6275762..6276073 FT /rpt_family="Alu" FT repeat_region 6276120..6276203 FT /rpt_family="MIR" FT repeat_region 6276614..6276730 FT /rpt_family="MIR" FT repeat_region 6276741..6276799 FT /rpt_family="MIR" FT repeat_region 6277677..6277783 FT /rpt_family="MIR" FT repeat_region 6278323..6278378 FT /rpt_family="C-rich" FT repeat_region 6278408..6278780 FT /rpt_family="MaLR" FT repeat_region 6280272..6280370 FT /rpt_family="MIR" FT repeat_region 6281016..6281219 FT /rpt_family="MIR" FT repeat_region 6285064..6285598 FT /rpt_family="MaLR" FT repeat_region 6285816..6286129 FT /rpt_family="Alu" FT repeat_region 6287919..6288282 FT /rpt_family="MaLR" FT repeat_region 6289662..6289962 FT /rpt_family="Alu" FT repeat_region 6290075..6290120 FT /rpt_family="MIR" FT repeat_region 6290132..6290300 FT /rpt_family="MER1_type" FT repeat_region 6291531..6291654 FT /rpt_family="L1" FT repeat_region 6291655..6291965 FT /rpt_family="Alu" FT repeat_region 6292254..6292318 FT /rpt_family="L1" FT repeat_region 6292555..6292652 FT /rpt_family="MIR" FT repeat_region 6294015..6294138 FT /rpt_family="L2" FT repeat_region 6294446..6294550 FT /rpt_family="MIR" FT repeat_region 6295106..6295415 FT /rpt_family="L2" FT repeat_region 6295594..6295826 FT /rpt_family="L2" FT repeat_region 6298553..6298854 FT /rpt_family="Alu" FT repeat_region 6301143..6301317 FT /rpt_family="(TG)n" FT repeat_region 6301344..6301514 FT /rpt_family="(TG)n" FT repeat_region 6301544..6301709 FT /rpt_family="(TG)n" FT repeat_region 6306135..6306258 FT /rpt_family="MIR" FT repeat_region 6306380..6306530 FT /rpt_family="MIR" FT repeat_region 6306543..6306628 FT /rpt_family="Alu" FT repeat_region 6307357..6307524 FT /rpt_family="L2" FT repeat_region 6307662..6308002 FT /rpt_family="MaLR" FT repeat_region 6308909..6308994 FT /rpt_family="MIR" FT repeat_region 6309009..6309425 FT /rpt_family="MaLR" FT repeat_region 6310053..6311321 FT /rpt_family="ERV1" FT repeat_region 6311531..6312103 FT /rpt_family="ERVL" FT repeat_region 6312273..6312459 FT /rpt_family="MIR" FT repeat_region 6312468..6312578 FT /rpt_family="MIR" FT repeat_region 6312622..6312707 FT /rpt_family="(TTCA)n" FT repeat_region 6312972..6313521 FT /rpt_family="ERV1" FT repeat_region 6313571..6313904 FT /rpt_family="L1" FT repeat_region 6313905..6314184 FT /rpt_family="Alu" FT repeat_region 6314185..6314502 FT /rpt_family="L1" FT repeat_region 6314522..6314720 FT /rpt_family="MaLR" FT repeat_region 6314721..6315294 FT /rpt_family="ERV1" FT repeat_region 6315295..6315580 FT /rpt_family="Alu" FT repeat_region 6315581..6315779 FT /rpt_family="ERV1" FT repeat_region 6315780..6315901 FT /rpt_family="MaLR" FT repeat_region 6315992..6316065 FT /rpt_family="L1" FT repeat_region 6316113..6316243 FT /rpt_family="MaLR" FT repeat_region 6316264..6316504 FT /rpt_family="ERV1" FT repeat_region 6316505..6316815 FT /rpt_family="Alu" FT repeat_region 6316816..6317142 FT /rpt_family="ERV1" FT repeat_region 6317280..6317388 FT /rpt_family="MaLR" FT repeat_region 6317389..6317776 FT /rpt_family="L1" FT repeat_region 6317777..6318098 FT /rpt_family="Alu" FT repeat_region 6318099..6318563 FT /rpt_family="L1" FT repeat_region 6318564..6318865 FT /rpt_family="Alu" FT repeat_region 6318866..6318959 FT /rpt_family="L1" FT repeat_region 6319126..6319337 FT /rpt_family="L1" FT repeat_region 6319466..6319526 FT /rpt_family="L2" FT repeat_region 6319729..6319950 FT /rpt_family="MIR" FT repeat_region 6320652..6321081 FT /rpt_family="MaLR" FT repeat_region 6321190..6321312 FT /rpt_family="MIR" FT repeat_region 6321858..6321924 FT /rpt_family="MIR" FT repeat_region 6322001..6322242 FT /rpt_family="MIR" FT repeat_region 6322476..6322504 FT /rpt_family="(CCA)n" FT repeat_region 6323375..6323403 FT /rpt_family="(CAAAA)n" FT repeat_region 6324054..6324128 FT /rpt_family="L2" FT repeat_region 6324259..6324327 FT /rpt_family="L2" FT repeat_region 6325383..6325692 FT /rpt_family="Alu" FT repeat_region 6325877..6326187 FT /rpt_family="Alu" FT repeat_region 6326817..6326877 FT /rpt_family="MIR" FT repeat_region 6327637..6327736 FT /rpt_family="Alu" FT repeat_region 6327780..6327885 FT /rpt_family="MaLR" FT repeat_region 6331486..6331658 FT /rpt_family="MIR" FT repeat_region 6332010..6332081 FT /rpt_family="L2" FT repeat_region 6332082..6332461 FT /rpt_family="ERVL" FT repeat_region 6332462..6332568 FT /rpt_family="L2" FT repeat_region 6332968..6333156 FT /rpt_family="MIR" FT repeat_region 6333256..6333569 FT /rpt_family="MaLR" FT repeat_region 6333623..6333668 FT /rpt_family="MIR" FT repeat_region 6334551..6334641 FT /rpt_family="L2" FT repeat_region 6335639..6335753 FT /rpt_family="MIR" FT repeat_region 6335860..6335941 FT /rpt_family="MIR" FT repeat_region 6336796..6336830 FT /rpt_family="(TTCA)n" FT repeat_region 6336843..6337328 FT /rpt_family="L2" FT repeat_region 6337456..6337491 FT /rpt_family="G-rich" FT repeat_region 6338361..6338655 FT /rpt_family="(TCCC)n" FT repeat_region 6338828..6338888 FT /rpt_family="(TA)n" FT repeat_region 6339745..6339780 FT /rpt_family="(CA)n" FT repeat_region 6340258..6340372 FT /rpt_family="L2" FT repeat_region 6340587..6340650 FT /rpt_family="MIR" FT repeat_region 6342233..6342645 FT /rpt_family="L2" FT repeat_region 6342791..6343085 FT /rpt_family="Alu" FT repeat_region 6343151..6343248 FT /rpt_family="MIR" FT repeat_region 6343250..6343693 FT /rpt_family="MaLR" FT repeat_region 6343713..6343808 FT /rpt_family="MER2_type" FT repeat_region 6343809..6343873 FT /rpt_family="(CA)n" FT repeat_region 6343874..6343943 FT /rpt_family="MER2_type" FT repeat_region 6343948..6344102 FT /rpt_family="MER2_type" FT repeat_region 6344106..6344234 FT /rpt_family="MIR" FT repeat_region 6344531..6344648 FT /rpt_family="MIR" FT repeat_region 6345189..6345448 FT /rpt_family="Alu" FT repeat_region 6345490..6345694 FT /rpt_family="L1" FT repeat_region 6346338..6346471 FT /rpt_family="L1" FT repeat_region 6346489..6346716 FT /rpt_family="L1" FT repeat_region 6347055..6347514 FT /rpt_family="MaLR" FT repeat_region 6347630..6347711 FT /rpt_family="L2" FT repeat_region 6348062..6348174 FT /rpt_family="L2" FT repeat_region 6348589..6348677 FT /rpt_family="L2" FT repeat_region 6348832..6348999 FT /rpt_family="MIR" FT repeat_region 6349209..6349288 FT /rpt_family="L2" FT repeat_region 6350440..6350618 FT /rpt_family="MaLR" FT repeat_region 6350660..6350762 FT /rpt_family="MIR" FT repeat_region 6350985..6351203 FT /rpt_family="MIR" FT repeat_region 6351309..6351427 FT /rpt_family="Alu" FT repeat_region 6351427..6351623 FT /rpt_family="Alu" FT repeat_region 6352450..6352545 FT /rpt_family="MaLR" FT repeat_region 6352750..6353056 FT /rpt_family="Alu" FT repeat_region 6353057..6353077 FT /rpt_family="AT_rich" FT repeat_region 6353998..6354050 FT /rpt_family="MIR" FT repeat_region 6354465..6354912 FT /rpt_family="MaLR" FT repeat_region 6356109..6356283 FT /rpt_family="L2" FT repeat_region 6356444..6356526 FT /rpt_family="MIR" FT repeat_region 6356848..6356941 FT /rpt_family="L2" FT repeat_region 6357045..6357109 FT /rpt_family="L1" FT repeat_region 6357110..6357258 FT /rpt_family="L1" FT repeat_region 6357436..6357745 FT /rpt_family="Alu" FT repeat_region 6358018..6358191 FT /rpt_family="MIR" FT repeat_region 6358191..6358417 FT /rpt_family="MIR" FT repeat_region 6358449..6358570 FT /rpt_family="MIR" FT repeat_region 6358610..6358725 FT /rpt_family="MIR" FT repeat_region 6358789..6358928 FT /rpt_family="MIR" FT repeat_region 6359089..6359241 FT /rpt_family="MER1_type" FT repeat_region 6359665..6361225 FT /rpt_family="L1" FT repeat_region 6361250..6361307 FT /rpt_family="MER1_type" FT repeat_region 6361308..6361344 FT /rpt_family="AT_rich" FT repeat_region 6361841..6362002 FT /rpt_family="MIR" FT repeat_region 6362481..6362860 FT /rpt_family="MaLR" FT repeat_region 6363099..6363319 FT /rpt_family="MIR" FT repeat_region 6364345..6364445 FT /rpt_family="MIR" FT repeat_region 6364524..6364768 FT /rpt_family="MIR" FT repeat_region 6364926..6365023 FT /rpt_family="AcHobo" FT repeat_region 6365024..6365335 FT /rpt_family="Alu" FT repeat_region 6365336..6365433 FT /rpt_family="AcHobo" FT repeat_region 6365724..6366266 FT /rpt_family="L2" FT repeat_region 6366300..6366496 FT /rpt_family="MIR" FT repeat_region 6366504..6366634 FT /rpt_family="L2" FT repeat_region 6366688..6366753 FT /rpt_family="Tip100" FT repeat_region 6366867..6366938 FT /rpt_family="L2" FT repeat_region 6366959..6367007 FT /rpt_family="MIR" FT repeat_region 6367807..6367908 FT /rpt_family="CR1" FT repeat_region 6368143..6368470 FT /rpt_family="L2" FT repeat_region 6368531..6368717 FT /rpt_family="L2" FT repeat_region 6369821..6370049 FT /rpt_family="L2" FT repeat_region 6370174..6370215 FT /rpt_family="L2" FT repeat_region 6370862..6371055 FT /rpt_family="MER1_type" FT repeat_region 6371065..6371310 FT /rpt_family="MER1_type" FT repeat_region 6371543..6371678 FT /rpt_family="L2" FT repeat_region 6371876..6372036 FT /rpt_family="MIR" FT repeat_region 6372147..6372246 FT /rpt_family="MaLR" FT repeat_region 6372844..6372946 FT /rpt_family="MIR" FT repeat_region 6373299..6373559 FT /rpt_family="MIR" FT repeat_region 6374625..6374694 FT /rpt_family="MIR" FT repeat_region 6374797..6374875 FT /rpt_family="MaLR" FT repeat_region 6374978..6375108 FT /rpt_family="MaLR" FT repeat_region 6375235..6375373 FT /rpt_family="L2" FT repeat_region 6375557..6375656 FT /rpt_family="(TG)n" FT repeat_region 6376145..6376365 FT /rpt_family="L2" FT repeat_region 6376427..6376545 FT /rpt_family="L2" FT repeat_region 6377133..6377265 FT /rpt_family="MIR" FT repeat_region 6377299..6377463 FT /rpt_family="MIR" FT repeat_region 6377750..6377961 FT /rpt_family="ERVL" FT repeat_region 6378014..6378098 FT /rpt_family="MIR" FT repeat_region 6378177..6378472 FT /rpt_family="Alu" FT repeat_region 6379101..6379407 FT /rpt_family="Alu" FT repeat_region 6380556..6380703 FT /rpt_family="MIR" FT repeat_region 6381396..6381585 FT /rpt_family="MIR" FT repeat_region 6381676..6381770 FT /rpt_family="C-rich" FT repeat_region 6383831..6383961 FT /rpt_family="MER1_type" FT repeat_region 6384238..6384349 FT /rpt_family="L2" FT repeat_region 6384350..6384403 FT /rpt_family="(TC)n" FT repeat_region 6384403..6384443 FT /rpt_family="(CA)n" FT repeat_region 6384404..6384665 FT /rpt_family="L2" FT repeat_region 6384763..6384875 FT /rpt_family="MaLR" FT repeat_region 6385122..6385569 FT /rpt_family="L2" FT repeat_region 6386084..6386212 FT /rpt_family="L1" FT repeat_region 6386213..6386302 FT /rpt_family="L1" FT repeat_region 6386303..6386332 FT /rpt_family="L1" FT repeat_region 6386577..6386729 FT /rpt_family="MIR" FT repeat_region 6387200..6387277 FT /rpt_family="L2" FT repeat_region 6387290..6387593 FT /rpt_family="Alu" FT repeat_region 6387720..6387770 FT /rpt_family="MIR" FT repeat_region 6387773..6389255 FT /rpt_family="L1" FT repeat_region 6389256..6389567 FT /rpt_family="Alu" FT repeat_region 6389568..6389583 FT /rpt_family="L1" FT repeat_region 6389603..6389700 FT /rpt_family="MIR" FT repeat_region 6390086..6390332 FT /rpt_family="MaLR" FT repeat_region 6390347..6390403 FT /rpt_family="Alu" FT repeat_region 6390410..6390633 FT /rpt_family="MaLR" FT repeat_region 6390791..6390937 FT /rpt_family="MIR" FT repeat_region 6391403..6391638 FT /rpt_family="MIR" FT repeat_region 6392970..6393070 FT /rpt_family="MIR" FT repeat_region 6393573..6393656 FT /rpt_family="MIR" FT repeat_region 6393782..6393961 FT /rpt_family="L1" FT repeat_region 6393962..6394471 FT /rpt_family="L2" FT repeat_region 6394766..6395190 FT /rpt_family="L1" FT repeat_region 6395795..6395926 FT /rpt_family="MER1_type" FT repeat_region 6395960..6396120 FT /rpt_family="MIR" FT repeat_region 6396276..6396331 FT /rpt_family="MIR" FT repeat_region 6396708..6396924 FT /rpt_family="L2" FT repeat_region 6397018..6397189 FT /rpt_family="L2" FT repeat_region 6398073..6398136 FT /rpt_family="MIR" FT repeat_region 6398340..6398451 FT /rpt_family="MIR" FT repeat_region 6398509..6398671 FT /rpt_family="AcHobo" FT repeat_region 6398698..6398776 FT /rpt_family="AcHobo" FT repeat_region 6399421..6399535 FT /rpt_family="MIR" FT repeat_region 6399548..6399818 FT /rpt_family="L1" FT repeat_region 6399823..6400975 FT /rpt_family="L1" FT repeat_region 6401818..6401886 FT /rpt_family="MER1_type" FT repeat_region 6401886..6402289 FT /rpt_family="MER1_type" FT repeat_region 6403628..6403825 FT /rpt_family="MIR" FT repeat_region 6404185..6404257 FT /rpt_family="CT-rich" FT repeat_region 6404285..6404510 FT /rpt_family="L2" FT repeat_region 6405347..6405607 FT /rpt_family="Alu" FT repeat_region 6405669..6405748 FT /rpt_family="MIR" FT repeat_region 6406317..6406418 FT /rpt_family="MER1_type" FT repeat_region 6406639..6406798 FT /rpt_family="MIR" FT repeat_region 6406831..6406945 FT /rpt_family="MIR" FT repeat_region 6407786..6407858 FT /rpt_family="MIR" FT repeat_region 6408176..6408515 FT /rpt_family="Alu" FT repeat_region 6408530..6408931 FT /rpt_family="MaLR" FT repeat_region 6409120..6409426 FT /rpt_family="Alu" FT repeat_region 6409562..6409858 FT /rpt_family="MER1_type" FT repeat_region 6410317..6410437 FT /rpt_family="MER1_type" FT repeat_region 6411409..6411525 FT /rpt_family="MIR" FT repeat_region 6411536..6411682 FT /rpt_family="L2" FT repeat_region 6412495..6412568 FT /rpt_family="MIR" FT repeat_region 6412569..6412898 FT /rpt_family="Alu" FT repeat_region 6412899..6413014 FT /rpt_family="MIR" FT repeat_region 6413272..6413394 FT /rpt_family="Alu" FT repeat_region 6413272..6413578 FT /rpt_family="Alu" FT repeat_region 6413678..6413721 FT /rpt_family="MIR" FT repeat_region 6414097..6414159 FT /rpt_family="MIR" FT repeat_region 6414231..6414296 FT /rpt_family="MIR" FT repeat_region 6414429..6414779 FT /rpt_family="MaLR" FT repeat_region 6414893..6415066 FT /rpt_family="(CA)n" FT repeat_region 6415483..6415581 FT /rpt_family="MIR" FT repeat_region 6415798..6415850 FT /rpt_family="(TG)n" FT repeat_region 6416446..6416586 FT /rpt_family="MIR" FT repeat_region 6417459..6417716 FT /rpt_family="CR1" FT repeat_region 6417787..6417913 FT /rpt_family="L2" FT repeat_region 6418000..6418104 FT /rpt_family="MIR" FT repeat_region 6419738..6419865 FT /rpt_family="MIR" FT repeat_region 6420029..6420192 FT /rpt_family="MIR" FT repeat_region 6420544..6420632 FT /rpt_family="L2" FT repeat_region 6420792..6420875 FT /rpt_family="MER1_type" FT repeat_region 6420890..6421184 FT /rpt_family="Alu" FT repeat_region 6421186..6421266 FT /rpt_family="MER1_type" FT repeat_region 6421357..6421725 FT /rpt_family="MaLR" FT repeat_region 6424017..6424153 FT /rpt_family="MIR" FT repeat_region 6424195..6424580 FT /rpt_family="MaLR" FT repeat_region 6424841..6424918 FT /rpt_family="L2" FT repeat_region 6424919..6425230 FT /rpt_family="Alu" FT repeat_region 6425231..6425547 FT /rpt_family="L2" FT repeat_region 6425628..6425666 FT /rpt_family="(TTAGGG)n" FT repeat_region 6426586..6426780 FT /rpt_family="MIR" FT repeat_region 6427513..6427589 FT /rpt_family="ERV1" FT repeat_region 6427593..6427660 FT /rpt_family="(TG)n" FT repeat_region 6428909..6428979 FT /rpt_family="L2" FT repeat_region 6429648..6429713 FT /rpt_family="MIR" FT repeat_region 6430486..6430647 FT /rpt_family="MIR" FT repeat_region 6430686..6430925 FT /rpt_family="MER1_type" FT repeat_region 6431670..6431730 FT /rpt_family="MIR" FT repeat_region 6431973..6432108 FT /rpt_family="MIR" FT repeat_region 6432370..6432681 FT /rpt_family="Alu" FT repeat_region 6432930..6433090 FT /rpt_family="AcHobo" FT repeat_region 6433535..6433856 FT /rpt_family="MaLR" FT repeat_region 6433939..6434041 FT /rpt_family="L2" FT repeat_region 6434273..6434530 FT /rpt_family="MER2_type" FT repeat_region 6434532..6434947 FT /rpt_family="MER2_type" FT repeat_region 6434962..6435164 FT /rpt_family="L1" FT repeat_region 6435393..6435633 FT /rpt_family="MIR" FT repeat_region 6435847..6436058 FT /rpt_family="L1" FT repeat_region 6436075..6436385 FT /rpt_family="Alu" FT repeat_region 6436433..6436674 FT /rpt_family="L1" FT repeat_region 6436696..6437228 FT /rpt_family="L1" FT repeat_region 6437624..6437987 FT /rpt_family="MaLR" FT repeat_region 6438383..6438600 FT /rpt_family="MER1_type" FT repeat_region 6438652..6438772 FT /rpt_family="MER1_type" FT repeat_region 6439095..6439231 FT /rpt_family="MIR" FT repeat_region 6442521..6442912 FT /rpt_family="ERVL" FT repeat_region 6444329..6444569 FT /rpt_family="MIR" FT repeat_region 6444660..6444719 FT /rpt_family="MIR" FT repeat_region 6445294..6445453 FT /rpt_family="MIR" FT repeat_region 6446060..6446168 FT /rpt_family="MIR" FT repeat_region 6446632..6446945 FT /rpt_family="Alu" FT repeat_region 6447297..6447466 FT /rpt_family="Alu" FT repeat_region 6447705..6447916 FT /rpt_family="MIR" FT repeat_region 6448174..6448297 FT /rpt_family="MIR" FT repeat_region 6448484..6448559 FT /rpt_family="MIR" FT repeat_region 6449244..6449264 FT /rpt_family="(CCCCCA)n" FT repeat_region 6449445..6449531 FT /rpt_family="MIR" FT repeat_region 6449872..6450005 FT /rpt_family="MIR" FT repeat_region 6450006..6450078 FT /rpt_family="Alu" FT repeat_region 6451157..6451177 FT /rpt_family="AT_rich" FT repeat_region 6451815..6451953 FT /rpt_family="MIR" FT repeat_region 6452677..6452758 FT /rpt_family="L2" FT repeat_region 6452755..6452977 FT /rpt_family="L2" FT repeat_region 6454240..6454279 FT /rpt_family="MIR" FT repeat_region 6455924..6456450 FT /rpt_family="MaLR" FT repeat_region 6456461..6456524 FT /rpt_family="MIR" FT repeat_region 6457805..6457956 FT /rpt_family="L1" FT repeat_region 6457972..6458087 FT /rpt_family="L1" FT repeat_region 6458604..6458652 FT /rpt_family="MER2_type" FT repeat_region 6458653..6458954 FT /rpt_family="Alu" FT repeat_region 6458955..6459101 FT /rpt_family="MER2_type" FT repeat_region 6459102..6459400 FT /rpt_family="Alu" FT repeat_region 6459401..6459972 FT /rpt_family="MER2_type" FT repeat_region 6459973..6460335 FT /rpt_family="MaLR" FT repeat_region 6460336..6460426 FT /rpt_family="MER2_type" FT repeat_region 6460606..6460713 FT /rpt_family="ERVL" FT repeat_region 6460768..6461139 FT /rpt_family="MaLR" FT repeat_region 6461387..6461528 FT /rpt_family="Alu" FT repeat_region 6461631..6461858 FT /rpt_family="L1" FT repeat_region 6461859..6462233 FT /rpt_family="MaLR" FT repeat_region 6462234..6462514 FT /rpt_family="L1" FT repeat_region 6462642..6462891 FT /rpt_family="L2" FT repeat_region 6463053..6463439 FT /rpt_family="MaLR" FT repeat_region 6463659..6463808 FT /rpt_family="MIR" FT repeat_region 6463948..6463973 FT /rpt_family="L1" FT repeat_region 6463974..6464233 FT /rpt_family="Alu" FT repeat_region 6464234..6464626 FT /rpt_family="L1" FT repeat_region 6464892..6465053 FT /rpt_family="MIR" FT repeat_region 6465724..6465943 FT /rpt_family="MIR" FT repeat_region 6466262..6466601 FT /rpt_family="L1" FT repeat_region 6466607..6466670 FT /rpt_family="GA-rich" FT repeat_region 6467215..6468155 FT /rpt_family="AcHobo" FT repeat_region 6468262..6468348 FT /rpt_family="L1" FT repeat_region 6468979..6469070 FT /rpt_family="MIR" FT repeat_region 6469071..6469215 FT /rpt_family="MIR" FT repeat_region 6469408..6469637 FT /rpt_family="MaLR" FT repeat_region 6469690..6469748 FT /rpt_family="MaLR" FT repeat_region 6470805..6470833 FT /rpt_family="(A)n" FT repeat_region 6470920..6471123 FT /rpt_family="L2" FT repeat_region 6471231..6471441 FT /rpt_family="MIR" FT repeat_region 6471824..6471925 FT /rpt_family="MIR" FT repeat_region 6471932..6472037 FT /rpt_family="L2" FT misc_feature 6472176..6474534 FT /note="CpG_island (%GC=71.6, o/e=0.80, #CpGs=238)" FT repeat_region 6472658..6472726 FT /rpt_family="GC_rich" FT repeat_region 6473719..6473781 FT /rpt_family="(GGGTG)n" FT repeat_region 6474059..6474082 FT /rpt_family="GC_rich" FT repeat_region 6474098..6474203 FT /rpt_family="(CGGG)n" FT repeat_region 6474354..6474417 FT /rpt_family="(CCG)n" FT repeat_region 6475079..6475112 FT /rpt_family="L2" FT repeat_region 6476432..6476470 FT /rpt_family="(CACCC)n" FT repeat_region 6476706..6476922 FT /rpt_family="L2" FT repeat_region 6476924..6476994 FT /rpt_family="G-rich" FT repeat_region 6477040..6477314 FT /rpt_family="L2" FT repeat_region 6477543..6477891 FT /rpt_family="MaLR" FT repeat_region 6477892..6478013 FT /rpt_family="L1" FT repeat_region 6478014..6478390 FT /rpt_family="MaLR" FT repeat_region 6478391..6478444 FT /rpt_family="L1" FT repeat_region 6478452..6478704 FT /rpt_family="L1" FT repeat_region 6478705..6478983 FT /rpt_family="Alu" FT repeat_region 6478984..6479128 FT /rpt_family="L1" FT repeat_region 6479172..6479480 FT /rpt_family="Alu" FT repeat_region 6479974..6480361 FT /rpt_family="MaLR" FT repeat_region 6480439..6480626 FT /rpt_family="MaLR" FT repeat_region 6481604..6481736 FT /rpt_family="Alu" FT repeat_region 6481786..6482051 FT /rpt_family="L1" FT repeat_region 6482052..6482257 FT /rpt_family="MER1_type" FT repeat_region 6482258..6483423 FT /rpt_family="L1" FT repeat_region 6483424..6483731 FT /rpt_family="Alu" FT repeat_region 6483732..6483906 FT /rpt_family="L1" FT repeat_region 6483907..6484165 FT /rpt_family="MIR" FT repeat_region 6484166..6484828 FT /rpt_family="L1" FT repeat_region 6484829..6484901 FT /rpt_family="(TAGA)n" FT repeat_region 6484902..6485057 FT /rpt_family="L1" FT repeat_region 6485083..6485620 FT /rpt_family="L1" FT repeat_region 6485621..6485827 FT /rpt_family="MER1_type" FT repeat_region 6485828..6490128 FT /rpt_family="L1" FT repeat_region 6490129..6490427 FT /rpt_family="Alu" FT repeat_region 6490428..6491094 FT /rpt_family="L1" FT repeat_region 6492541..6492729 FT /rpt_family="MIR" FT repeat_region 6492795..6492952 FT /rpt_family="L2" FT repeat_region 6493304..6493689 FT /rpt_family="MaLR" FT repeat_region 6493777..6493842 FT /rpt_family="MaLR" FT repeat_region 6494394..6494477 FT /rpt_family="ERVL" FT repeat_region 6494651..6494916 FT /rpt_family="L2" FT repeat_region 6494935..6494983 FT /rpt_family="(CA)n" FT repeat_region 6497106..6497165 FT /rpt_family="L2" FT repeat_region 6497355..6497446 FT /rpt_family="MIR" FT repeat_region 6497526..6497978 FT /rpt_family="MaLR" FT repeat_region 6498307..6498628 FT /rpt_family="Alu" FT repeat_region 6499022..6499734 FT /rpt_family="L1" FT repeat_region 6499912..6500097 FT /rpt_family="L1" FT repeat_region 6500652..6500702 FT /rpt_family="(TCTCCC)n" FT repeat_region 6501094..6501184 FT /rpt_family="L2" FT repeat_region 6501509..6501849 FT /rpt_family="L2" FT repeat_region 6501870..6502174 FT /rpt_family="Alu" FT repeat_region 6503301..6503332 FT /rpt_family="(TTCA)n" FT repeat_region 6503393..6503454 FT /rpt_family="MIR" FT repeat_region 6503564..6503686 FT /rpt_family="L2" FT repeat_region 6503685..6503975 FT /rpt_family="CR1" FT repeat_region 6504173..6504277 FT /rpt_family="CT-rich" FT repeat_region 6504534..6505205 FT /rpt_family="L2" FT repeat_region 6505349..6505536 FT /rpt_family="L1" FT repeat_region 6505545..6507399 FT /rpt_family="L1" FT repeat_region 6507411..6507730 FT /rpt_family="Alu" FT repeat_region 6507734..6508070 FT /rpt_family="L1" FT repeat_region 6508227..6508348 FT /rpt_family="L2" FT repeat_region 6508353..6508753 FT /rpt_family="MaLR" FT repeat_region 6508755..6508975 FT /rpt_family="L2" FT repeat_region 6508970..6509044 FT /rpt_family="MIR" FT repeat_region 6509113..6509486 FT /rpt_family="MaLR" FT repeat_region 6509552..6509656 FT /rpt_family="MIR" FT repeat_region 6509720..6509838 FT /rpt_family="Alu" FT repeat_region 6509853..6510031 FT /rpt_family="ERV1" FT repeat_region 6510032..6510345 FT /rpt_family="Alu" FT repeat_region 6510346..6510827 FT /rpt_family="ERV1" FT repeat_region 6511203..6511223 FT /rpt_family="AT_rich" FT repeat_region 6511451..6511573 FT /rpt_family="MIR" FT repeat_region 6511632..6512252 FT /rpt_family="L2" FT repeat_region 6512286..6512338 FT /rpt_family="(CA)n" FT repeat_region 6512365..6512422 FT /rpt_family="L2" FT repeat_region 6512423..6512733 FT /rpt_family="Alu" FT repeat_region 6512777..6512963 FT /rpt_family="MIR" FT unsure 6512953..6514479 FT /note="Unresolved tandem repeat." FT repeat_region 6512968..6513060 FT /rpt_family="(ATGGTG)n" FT repeat_region 6513078..6514430 FT /rpt_family="(TGG)n" FT repeat_region 6514862..6514898 FT /rpt_family="(TTCA)n" FT repeat_region 6516029..6516255 FT /rpt_family="MIR" FT repeat_region 6516425..6516869 FT /rpt_family="MaLR" FT repeat_region 6517121..6517367 FT /rpt_family="MIR" FT repeat_region 6517385..6517424 FT /rpt_family="MIR" FT repeat_region 6517416..6517475 FT /rpt_family="L2" FT repeat_region 6517520..6517899 FT /rpt_family="MaLR" FT repeat_region 6519037..6519175 FT /rpt_family="MIR" FT repeat_region 6519270..6519314 FT /rpt_family="MIR" FT repeat_region 6519581..6519658 FT /rpt_family="MIR" FT repeat_region 6519761..6520369 FT /rpt_family="L1" FT repeat_region 6520370..6520679 FT /rpt_family="Alu" FT repeat_region 6520680..6520845 FT /rpt_family="L1" FT repeat_region 6521126..6521295 FT /rpt_family="L2" FT repeat_region 6522477..6522693 FT /rpt_family="MIR" FT repeat_region 6522795..6522852 FT /rpt_family="MIR" FT repeat_region 6523070..6523152 FT /rpt_family="L1" FT repeat_region 6523504..6523584 FT /rpt_family="MIR" FT repeat_region 6524072..6524184 FT /rpt_family="MIR" FT repeat_region 6524647..6524772 FT /rpt_family="MIR" FT repeat_region 6524992..6525105 FT /rpt_family="MIR" FT repeat_region 6525113..6525629 FT /rpt_family="L1" FT repeat_region 6525630..6525948 FT /rpt_family="Alu" FT repeat_region 6525949..6526154 FT /rpt_family="L1" FT repeat_region 6526156..6526521 FT /rpt_family="ERV1" FT repeat_region 6526522..6526533 FT /rpt_family="ERV1" FT repeat_region 6526534..6526842 FT /rpt_family="Alu" FT repeat_region 6526850..6527163 FT /rpt_family="Alu" FT repeat_region 6527164..6527456 FT /rpt_family="ERV1" FT repeat_region 6527457..6527729 FT /rpt_family="Alu" FT repeat_region 6527730..6528149 FT /rpt_family="ERV1" FT repeat_region 6528159..6528266 FT /rpt_family="L1" FT repeat_region 6528753..6528870 FT /rpt_family="MIR" FT repeat_region 6528896..6529063 FT /rpt_family="MIR" FT repeat_region 6529408..6529462 FT /rpt_family="Tip100" FT repeat_region 6529579..6529854 FT /rpt_family="Tip100" FT repeat_region 6530334..6530738 FT /rpt_family="ERV1" FT repeat_region 6531180..6531257 FT /rpt_family="MIR" FT repeat_region 6531418..6531536 FT /rpt_family="L2" FT repeat_region 6531902..6532309 FT /rpt_family="ERV1" FT repeat_region 6532327..6532524 FT /rpt_family="MIR" FT repeat_region 6533939..6534108 FT /rpt_family="MIR" FT repeat_region 6534492..6534626 FT /rpt_family="ERVL" FT repeat_region 6535606..6535980 FT /rpt_family="(CA)n" FT repeat_region 6536002..6536068 FT /rpt_family="(CA)n" FT repeat_region 6536097..6536417 FT /rpt_family="(CA)n" FT repeat_region 6536592..6536677 FT /rpt_family="L2" FT repeat_region 6536774..6536873 FT /rpt_family="G-rich" FT repeat_region 6537288..6537352 FT /rpt_family="MIR" FT repeat_region 6537606..6537647 FT /rpt_family="L2" FT repeat_region 6538047..6538647 FT /rpt_family="L1" FT repeat_region 6538648..6538946 FT /rpt_family="Alu" FT repeat_region 6538947..6538976 FT /rpt_family="L1" FT repeat_region 6539205..6539271 FT /rpt_family="L1" FT repeat_region 6539272..6539576 FT /rpt_family="Alu" FT repeat_region 6539577..6539867 FT /rpt_family="L1" FT repeat_region 6539879..6540003 FT /rpt_family="MIR" FT repeat_region 6540561..6540642 FT /rpt_family="L2" FT repeat_region 6540709..6541181 FT /rpt_family="MaLR" FT repeat_region 6541504..6541628 FT /rpt_family="MIR" FT repeat_region 6541780..6542436 FT /rpt_family="L1" FT repeat_region 6542604..6543026 FT /rpt_family="MaLR" FT repeat_region 6543105..6543130 FT /rpt_family="(TTAA)n" FT repeat_region 6543266..6543556 FT /rpt_family="Alu" FT repeat_region 6543664..6543733 FT /rpt_family="L2" FT repeat_region 6543871..6543923 FT /rpt_family="MIR" FT repeat_region 6544100..6544139 FT /rpt_family="L1" FT repeat_region 6544140..6544457 FT /rpt_family="Alu" FT repeat_region 6544458..6544553 FT /rpt_family="L1" FT repeat_region 6544833..6545100 FT /rpt_family="ERVL" FT repeat_region 6545168..6545306 FT /rpt_family="Alu" FT repeat_region 6545865..6545962 FT /rpt_family="MaLR" FT repeat_region 6546070..6546363 FT /rpt_family="Alu" FT repeat_region 6546678..6546698 FT /rpt_family="AT_rich" FT repeat_region 6547283..6547391 FT /rpt_family="MIR" FT repeat_region 6547423..6547561 FT /rpt_family="MIR" FT repeat_region 6548138..6548273 FT /rpt_family="MIR" FT repeat_region 6548623..6548677 FT /rpt_family="GA-rich" FT repeat_region 6548841..6549087 FT /rpt_family="L1" FT repeat_region 6549439..6549590 FT /rpt_family="L1" FT repeat_region 6549594..6549662 FT /rpt_family="L1" FT repeat_region 6549663..6549976 FT /rpt_family="Alu" FT repeat_region 6549977..6550014 FT /rpt_family="L1" FT repeat_region 6550131..6550231 FT /rpt_family="L1" FT repeat_region 6550243..6550616 FT /rpt_family="ERVL" FT repeat_region 6550719..6550803 FT /rpt_family="L2" FT repeat_region 6550839..6551089 FT /rpt_family="L2" FT repeat_region 6551104..6551235 FT /rpt_family="L2" FT repeat_region 6551363..6551546 FT /rpt_family="MIR" FT repeat_region 6551820..6551926 FT /rpt_family="MIR" FT repeat_region 6552087..6552243 FT /rpt_family="L2" FT repeat_region 6552366..6552672 FT /rpt_family="Alu" FT repeat_region 6552761..6552984 FT /rpt_family="MIR" FT repeat_region 6553005..6553077 FT /rpt_family="L2" FT repeat_region 6553190..6553695 FT /rpt_family="MaLR" FT repeat_region 6553936..6554512 FT /rpt_family="MaLR" FT repeat_region 6554786..6555107 FT /rpt_family="ERVL" FT repeat_region 6555545..6555782 FT /rpt_family="ERVL" FT repeat_region 6555788..6556228 FT /rpt_family="MaLR" FT repeat_region 6556229..6556303 FT /rpt_family="MaLR" FT repeat_region 6556305..6556733 FT /rpt_family="Alu" FT repeat_region 6556734..6557007 FT /rpt_family="MaLR" FT repeat_region 6557049..6557130 FT /rpt_family="AcHobo" FT repeat_region 6557526..6557840 FT /rpt_family="ERVL" FT repeat_region 6557841..6558300 FT /rpt_family="ERVL" FT repeat_region 6558301..6558520 FT /rpt_family="ERVL" FT repeat_region 6558562..6558786 FT /rpt_family="ERVL" FT repeat_region 6559108..6559133 FT /rpt_family="(GAAA)n" FT repeat_region 6559194..6559403 FT /rpt_family="L2" FT repeat_region 6560898..6561106 FT /rpt_family="MIR" FT repeat_region 6561117..6561158 FT /rpt_family="(CA)n" FT repeat_region 6561297..6561636 FT /rpt_family="MaLR" FT repeat_region 6562176..6562357 FT /rpt_family="MIR" FT repeat_region 6562402..6563185 FT /rpt_family="Tip100" FT repeat_region 6563346..6563461 FT /rpt_family="(CA)n" FT repeat_region 6564089..6564173 FT /rpt_family="MIR" FT repeat_region 6564388..6564561 FT /rpt_family="MIR" FT misc_feature 6564752..6566215 FT /note="CpG_island (%GC=75.4, o/e=0.90, #CpGs=192)" FT repeat_region 6565191..6565267 FT /rpt_family="(CGGGG)n" FT repeat_region 6565344..6565456 FT /rpt_family="G-rich" FT repeat_region 6565515..6565549 FT /rpt_family="GC_rich" FT repeat_region 6565582..6565611 FT /rpt_family="GC_rich" FT repeat_region 6565631..6565795 FT /rpt_family="G-rich" FT repeat_region 6565897..6565983 FT /rpt_family="MIR" FT repeat_region 6566952..6567019 FT /rpt_family="MIR" FT repeat_region 6567414..6567514 FT /rpt_family="L2" FT repeat_region 6568692..6569284 FT /rpt_family="L2" FT repeat_region 6569328..6569380 FT /rpt_family="MaLR" FT repeat_region 6569393..6569687 FT /rpt_family="Alu" FT repeat_region 6569718..6570155 FT /rpt_family="ERVL" FT repeat_region 6570197..6570642 FT /rpt_family="MaLR" FT repeat_region 6570837..6571080 FT /rpt_family="ERVL" FT repeat_region 6571086..6571576 FT /rpt_family="Alu" FT repeat_region 6571577..6571730 FT /rpt_family="GA-rich" FT repeat_region 6571770..6571933 FT /rpt_family="GA-rich" FT repeat_region 6572007..6572246 FT /rpt_family="ERVL" FT repeat_region 6572249..6572551 FT /rpt_family="MaLR" FT repeat_region 6572557..6573353 FT /rpt_family="ERVL" FT repeat_region 6573496..6573695 FT /rpt_family="MaLR" FT repeat_region 6573696..6573815 FT /rpt_family="Alu" FT repeat_region 6573823..6574143 FT /rpt_family="Alu" FT repeat_region 6574144..6574216 FT /rpt_family="MaLR" FT repeat_region 6574217..6575091 FT /rpt_family="ERV1" FT repeat_region 6575092..6575160 FT /rpt_family="MaLR" FT repeat_region 6575186..6575522 FT /rpt_family="MaLR" FT repeat_region 6575939..6575988 FT /rpt_family="MIR" FT repeat_region 6576002..6576087 FT /rpt_family="MIR" FT repeat_region 6576090..6576385 FT /rpt_family="Alu" FT repeat_region 6576856..6576890 FT /rpt_family="GC_rich" FT repeat_region 6577178..6577298 FT /rpt_family="MIR" FT repeat_region 6577518..6577600 FT /rpt_family="MIR" FT repeat_region 6577619..6577729 FT /rpt_family="MIR" FT repeat_region 6578643..6578819 FT /rpt_family="MER1_type" FT repeat_region 6579283..6579391 FT /rpt_family="MIR" FT repeat_region 6579534..6579644 FT /rpt_family="L2" FT repeat_region 6579746..6579882 FT /rpt_family="L1" FT repeat_region 6579903..6580000 FT /rpt_family="L2" FT repeat_region 6580396..6580633 FT /rpt_family="MIR" FT repeat_region 6580681..6581108 FT /rpt_family="(CCA)n" FT repeat_region 6581125..6581313 FT /rpt_family="(CCA)n" FT repeat_region 6581301..6581485 FT /rpt_family="(CACCAT)n" FT repeat_region 6581633..6581756 FT /rpt_family="MIR" FT repeat_region 6582782..6582943 FT /rpt_family="MIR" FT repeat_region 6582994..6583169 FT /rpt_family="MIR" FT repeat_region 6584046..6584366 FT /rpt_family="Alu" FT repeat_region 6584415..6584473 FT /rpt_family="Alu" FT repeat_region 6584626..6585035 FT /rpt_family="MaLR" FT repeat_region 6585024..6585210 FT /rpt_family="MaLR" FT repeat_region 6585272..6585944 FT /rpt_family="ERV1" FT repeat_region 6586010..6586125 FT /rpt_family="MaLR" FT repeat_region 6586155..6586479 FT /rpt_family="ERV1" FT repeat_region 6586507..6586582 FT /rpt_family="MaLR" FT repeat_region 6587301..6587767 FT /rpt_family="MaLR" FT repeat_region 6587768..6588076 FT /rpt_family="Alu" FT repeat_region 6588224..6588559 FT /rpt_family="L1" FT repeat_region 6589417..6589458 FT /rpt_family="T-rich" FT repeat_region 6589472..6589786 FT /rpt_family="Alu" FT repeat_region 6589840..6590167 FT /rpt_family="MaLR" FT repeat_region 6590170..6590459 FT /rpt_family="Alu" FT repeat_region 6590472..6590589 FT /rpt_family="CR1" FT repeat_region 6590961..6591267 FT /rpt_family="Alu" FT repeat_region 6591336..6591495 FT /rpt_family="MIR" FT repeat_region 6591525..6591814 FT /rpt_family="Alu" FT repeat_region 6591817..6592110 FT /rpt_family="Alu" FT repeat_region 6592111..6592135 FT /rpt_family="(CAAT)n" FT repeat_region 6592594..6592890 FT /rpt_family="Alu" FT repeat_region 6592980..6593428 FT /rpt_family="ERVL" FT repeat_region 6593575..6593759 FT /rpt_family="MIR" FT repeat_region 6593944..6594024 FT /rpt_family="MIR" FT repeat_region 6594074..6594339 FT /rpt_family="Alu" FT repeat_region 6594467..6594677 FT /rpt_family="MER1_type" FT repeat_region 6595370..6595473 FT /rpt_family="MIR" FT repeat_region 6595484..6595732 FT /rpt_family="MIR" FT repeat_region 6595794..6595842 FT /rpt_family="AT_rich" FT repeat_region 6595888..6596122 FT /rpt_family="Alu" FT repeat_region 6596708..6596849 FT /rpt_family="L2" FT repeat_region 6597006..6597113 FT /rpt_family="MIR" FT repeat_region 6597114..6597473 FT /rpt_family="MaLR" FT repeat_region 6599311..6599489 FT /rpt_family="MIR" FT repeat_region 6599741..6599793 FT /rpt_family="MIR" FT repeat_region 6600158..6600280 FT /rpt_family="MIR" FT repeat_region 6600304..6600502 FT /rpt_family="MIR" FT repeat_region 6600656..6600746 FT /rpt_family="AcHobo" FT repeat_region 6600819..6601101 FT /rpt_family="Alu" FT repeat_region 6601108..6601410 FT /rpt_family="Alu" FT repeat_region 6601987..6602056 FT /rpt_family="MIR" FT repeat_region 6602562..6602627 FT /rpt_family="MIR" FT repeat_region 6602628..6602948 FT /rpt_family="ERV1" FT repeat_region 6602949..6603247 FT /rpt_family="Alu" FT repeat_region 6603248..6603538 FT /rpt_family="ERV1" FT repeat_region 6603958..6604301 FT /rpt_family="MaLR" FT repeat_region 6604392..6604702 FT /rpt_family="Alu" FT repeat_region 6605023..6605086 FT /rpt_family="L2" FT repeat_region 6605306..6605477 FT /rpt_family="L2" FT repeat_region 6606486..6606669 FT /rpt_family="CR1" FT repeat_region 6607384..6607429 FT /rpt_family="MIR" FT repeat_region 6607430..6607477 FT /rpt_family="(CCCA)n" FT repeat_region 6607482..6607660 FT /rpt_family="(TCCA)n" FT repeat_region 6607849..6607916 FT /rpt_family="GA-rich" FT repeat_region 6608648..6608931 FT /rpt_family="L1" FT repeat_region 6608932..6608952 FT /rpt_family="(ATTG)n" FT repeat_region 6608954..6609231 FT /rpt_family="Alu" FT repeat_region 6609232..6609926 FT /rpt_family="L1" FT repeat_region 6610260..6610424 FT /rpt_family="MIR" FT repeat_region 6611885..6612183 FT /rpt_family="Alu" FT repeat_region 6612225..6612405 FT /rpt_family="MIR" FT repeat_region 6612429..6612509 FT /rpt_family="MIR" FT repeat_region 6613111..6613228 FT /rpt_family="MIR" FT repeat_region 6613364..6613541 FT /rpt_family="Alu" FT repeat_region 6613898..6613964 FT /rpt_family="L2" FT repeat_region 6614511..6614893 FT /rpt_family="MaLR" FT repeat_region 6615034..6615320 FT /rpt_family="Alu" FT repeat_region 6615321..6615380 FT /rpt_family="G-rich" FT repeat_region 6615383..6615607 FT /rpt_family="GA-rich" FT repeat_region 6615623..6615748 FT /rpt_family="MIR" FT repeat_region 6616171..6616317 FT /rpt_family="MIR" FT repeat_region 6616845..6617005 FT /rpt_family="Alu" FT repeat_region 6617242..6617534 FT /rpt_family="Alu" FT repeat_region 6617535..6617830 FT /rpt_family="Alu" FT repeat_region 6617845..6617904 FT /rpt_family="MER1_type" FT repeat_region 6617971..6618037 FT /rpt_family="MIR" FT repeat_region 6618108..6618266 FT /rpt_family="MaLR" FT repeat_region 6618309..6618400 FT /rpt_family="MaLR" FT repeat_region 6618505..6618627 FT /rpt_family="MIR" FT repeat_region 6618632..6618992 FT /rpt_family="MaLR" FT repeat_region 6619400..6619574 FT /rpt_family="Alu" FT repeat_region 6619575..6619876 FT /rpt_family="Alu" FT repeat_region 6619877..6619997 FT /rpt_family="Alu" FT repeat_region 6620108..6620249 FT /rpt_family="MIR" FT repeat_region 6620715..6620779 FT /rpt_family="MIR" FT repeat_region 6621391..6621511 FT /rpt_family="MIR" FT repeat_region 6622389..6622424 FT /rpt_family="(GGGA)n" FT repeat_region 6623638..6624158 FT /rpt_family="L1" FT repeat_region 6624167..6624462 FT /rpt_family="Alu" FT repeat_region 6624809..6625095 FT /rpt_family="Alu" FT repeat_region 6625103..6625399 FT /rpt_family="Alu" FT repeat_region 6625643..6625947 FT /rpt_family="Alu" FT repeat_region 6625957..6626004 FT /rpt_family="(T)n" FT repeat_region 6626106..6626239 FT /rpt_family="Alu" FT repeat_region 6626240..6626533 FT /rpt_family="Alu" FT repeat_region 6626534..6626556 FT /rpt_family="(CA)n" FT repeat_region 6626565..6626592 FT /rpt_family="MaLR" FT repeat_region 6626593..6626852 FT /rpt_family="Alu" FT repeat_region 6626853..6627050 FT /rpt_family="MaLR" FT repeat_region 6627253..6627462 FT /rpt_family="Alu" FT repeat_region 6627512..6627794 FT /rpt_family="Alu" FT repeat_region 6627999..6628104 FT /rpt_family="ERV1" FT repeat_region 6628110..6628217 FT /rpt_family="MaLR" FT repeat_region 6628273..6628569 FT /rpt_family="Alu" FT repeat_region 6628695..6628996 FT /rpt_family="L1" FT repeat_region 6628997..6629151 FT /rpt_family="Alu" FT repeat_region 6629152..6629470 FT /rpt_family="Alu" FT repeat_region 6629471..6629646 FT /rpt_family="Alu" FT repeat_region 6629647..6629783 FT /rpt_family="L1" FT repeat_region 6629784..6629971 FT /rpt_family="MER1_type" FT repeat_region 6629972..6630029 FT /rpt_family="L1" FT repeat_region 6630030..6630101 FT /rpt_family="(TAGA)n" FT repeat_region 6630102..6630249 FT /rpt_family="L1" FT repeat_region 6630250..6630559 FT /rpt_family="Alu" FT repeat_region 6630560..6630615 FT /rpt_family="L1" FT repeat_region 6630617..6630668 FT /rpt_family="(GGGAA)n" FT repeat_region 6630672..6630874 FT /rpt_family="L1" FT repeat_region 6630937..6630959 FT /rpt_family="AT_rich" FT repeat_region 6631102..6631267 FT /rpt_family="MaLR" FT repeat_region 6631280..6631492 FT /rpt_family="MaLR" FT repeat_region 6631493..6631785 FT /rpt_family="Alu" FT repeat_region 6631786..6631824 FT /rpt_family="MaLR" FT repeat_region 6631847..6631992 FT /rpt_family="L1" FT repeat_region 6631993..6632306 FT /rpt_family="Alu" FT repeat_region 6632307..6632515 FT /rpt_family="L1" FT repeat_region 6632838..6632993 FT /rpt_family="MaLR" FT repeat_region 6633037..6633158 FT /rpt_family="ERV1" FT repeat_region 6633159..6633324 FT /rpt_family="Alu" FT repeat_region 6633325..6633829 FT /rpt_family="ERV1" FT repeat_region 6633830..6634044 FT /rpt_family="MaLR" FT repeat_region 6634134..6634351 FT /rpt_family="ERV1" FT repeat_region 6634352..6634645 FT /rpt_family="Alu" FT repeat_region 6634646..6634877 FT /rpt_family="ERV1" FT repeat_region 6635527..6635720 FT /rpt_family="L1" FT repeat_region 6635721..6636027 FT /rpt_family="Alu" FT repeat_region 6636028..6636296 FT /rpt_family="L1" FT repeat_region 6636297..6636592 FT /rpt_family="Alu" FT repeat_region 6636593..6636632 FT /rpt_family="L1" FT repeat_region 6636817..6637676 FT /rpt_family="L1" FT repeat_region 6637737..6637780 FT /rpt_family="ERV1" FT repeat_region 6640108..6640453 FT /rpt_family="ERV1" FT repeat_region 6640459..6640623 FT /rpt_family="ERV1" FT repeat_region 6641168..6641328 FT /rpt_family="Alu" FT repeat_region 6641355..6641665 FT /rpt_family="Alu" FT repeat_region 6641781..6642083 FT /rpt_family="Alu" FT misc_feature 6641852..6643322 FT /note="CpG_island (%GC=60.7, o/e=1.00, #CpGs=145)" FT repeat_region 6644793..6645204 FT /rpt_family="ERVL" FT repeat_region 6645489..6645605 FT /rpt_family="L1" FT repeat_region 6645766..6646023 FT /rpt_family="Alu" FT repeat_region 6646052..6646180 FT /rpt_family="Alu" FT repeat_region 6646190..6646360 FT /rpt_family="L1" FT repeat_region 6646592..6646881 FT /rpt_family="Alu" FT repeat_region 6646935..6647310 FT /rpt_family="MaLR" FT repeat_region 6647671..6648011 FT /rpt_family="MaLR" FT repeat_region 6648327..6648575 FT /rpt_family="L2" FT repeat_region 6648679..6648810 FT /rpt_family="MIR" FT repeat_region 6648823..6649254 FT /rpt_family="L2" FT repeat_region 6649444..6649530 FT /rpt_family="ERVL" FT repeat_region 6649934..6650239 FT /rpt_family="Alu" FT repeat_region 6650253..6650534 FT /rpt_family="Alu" FT repeat_region 6650850..6650970 FT /rpt_family="MaLR" FT repeat_region 6651039..6651290 FT /rpt_family="ERV1" FT repeat_region 6651291..6651592 FT /rpt_family="Alu" FT repeat_region 6651595..6651892 FT /rpt_family="Alu" FT repeat_region 6651893..6652119 FT /rpt_family="ERV1" FT repeat_region 6652131..6652314 FT /rpt_family="L1" FT repeat_region 6652333..6652730 FT /rpt_family="MaLR" FT repeat_region 6652759..6652779 FT /rpt_family="AT_rich" FT repeat_region 6652966..6653273 FT /rpt_family="Alu" FT repeat_region 6653284..6653496 FT /rpt_family="Alu" FT repeat_region 6653525..6653768 FT /rpt_family="L1" FT repeat_region 6653793..6654072 FT /rpt_family="Alu" FT repeat_region 6654095..6654348 FT /rpt_family="L1" FT repeat_region 6654349..6654510 FT /rpt_family="L1" FT repeat_region 6654512..6654821 FT /rpt_family="Alu" FT repeat_region 6654827..6654993 FT /rpt_family="MaLR" FT repeat_region 6654994..6655098 FT /rpt_family="L1" FT repeat_region 6655099..6655401 FT /rpt_family="Alu" FT repeat_region 6655402..6655553 FT /rpt_family="L1" FT repeat_region 6655554..6655791 FT /rpt_family="L1" FT repeat_region 6655880..6655940 FT /rpt_family="L1" FT repeat_region 6656037..6656045 FT /rpt_family="(TTAGGG)n" FT repeat_region 6656046..6657540 FT /rpt_family="L1" FT repeat_region 6657541..6657564 FT /rpt_family="(TTAGGG)n" FT repeat_region 6657658..6658005 FT /rpt_family="MaLR" FT repeat_region 6658013..6658033 FT /rpt_family="GC_rich" FT repeat_region 6658064..6658406 FT /rpt_family="MaLR" FT repeat_region 6658804..6659104 FT /rpt_family="Alu" FT repeat_region 6659800..6660370 FT /rpt_family="ERV1" FT repeat_region 6661021..6661321 FT /rpt_family="Alu" FT repeat_region 6661326..6661623 FT /rpt_family="Alu" FT repeat_region 6661767..6661999 FT /rpt_family="ERV1" FT repeat_region 6661969..6662143 FT /rpt_family="ERV1" FT repeat_region 6662156..6662572 FT /rpt_family="(GGA)n" FT repeat_region 6662574..6662866 FT /rpt_family="Alu" FT repeat_region 6663506..6663817 FT /rpt_family="Alu" FT repeat_region 6664206..6664367 FT /rpt_family="L2" FT repeat_region 6664432..6664589 FT /rpt_family="MIR" FT repeat_region 6664671..6664801 FT /rpt_family="ERVL" FT repeat_region 6664806..6665293 FT /rpt_family="MaLR" FT repeat_region 6665303..6665508 FT /rpt_family="ERVL" FT misc_feature 6665672..6666650 FT /note="CpG_island (%GC=66.4, o/e=0.80, #CpGs=87)" FT repeat_region 6666113..6666411 FT /rpt_family="Alu" FT repeat_region 6666592..6667334 FT /rpt_family="(CA)n" FT repeat_region 6667386..6667670 FT /rpt_family="Alu" FT repeat_region 6668217..6668248 FT /rpt_family="MaLR" FT repeat_region 6668249..6668538 FT /rpt_family="Alu" FT repeat_region 6668539..6668584 FT /rpt_family="MaLR" FT repeat_region 6668585..6668895 FT /rpt_family="Alu" FT repeat_region 6668896..6669162 FT /rpt_family="MaLR" FT repeat_region 6669165..6669463 FT /rpt_family="MaLR" FT repeat_region 6669603..6669877 FT /rpt_family="Alu" FT repeat_region 6669900..6670159 FT /rpt_family="MaLR" FT repeat_region 6670806..6671100 FT /rpt_family="Alu" FT repeat_region 6671343..6671693 FT /rpt_family="MaLR" FT repeat_region 6671841..6671948 FT /rpt_family="MaLR" FT repeat_region 6672097..6672203 FT /rpt_family="MER1_type" FT repeat_region 6672339..6672486 FT /rpt_family="MaLR" FT repeat_region 6672797..6672810 FT /rpt_family="MaLR" FT repeat_region 6672811..6673173 FT /rpt_family="MaLR" FT repeat_region 6673174..6673349 FT /rpt_family="MaLR" FT repeat_region 6673445..6673598 FT /rpt_family="L2" FT repeat_region 6673630..6673711 FT /rpt_family="L2" FT repeat_region 6673927..6674242 FT /rpt_family="Alu" FT repeat_region 6674268..6675474 FT /rpt_family="ERV1" FT misc_feature 6675594..6676407 FT /note="CpG_island (%GC=73.5, o/e=0.80, #CpGs=109)" FT repeat_region 6675635..6675686 FT /rpt_family="(CG)n" FT repeat_region 6676001..6676024 FT /rpt_family="GC_rich" FT repeat_region 6678176..6678306 FT /rpt_family="Alu" FT repeat_region 6678444..6678619 FT /rpt_family="L2" FT repeat_region 6678934..6679034 FT /rpt_family="AcHobo" FT repeat_region 6679573..6679640 FT /rpt_family="MIR" FT repeat_region 6679770..6680087 FT /rpt_family="Alu" FT repeat_region 6680432..6680559 FT /rpt_family="L2" FT repeat_region 6680747..6681051 FT /rpt_family="Alu" FT repeat_region 6681306..6681456 FT /rpt_family="MIR" FT repeat_region 6681976..6682129 FT /rpt_family="L1" FT repeat_region 6682193..6682314 FT /rpt_family="L2" FT repeat_region 6682341..6682517 FT /rpt_family="L2" FT repeat_region 6683748..6683874 FT /rpt_family="MIR" FT repeat_region 6683943..6684245 FT /rpt_family="Alu" FT repeat_region 6684288..6684415 FT /rpt_family="L1" FT repeat_region 6685373..6685632 FT /rpt_family="Alu" FT repeat_region 6685647..6685941 FT /rpt_family="Alu" FT repeat_region 6686842..6686861 FT /rpt_family="(TG)n" FT repeat_region 6686909..6687274 FT /rpt_family="ERVL" FT repeat_region 6687313..6687441 FT /rpt_family="MIR" FT repeat_region 6687938..6688046 FT /rpt_family="MIR" FT repeat_region 6688243..6688359 FT /rpt_family="Alu" FT repeat_region 6689004..6689132 FT /rpt_family="MER1_type" FT repeat_region 6689133..6689629 FT /rpt_family="ERV1" FT repeat_region 6689630..6689654 FT /rpt_family="MER1_type" FT repeat_region 6689667..6689862 FT /rpt_family="L2" FT repeat_region 6690224..6690638 FT /rpt_family="MaLR" FT repeat_region 6691158..6691231 FT /rpt_family="MIR" FT repeat_region 6692438..6692726 FT /rpt_family="Alu" FT repeat_region 6693057..6693218 FT /rpt_family="Alu" FT repeat_region 6693222..6693534 FT /rpt_family="Alu" FT repeat_region 6693554..6693736 FT /rpt_family="Alu" FT repeat_region 6693738..6693761 FT /rpt_family="(CAAA)n" FT repeat_region 6693765..6693813 FT /rpt_family="(TATATG)n" FT repeat_region 6693815..6693884 FT /rpt_family="L1" FT repeat_region 6694540..6695102 FT /rpt_family="ERV1" FT repeat_region 6696463..6696547 FT /rpt_family="CT-rich" FT repeat_region 6696680..6696992 FT /rpt_family="Alu" FT repeat_region 6698059..6698150 FT /rpt_family="MIR" FT repeat_region 6699270..6699562 FT /rpt_family="Alu" FT repeat_region 6699578..6699881 FT /rpt_family="Alu" FT repeat_region 6700401..6700483 FT /rpt_family="Alu" FT repeat_region 6700485..6700802 FT /rpt_family="Alu" FT repeat_region 6700804..6700918 FT /rpt_family="Alu" FT repeat_region 6701021..6701164 FT /rpt_family="ERVL" FT repeat_region 6701680..6701995 FT /rpt_family="Alu" FT repeat_region 6702170..6702299 FT /rpt_family="Alu" FT repeat_region 6702379..6702813 FT /rpt_family="L1" FT repeat_region 6702817..6703154 FT /rpt_family="Alu" FT repeat_region 6703443..6703747 FT /rpt_family="Alu" FT repeat_region 6703814..6703995 FT /rpt_family="L1" FT repeat_region 6703996..6704303 FT /rpt_family="Alu" FT repeat_region 6704309..6704374 FT /rpt_family="L1" FT repeat_region 6704354..6704960 FT /rpt_family="L1" FT repeat_region 6705317..6705367 FT /rpt_family="(TAAA)n" FT repeat_region 6705566..6706200 FT /rpt_family="MER2_type" FT repeat_region 6706582..6706750 FT /rpt_family="L2" FT repeat_region 6706780..6707022 FT /rpt_family="L2" FT repeat_region 6707093..6707382 FT /rpt_family="L2" FT repeat_region 6707459..6707808 FT /rpt_family="Tc2" FT repeat_region 6707946..6708027 FT /rpt_family="(TATG)n" FT repeat_region 6708106..6708291 FT /rpt_family="MaLR" FT misc_feature 6710949..6711793 FT /note="CpG_island (%GC=58.1, o/e=0.90, #CpGs=72)" FT repeat_region 6711899..6711982 FT /rpt_family="MIR" FT repeat_region 6712293..6712395 FT /rpt_family="L2" FT repeat_region 6712670..6713030 FT /rpt_family="L1" FT repeat_region 6713031..6713429 FT /rpt_family="MaLR" FT repeat_region 6713430..6713662 FT /rpt_family="L1" FT repeat_region 6713684..6713747 FT /rpt_family="MaLR" FT repeat_region 6713748..6713960 FT /rpt_family="MaLR" FT repeat_region 6713961..6714261 FT /rpt_family="Alu" FT repeat_region 6714272..6714570 FT /rpt_family="Alu" FT repeat_region 6714571..6714664 FT /rpt_family="MaLR" FT repeat_region 6714665..6715078 FT /rpt_family="MaLR" FT repeat_region 6715079..6715147 FT /rpt_family="MaLR" FT repeat_region 6715157..6715386 FT /rpt_family="MaLR" FT repeat_region 6715387..6715690 FT /rpt_family="ERV1" FT repeat_region 6715691..6715713 FT /rpt_family="(TTTC)n" FT repeat_region 6715720..6716023 FT /rpt_family="Alu" FT repeat_region 6716024..6716200 FT /rpt_family="ERV1" FT repeat_region 6716201..6716397 FT /rpt_family="MaLR" FT repeat_region 6716404..6717533 FT /rpt_family="MaLR" FT repeat_region 6717536..6717691 FT /rpt_family="L1" FT misc_feature 6717716..6718549 FT /note="CpG_island (%GC=71.1, o/e=0.90, #CpGs=112)" FT repeat_region 6717735..6717894 FT /rpt_family="(CG)n" FT repeat_region 6718089..6718145 FT /rpt_family="(CCGCG)n" FT repeat_region 6718155..6718177 FT /rpt_family="GC_rich" FT repeat_region 6718785..6718898 FT /rpt_family="Alu" FT repeat_region 6719132..6719152 FT /rpt_family="AT_rich" FT repeat_region 6719544..6719866 FT /rpt_family="Alu" FT repeat_region 6720399..6720685 FT /rpt_family="Alu" FT repeat_region 6720737..6720973 FT /rpt_family="L2" FT repeat_region 6721628..6721920 FT /rpt_family="Alu" FT repeat_region 6722495..6722642 FT /rpt_family="L2" FT repeat_region 6723219..6723251 FT /rpt_family="(TC)n" FT repeat_region 6723407..6723691 FT /rpt_family="Alu" FT repeat_region 6723692..6723735 FT /rpt_family="(CA)n" FT repeat_region 6723858..6723891 FT /rpt_family="(TG)n" FT repeat_region 6724144..6724261 FT /rpt_family="MIR" FT repeat_region 6724357..6724819 FT /rpt_family="L1" FT repeat_region 6725912..6725995 FT /rpt_family="MIR" FT repeat_region 6726147..6726427 FT /rpt_family="MaLR" FT repeat_region 6727208..6727394 FT /rpt_family="(CA)n" FT repeat_region 6727445..6727929 FT /rpt_family="(CA)n" FT repeat_region 6727949..6728095 FT /rpt_family="(CA)n" FT repeat_region 6728111..6728155 FT /rpt_family="MIR" FT repeat_region 6728156..6728449 FT /rpt_family="Alu" FT repeat_region 6728450..6728566 FT /rpt_family="MIR" FT repeat_region 6729341..6729590 FT /rpt_family="C-rich" FT repeat_region 6729591..6729831 FT /rpt_family="L2" FT repeat_region 6730136..6730245 FT /rpt_family="L2" FT misc_feature 6783873..6785603 FT /note="CpG_island (%GC=77.8, o/e=0.81, #CpGs=221)" FT misc_feature 6838800..6839512 FT /note="CpG_island (%GC=69.4, o/e=0.72, #CpGs=58)" FT misc_feature 6910916..6912310 FT /note="CpG_island (%GC=74.3, o/e=0.95, #CpGs=180)" FT gene 6911572..6911678 FT /gene="KIAA1322" FT mRNA 6911572..6911678 FT /gene="KIAA1322" FT /product="unknown" FT /note="Homo sapiens TBC1 domain family, member 14 FT (TBC1D14), mRNA.; H_NH0029H20.1 This gene was based on FT gi(29789113) Continues as H_NH0326F06.1" FT repeat_region 6913686..6913797 FT /rpt_family="Alu" FT repeat_region 6913836..6914135 FT /rpt_family="Alu" FT repeat_region 6914172..6914264 FT /rpt_family="MIR" FT repeat_region 6914433..6914673 FT /rpt_family="MIR" FT repeat_region 6914708..6915021 FT /rpt_family="Alu" FT repeat_region 6915208..6915305 FT /rpt_family="MIR" FT repeat_region 6915574..6915689 FT /rpt_family="Alu" FT repeat_region 6915690..6915709 FT /rpt_family="(CAA)n" FT repeat_region 6915710..6915877 FT /rpt_family="Alu" FT repeat_region 6916485..6916787 FT /rpt_family="Alu" FT repeat_region 6917226..6917408 FT /rpt_family="MIR" FT repeat_region 6917560..6917870 FT /rpt_family="Alu" FT repeat_region 6919174..6919206 FT /rpt_family="L2" FT repeat_region 6920172..6920380 FT /rpt_family="MIR" FT repeat_region 6920880..6921166 FT /rpt_family="Alu" FT repeat_region 6921325..6921339 FT /rpt_family="Alu" FT repeat_region 6921340..6921645 FT /rpt_family="Alu" FT repeat_region 6921646..6921855 FT /rpt_family="Alu" FT repeat_region 6921996..6922166 FT /rpt_family="Alu" FT repeat_region 6922508..6922806 FT /rpt_family="Alu" FT repeat_region 6922926..6923231 FT /rpt_family="Alu" FT repeat_region 6923246..6923420 FT /rpt_family="Alu" FT repeat_region 6923421..6923721 FT /rpt_family="Alu" FT repeat_region 6923773..6923995 FT /rpt_family="Alu" FT repeat_region 6924146..6924270 FT /rpt_family="MIR" FT repeat_region 6924646..6924940 FT /rpt_family="Alu" FT repeat_region 6926738..6927019 FT /rpt_family="Alu" FT repeat_region 6927564..6927664 FT /rpt_family="MER1_type" FT repeat_region 6927744..6927814 FT /rpt_family="MIR" FT repeat_region 6927895..6928031 FT /rpt_family="MIR" FT repeat_region 6928458..6928531 FT /rpt_family="MIR" FT repeat_region 6928922..6928971 FT /rpt_family="L2" FT repeat_region 6929033..6929142 FT /rpt_family="MIR" FT repeat_region 6929337..6929544 FT /rpt_family="MER1_type" FT repeat_region 6929886..6930009 FT /rpt_family="L2" FT repeat_region 6930027..6930079 FT /rpt_family="L2" FT repeat_region 6930117..6930276 FT /rpt_family="MIR" FT repeat_region 6930278..6930419 FT /rpt_family="Alu" FT repeat_region 6930453..6930544 FT /rpt_family="MIR" FT repeat_region 6932243..6932539 FT /rpt_family="Alu" FT repeat_region 6932616..6932925 FT /rpt_family="Alu" FT repeat_region 6933096..6933146 FT /rpt_family="L2" FT repeat_region 6933431..6933475 FT /rpt_family="L2" FT repeat_region 6933493..6933805 FT /rpt_family="L2" FT repeat_region 6933806..6934118 FT /rpt_family="Alu" FT repeat_region 6934119..6934344 FT /rpt_family="L2" FT repeat_region 6934345..6934508 FT /rpt_family="Alu" FT repeat_region 6934509..6934536 FT /rpt_family="L2" FT repeat_region 6934542..6934970 FT /rpt_family="MaLR" FT repeat_region 6934971..6935042 FT /rpt_family="C-rich" FT repeat_region 6935043..6935334 FT /rpt_family="Alu" FT repeat_region 6935353..6935480 FT /rpt_family="MaLR" FT repeat_region 6935481..6936149 FT /rpt_family="L2" FT repeat_region 6936150..6936412 FT /rpt_family="Alu" FT repeat_region 6936413..6936522 FT /rpt_family="L2" FT repeat_region 6936523..6936842 FT /rpt_family="Alu" FT repeat_region 6936843..6936994 FT /rpt_family="L2" FT repeat_region 6936995..6937017 FT /rpt_family="(TTTG)n" FT repeat_region 6937018..6937208 FT /rpt_family="L2" FT repeat_region 6937246..6937311 FT /rpt_family="CT-rich" FT repeat_region 6937376..6937670 FT /rpt_family="Alu" FT repeat_region 6937703..6938528 FT /rpt_family="L1" FT repeat_region 6938607..6938625 FT /rpt_family="MaLR" FT repeat_region 6938626..6938943 FT /rpt_family="Alu" FT repeat_region 6938944..6939232 FT /rpt_family="MaLR" FT repeat_region 6939255..6939525 FT /rpt_family="L2" FT repeat_region 6940818..6940928 FT /rpt_family="MIR" FT repeat_region 6941511..6941658 FT /rpt_family="L2" FT repeat_region 6941832..6942026 FT /rpt_family="MER1_type" FT repeat_region 6942634..6942664 FT /rpt_family="(TGAA)n" FT repeat_region 6942908..6943211 FT /rpt_family="Alu" FT repeat_region 6945283..6945375 FT /rpt_family="L2" FT repeat_region 6947194..6947506 FT /rpt_family="Alu" FT repeat_region 6947574..6947744 FT /rpt_family="MER1_type" FT repeat_region 6947820..6947964 FT /rpt_family="L2" FT repeat_region 6948049..6948347 FT /rpt_family="Alu" FT repeat_region 6948413..6948528 FT /rpt_family="MIR" FT repeat_region 6948807..6948942 FT /rpt_family="Alu" FT repeat_region 6948943..6949239 FT /rpt_family="Alu" FT repeat_region 6949240..6949406 FT /rpt_family="Alu" FT repeat_region 6949893..6950206 FT /rpt_family="L1" FT repeat_region 6950435..6950636 FT /rpt_family="Alu" FT repeat_region 6950643..6950909 FT /rpt_family="Alu" FT repeat_region 6950910..6950954 FT /rpt_family="Alu" FT repeat_region 6950955..6951127 FT /rpt_family="L1" FT repeat_region 6951128..6951424 FT /rpt_family="Alu" FT repeat_region 6951425..6951622 FT /rpt_family="L1" FT repeat_region 6951623..6951985 FT /rpt_family="L1" FT repeat_region 6951986..6952684 FT /rpt_family="L1" FT repeat_region 6952739..6953057 FT /rpt_family="Alu" FT repeat_region 6953118..6953243 FT /rpt_family="Alu" FT repeat_region 6953490..6953583 FT /rpt_family="L1" FT repeat_region 6953902..6954081 FT /rpt_family="MER1_type" FT repeat_region 6954094..6954191 FT /rpt_family="L2" FT repeat_region 6954563..6954740 FT /rpt_family="Alu" FT repeat_region 6954741..6955049 FT /rpt_family="Alu" FT repeat_region 6955067..6955381 FT /rpt_family="Alu" FT repeat_region 6955561..6955599 FT /rpt_family="L2" FT repeat_region 6956339..6956631 FT /rpt_family="Alu" FT repeat_region 6957053..6957195 FT /rpt_family="MIR" FT repeat_region 6957728..6957849 FT /rpt_family="L2" FT repeat_region 6957871..6957957 FT /rpt_family="Tip100" FT repeat_region 6958064..6958174 FT /rpt_family="MER1_type" FT repeat_region 6959398..6959624 FT /rpt_family="Alu" FT repeat_region 6959632..6959660 FT /rpt_family="(TAAA)n" FT repeat_region 6960097..6960130 FT /rpt_family="(CA)n" FT repeat_region 6960148..6960461 FT /rpt_family="Alu" FT repeat_region 6960617..6960911 FT /rpt_family="Alu" FT repeat_region 6961809..6962118 FT /rpt_family="Alu" FT repeat_region 6965533..6965822 FT /rpt_family="Alu" FT repeat_region 6966339..6966413 FT /rpt_family="Alu" FT repeat_region 6966544..6966886 FT /rpt_family="L1" FT repeat_region 6966888..6967048 FT /rpt_family="Alu" FT repeat_region 6967050..6967255 FT /rpt_family="L1" FT repeat_region 6967293..6967538 FT /rpt_family="Alu" FT repeat_region 6967542..6968027 FT /rpt_family="L1" FT repeat_region 6968297..6968458 FT /rpt_family="MIR" FT repeat_region 6968531..6968835 FT /rpt_family="Alu" FT repeat_region 6970096..6970318 FT /rpt_family="MIR" FT repeat_region 6971133..6971431 FT /rpt_family="Alu" FT repeat_region 6971936..6972169 FT /rpt_family="MIR" FT repeat_region 6972873..6972980 FT /rpt_family="MIR" FT repeat_region 6973369..6973552 FT /rpt_family="MER1_type" FT repeat_region 6974096..6974265 FT /rpt_family="L2" FT repeat_region 6974303..6974489 FT /rpt_family="MER1_type" FT repeat_region 6975191..6975539 FT /rpt_family="L1" FT repeat_region 6975540..6975841 FT /rpt_family="Alu" FT repeat_region 6975842..6976562 FT /rpt_family="L1" FT repeat_region 6976629..6976940 FT /rpt_family="Alu" FT repeat_region 6976943..6977237 FT /rpt_family="Alu" FT repeat_region 6977252..6977537 FT /rpt_family="L1" FT repeat_region 6977538..6977838 FT /rpt_family="Alu" FT repeat_region 6977839..6978500 FT /rpt_family="L1" FT repeat_region 6978761..6978803 FT /rpt_family="CT-rich" FT misc_feature 6978972..6979910 FT /note="CpG_island (%GC=68.4, o/e=0.70, #CpGs=74)" FT repeat_region 6980594..6981071 FT /rpt_family="L1" FT repeat_region 6981072..6981360 FT /rpt_family="Alu" FT repeat_region 6981361..6982442 FT /rpt_family="L1" FT repeat_region 6982443..6982741 FT /rpt_family="Alu" FT repeat_region 6982750..6983046 FT /rpt_family="Alu" FT repeat_region 6983047..6983747 FT /rpt_family="L1" FT repeat_region 6983745..6984313 FT /rpt_family="L1" FT repeat_region 6984351..6984492 FT /rpt_family="L1" FT repeat_region 6984757..6984998 FT /rpt_family="Alu" FT repeat_region 6984999..6985025 FT /rpt_family="AT_rich" FT repeat_region 6985870..6985974 FT /rpt_family="MIR" FT repeat_region 6986792..6987127 FT /rpt_family="L1" FT repeat_region 6987130..6987546 FT /rpt_family="ERV1" FT repeat_region 6987613..6988205 FT /rpt_family="L1" FT misc_feature 6988148..6988807 FT /note="match to EST BG701695 (NID:g13972292)" FT misc_feature 6988148..6988486 FT /note="match to EST BF820053 (NID:g12158282)" FT misc_feature 6988306..6989373 FT /note="CpG_island (%GC=64.7, o/e=0.90, #CpGs=102)" FT misc_feature 6988350..6988765 FT /note="match to EST AA009883 (NID:g1470910) ze83b02.r1" FT misc_feature 6988461..6988667 FT /note="match to EST BE828154 (NID:g10260532)" FT repeat_region 6988933..6988953 FT /rpt_family="GC_rich" FT repeat_region 6988964..6988991 FT /rpt_family="GC_rich" FT misc_feature 6988997..6989076 FT /note="similar to Mus musculus EST BF782356 FT (NID:g12087392)" FT misc_feature 6989018..6989076 FT /note="similar to Mus musculus EST BE382092 (NID:g9327457)" FT misc_feature 6989026..6989076 FT /note="match to EST BG914339 (NID:g14294815)" FT misc_feature 6990130..6990507 FT /note="match to EST BF806825 (NID:g12135814)" FT repeat_region 6990586..6990635 FT /rpt_family="(T)n" FT repeat_region 6990606..6990766 FT /rpt_family="Alu" FT misc_feature 6990613..6990625 FT /note="match to EST AW451321 (NID:g6992097)" FT misc_feature 6990613..6990624 FT /note="match to EST AI096903 (NID:g3446485) qb58h04.x1" FT misc_feature 6990898..6991176 FT /note="match to EST BI053040 (NID:g14460570)" FT misc_feature 6990951..6991232 FT /note="match to EST BF817308 (NID:g12153848)" FT misc_feature 6991161..6991330 FT /note="match to EST AA330767 (NID:g1983009)" FT misc_feature 6991215 FT /note="match to EST BI053040 (NID:g14460570)" FT repeat_region 6991895..6992189 FT /rpt_family="Alu" FT misc_feature 6992919..6992924 FT /note="match to EST AW295138 (NID:g6701774)" FT repeat_region 6993880..6993999 FT /rpt_family="MIR" FT repeat_region 6994098..6994237 FT /rpt_family="MIR" FT misc_feature 6994486..6995079 FT /note="match to EST AW852743 (NID:g7948260)" FT repeat_region 6995455..6995744 FT /rpt_family="Alu" FT misc_feature 6995903..6996029 FT /note="match to EST BF948085 (NID:g12365360)" FT misc_feature 6995909..6996029 FT /note="match to EST BG910318 (NID:g14290794)" FT misc_feature 6995910..6996029 FT /note="similar to Mus musculus EST BF161232 FT (NID:g11041339)" FT /note="similar to Gallus gallus EST BI391582 FT (NID:g15084864)" FT misc_feature 6995911..6996029 FT /note="similar to Mus musculus EST BF782356 FT (NID:g12087392)" FT /note="similar to Mus musculus EST BE382092 (NID:g9327457)" FT /note="match to EST BG914339 (NID:g14294815)" FT misc_feature 6996014..6996029 FT /note="match to EST AW503868 (NID:g7141535)" FT repeat_region 6996294..6996611 FT /rpt_family="Alu" FT repeat_region 6997234..6997537 FT /rpt_family="Alu" FT misc_feature 6997238..6997273 FT /note="match to EST BG941859 (NID:g14341231) ax18b10.x1" FT repeat_region 6997549..6997581 FT /rpt_family="AT_rich" FT repeat_region 6997568..6997851 FT /rpt_family="Alu" FT misc_feature 6997860..6998008 FT /note="match to EST AW883890 (NID:g8045902)" FT misc_feature 6998050..6998134 FT /note="match to EST AA299989 (NID:g1952559)" FT misc_feature 6998052..6998134 FT /note="similar to Mus musculus EST BF782356 FT (NID:g12087392)" FT /note="similar to Mus musculus EST BF161232 FT (NID:g11041339)" FT /note="match to EST BG910318 (NID:g14290794)" FT /note="match to EST AW503868 (NID:g7141535)" FT /note="match to EST BG914339 (NID:g14294815)" FT /note="similar to Gallus gallus EST BI391582 FT (NID:g15084864)" FT /note="match to EST BF948085 (NID:g12365360)" FT /note="similar to Mus musculus EST BE382092 (NID:g9327457)" FT misc_feature 6998082..6998134 FT /note="match to EST BF372631 (NID:g11334656)" FT repeat_region 6998288..6998504 FT /rpt_family="centr" FT misc_feature 6998734..6999005 FT /note="similar to Homo sapiens EST AV736824 FT (NID:g10854405)" FT repeat_region 6998739..6999053 FT /rpt_family="7SK" FT repeat_region 6999072..6999370 FT /rpt_family="Alu" FT repeat_region 6999353..6999377 FT /rpt_family="AT_rich" FT repeat_region 6999379..6999728 FT /rpt_family="L1" FT repeat_region 6999816..7000102 FT /rpt_family="Alu" FT misc_feature 7000079..7000112 FT /note="similar to Homo sapiens EST AV736824 FT (NID:g10854405)" FT repeat_region 7000116..7000258 FT /rpt_family="L1" FT repeat_region 7000259..7000564 FT /rpt_family="Alu" FT repeat_region 7000565..7000615 FT /rpt_family="L1" FT misc_feature 7000812..7000936 FT /note="similar to Gallus gallus EST BI391582 FT (NID:g15084864)" FT misc_feature 7000812..7000929 FT /note="match to EST BF372631 (NID:g11334656)" FT /note="similar to Mus musculus EST BF782356 FT (NID:g12087392)" FT /note="match to EST BG914339 (NID:g14294815)" FT /note="match to EST BG910318 (NID:g14290794)" FT /note="match to EST AW503868 (NID:g7141535)" FT /note="similar to Mus musculus EST BF161232 FT (NID:g11041339)" FT /note="similar to Mus musculus EST BE382092 (NID:g9327457)" FT /note="match to EST AA299989 (NID:g1952559)" FT misc_feature 7000812..7000934 FT /note="match to EST BF948085 (NID:g12365360)" FT misc_feature 7000821..7000929 FT /note="match to EST BF354600 (NID:g11313674)" FT misc_feature 7000896..7000936 FT /note="match to EST BF333558 (NID:g11304306)" FT repeat_region 7001047..7001310 FT /rpt_family="L2" FT repeat_region 7001367..7001459 FT /rpt_family="L2" FT repeat_region 7002044..7002248 FT /rpt_family="MIR" FT misc_feature 7002139..7002141 FT /note="match to EST AW813181 (NID:g7906175)" FT repeat_region 7002729..7002837 FT /rpt_family="L2" FT misc_feature 7002864..7003136 FT /note="match to EST BI023601 (NID:g14430231)" FT misc_feature 7002872..7002978 FT /note="similar to Mus musculus EST BF782356 FT (NID:g12087392)" FT /note="match to EST BF372631 (NID:g11334656)" FT /note="similar to Mus musculus EST BF161232 FT (NID:g11041339)" FT /note="match to EST BG914339 (NID:g14294815)" FT /note="match to EST BG910318 (NID:g14290794)" FT /note="similar to Mus musculus EST BE382092 (NID:g9327457)" FT /note="match to EST AW503868 (NID:g7141535)" FT misc_feature 7002872..7002904 FT /note="match to EST AA299989 (NID:g1952559)" FT misc_feature 7002872..7002932 FT /note="match to EST BF354600 (NID:g11313674)" FT misc_feature 7002872..7002976 FT /note="similar to Gallus gallus EST BI391582 FT (NID:g15084864)" FT misc_feature 7002884..7003205 FT /note="match to EST BF333558 (NID:g11304306)" FT misc_feature 7002967..7003126 FT /note="match to EST BI023268 (NID:g14429898)" FT misc_feature 7003556..7003850 FT /note="match to EST AW813181 (NID:g7906175)" FT misc_feature 7003663..7004223 FT /note="match to EST BG005996 (NID:g12448544)" FT repeat_region 7004366..7004466 FT /rpt_family="L2" FT repeat_region 7004542..7004739 FT /rpt_family="MIR" FT misc_feature 7005071..7005566 FT /note="match to EST AA864828 (NID:g2959141) oh38b12.s1" FT repeat_region 7005448..7005751 FT /rpt_family="Alu" FT repeat_region 7006169..7006329 FT /rpt_family="L2" FT misc_feature 7006571..7006651 FT /note="similar to Mus musculus EST BF782356 FT (NID:g12087392)" FT /note="match to EST AW503868 (NID:g7141535)" FT /note="match to EST BG910318 (NID:g14290794)" FT /note="similar to Mus musculus EST BE382092 (NID:g9327457)" FT /note="similar to Mus musculus EST BF161232 FT (NID:g11041339)" FT misc_feature 7006571..7006641 FT /note="match to EST BG914339 (NID:g14294815)" FT /note="match to EST BF372631 (NID:g11334656)" FT misc_feature 7006584..7006651 FT /note="similar to Sus scrofa EST F23037 (NID:g2578650)" FT repeat_region 7006845..7006980 FT /rpt_family="Alu" FT repeat_region 7006981..7007276 FT /rpt_family="Alu" FT repeat_region 7007277..7007446 FT /rpt_family="Alu" FT misc_feature 7007459..7007917 FT /note="match to EST AW152601 (NID:g6200501) xf76h09.x1" FT repeat_region 7007786..7007921 FT /rpt_family="Alu" FT misc_feature 7007925..7008382 FT /note="match to EST BI045048 (NID:g14451674)" FT misc_feature 7008359..7008372 FT /note="match to EST AW503868 (NID:g7141535)" FT misc_feature 7008359..7008445 FT /note="similar to Mus musculus EST BE382092 (NID:g9327457)" FT misc_feature 7008359..7008454 FT /note="match to EST BG910318 (NID:g14290794)" FT misc_feature 7008359..7008453 FT /note="similar to Mus musculus EST BF782356 FT (NID:g12087392)" FT misc_feature 7008374..7008453 FT /note="similar to Sus scrofa EST F23037 (NID:g2578650)" FT misc_feature 7008400..7008453 FT /note="match to EST BG479167 (NID:g13411446)" FT misc_feature 7008441..7008453 FT /note="match to EST AA300225 (NID:g1952557)" FT repeat_region 7009701..7009816 FT /rpt_family="MIR" FT repeat_region 7010137..7010436 FT /rpt_family="Alu" FT misc_feature 7010783..7011040 FT /note="match to EST BF362344 (NID:g11324369)" FT misc_feature 7011604..7011675 FT /note="similar to Bos taurus EST BE589691 (NID:g9842730)" FT /note="match to EST BG479167 (NID:g13411446)" FT /note="similar to Sus scrofa EST F23037 (NID:g2578650)" FT /note="match to EST AA300225 (NID:g1952557)" FT misc_feature 7011604..7011672 FT /note="similar to Mus musculus EST BF782356 FT (NID:g12087392)" FT misc_feature 7011638..7011675 FT /note="match to EST AI659483 (NID:g4763053) tu30h12.x1" FT misc_feature 7011659..7011675 FT /note="match to EST BE892583 (NID:g10353071)" FT misc_feature 7011772..7012075 FT /note="match to EST BF367056 (NID:g11329107)" FT misc_feature 7012380..7012508 FT /note="match to EST BE892583 (NID:g10353071)" FT /note="match to EST BG479167 (NID:g13411446)" FT /note="match to EST AI659483 (NID:g4763053) tu30h12.x1" FT /note="similar to Sus scrofa EST F23037 (NID:g2578650)" FT /note="similar to Bos taurus EST BE589691 (NID:g9842730)" FT misc_feature 7012380..7012486 FT /note="match to EST AA300225 (NID:g1952557)" FT misc_feature 7012402..7012508 FT /note="match to EST AW503759 (NID:g7141426)" FT repeat_region 7013116..7013226 FT /rpt_family="MIR" FT repeat_region 7013263..7013300 FT /rpt_family="(TTTTG)n" FT repeat_region 7013274..7013583 FT /rpt_family="Alu" FT repeat_region 7013746..7014047 FT /rpt_family="Alu" FT repeat_region 7014068..7014307 FT /rpt_family="L1" FT repeat_region 7014691..7014722 FT /rpt_family="AT_rich" FT repeat_region 7014876..7015081 FT /rpt_family="MER1_type" FT repeat_region 7015471..7015774 FT /rpt_family="Alu" FT repeat_region 7015843..7016067 FT /rpt_family="MIR" FT misc_feature 7016170..7016284 FT /note="match to EST AI745593 (NID:g5113881) wc34h12.x1" FT misc_feature 7016175..7016286 FT /note="similar to Sus scrofa EST F23037 (NID:g2578650)" FT misc_feature 7016175..7016284 FT /note="match to EST AI659483 (NID:g4763053) tu30h12.x1" FT /note="similar to Sus scrofa EST BF192724 (NID:g11076093)" FT /note="similar to Bos taurus EST BE589691 (NID:g9842730)" FT /note="match to EST BG479167 (NID:g13411446)" FT /note="match to EST AW503759 (NID:g7141426)" FT /note="match to EST BE892583 (NID:g10353071)" FT misc_feature 7016247..7016284 FT /note="match to EST AA213527 (NID:g1812144) zr92b10.r1" FT misc_feature 7016257..7016284 FT /note="match to EST BG258607 (NID:g12768423)" FT repeat_region 7018291..7018552 FT /rpt_family="MER1_type" FT repeat_region 7018651..7018745 FT /rpt_family="MIR" FT repeat_region 7018746..7019051 FT /rpt_family="Alu" FT repeat_region 7019052..7019157 FT /rpt_family="MIR" FT repeat_region 7020744..7021046 FT /rpt_family="Alu" FT repeat_region 7022413..7022447 FT /rpt_family="(TTTTG)n" FT repeat_region 7022419..7022597 FT /rpt_family="Alu" FT repeat_region 7022614..7022693 FT /rpt_family="MIR" FT repeat_region 7023043..7023344 FT /rpt_family="Alu" FT repeat_region 7023386..7023441 FT /rpt_family="AT_rich" FT misc_feature 7023698..7023836 FT /note="similar to Homo sapiens EST BF768270 FT (NID:g12116170)" FT misc_feature 7024004..7024044 FT /note="match to EST BI909629 (NID:g16172893)" FT repeat_region 7024701..7025009 FT /rpt_family="Alu" FT misc_feature 7025490..7026042 FT /note="match to EST BG007206 (NID:g12451158)" FT misc_feature 7026729..7026989 FT /note="similar to Mus musculus EST BI655130 FT (NID:g15569366)" FT misc_feature 7026731..7026901 FT /note="match to EST AW503759 (NID:g7141426)" FT misc_feature 7026731..7026989 FT /note="match to EST AA213527 (NID:g1812144) zr92b10.r1" FT /note="match to EST AI745593 (NID:g5113881) wc34h12.x1" FT /note="match to EST AI659483 (NID:g4763053) tu30h12.x1" FT /note="match to EST BG258607 (NID:g12768423)" FT /note="match to EST BE892583 (NID:g10353071)" FT /note="match to EST BG479167 (NID:g13411446)" FT misc_feature 7026731..7026991 FT /note="similar to Sus scrofa EST BF192724 (NID:g11076093)" FT misc_feature 7026731..7026819 FT /note="similar to Bos taurus EST BE589691 (NID:g9842730)" FT misc_feature 7026750..7026989 FT /note="similar to Mus musculus EST AV273678 FT (NID:g15405543)" FT misc_feature 7026760..7026989 FT /note="match to EST AI857996 (NID:g5511612) wj69a11.x1" FT misc_feature 7026793..7027049 FT /note="match to EST BE835617 (NID:g10267995)" FT misc_feature 7026813..7026989 FT /note="match to EST BG391590 (NID:g13285038)" FT misc_feature 7026943..7026989 FT /note="similar to Homo sapiens EST BE771893 FT (NID:g10225551)" FT misc_feature 7027285..7027652 FT /note="match to EST AI927989 (NID:g5663953) wo92c07.x1" FT repeat_region 7027764..7027860 FT /rpt_family="Alu" FT repeat_region 7027884..7028341 FT /rpt_family="L1" FT repeat_region 7028342..7028651 FT /rpt_family="Alu" FT repeat_region 7028658..7028954 FT /rpt_family="Alu" FT repeat_region 7028955..7028984 FT /rpt_family="L1" FT repeat_region 7029025..7029643 FT /rpt_family="(CA)n" FT repeat_region 7029736..7029919 FT /rpt_family="(CA)n" FT repeat_region 7030150..7030449 FT /rpt_family="Alu" FT repeat_region 7030550..7030581 FT /rpt_family="polypyrimidine" FT repeat_region 7030552..7030865 FT /rpt_family="Alu" FT repeat_region 7031304..7031568 FT /rpt_family="Alu" FT misc_feature 7032041..7032523 FT /note="match to EST AL118870 (NID:g5924769)" FT misc_feature 7032054..7032443 FT /note="match to EST AI857996 (NID:g5511612) wj69a11.x1" FT misc_feature 7032054..7032256 FT /note="match to EST AI745593 (NID:g5113881) wc34h12.x1" FT /note="match to EST AI659483 (NID:g4763053) tu30h12.x1" FT misc_feature 7032054..7032442 FT /note="similar to Mus musculus EST AV273678 FT (NID:g15405543)" FT misc_feature 7032054..7032224 FT /note="similar to Mus musculus EST BI655130 FT (NID:g15569366)" FT misc_feature 7032054..7032514 FT /note="match to EST BG258607 (NID:g12768423)" FT misc_feature 7032054..7032099 FT /note="match to EST AA213527 (NID:g1812144) zr92b10.r1" FT misc_feature 7032054..7032147 FT /note="match to EST BE892583 (NID:g10353071)" FT misc_feature 7032054..7032178 FT /note="match to EST BG479167 (NID:g13411446)" FT misc_feature 7032054..7032329 FT /note="similar to Homo sapiens EST BE771893 FT (NID:g10225551)" FT misc_feature 7032054..7032519 FT /note="match to EST BG391590 (NID:g13285038)" FT misc_feature 7032095..7032554 FT /note="match to EST BE771934 (NID:g10225592)" FT misc_feature 7032228..7032583 FT /note="match to EST AA460612 (NID:g2185732) zx62a07.r1" FT misc_feature 7032297..7032968 FT /note="match to EST BF310721 (NID:g11258324)" FT misc_feature 7032298..7032481 FT /note="match to EST BE838167 (NID:g10270545)" FT misc_feature 7032501..7032873 FT /note="match to EST AA354950 (NID:g2007268)" FT misc_feature 7032549..7033393 FT /note="match to EST BG392410 (NID:g13285858)" FT misc_feature 7032616..7033222 FT /note="match to EST BF791541 (NID:g12096595)" FT misc_feature 7032640..7032641 FT /note="match to EST BF974050 (NID:g12341252)" FT misc_feature 7032839..7033235 FT /note="match to EST BE830814 (NID:g10263192)" FT misc_feature 7032878 FT /note="similar to Homo sapiens EST AA045222 (NID:g1523628) FT zk59d01.r1" FT misc_feature 7032887..7033566 FT /note="similar to Homo sapiens EST BG674493 FT (NID:g13905889)" FT misc_feature 7032899..7033107 FT /note="similar to Homo sapiens EST AA045222 (NID:g1523628) FT zk59d01.r1" FT misc_feature 7032922..7033384 FT /note="match to EST AA309590 (NID:g1961960)" FT misc_feature 7032923..7033668 FT /note="match to EST BF974050 (NID:g12341252)" FT misc_feature 7033098..7033890 FT /note="match to EST BI859657 (NID:g16000404)" FT misc_feature 7033133..7033372 FT /note="similar to Homo sapiens EST Z43360 (NID:g570952)" FT misc_feature 7033136..7033563 FT /note="match to EST AW295138 (NID:g6701774)" FT misc_feature 7033207..7033648 FT /note="match to EST AA486318 (NID:g2216534) ab35d12.r1" FT misc_feature 7033243 FT /note="similar to Homo sapiens EST BG421954 FT (NID:g13328460)" FT misc_feature 7033290..7033761 FT /note="similar to Homo sapiens EST BG421954 FT (NID:g13328460)" FT misc_feature 7033400..7034129 FT /note="match to EST BG253298 (NID:g12763114)" FT misc_feature 7033416..7033746 FT /note="match to EST AW838272 (NID:g7932246)" FT misc_feature 7033460..7033651 FT /note="match to EST F08378 (NID:g676944)" FT misc_feature 7033461..7033861 FT /note="match to EST H14744 (NID:g879564) ym24e06.r1" FT misc_feature 7033513..7033973 FT /note="similar to Homo sapiens EST H54356 (NID:g994503) FT yq93a11.r1" FT misc_feature 7033535..7034077 FT /note="match to EST AW149456 (NID:g6197352) xf38b03.x1" FT misc_feature 7033670..7033672 FT /note="match to EST AW295138 (NID:g6701774)" FT misc_feature 7033687..7034150 FT /note="match to EST AA158540 (NID:g1733351) zo72e10.s1" FT misc_feature 7033759..7034555 FT /note="match to EST AL541075 (NID:g12871797)" FT misc_feature 7033840..7033890 FT /note="match to EST BG400545 (NID:g13293993)" FT misc_feature 7033853..7033854 FT /note="match to EST BF327580 (NID:g11298328)" FT misc_feature 7033908..7033938 FT /note="match to EST AA460612 (NID:g2185732) zx62a07.r1" FT misc_feature 7033910..7034110 FT /note="match to EST BF327580 (NID:g11298328)" FT misc_feature 7033983..7034385 FT /note="match to EST BG400545 (NID:g13293993)" FT misc_feature 7033995..7034469 FT /note="match to EST AV747771 (NID:g10905619)" FT misc_feature 7034008..7034430 FT /note="similar to Mus musculus EST BI105547 FT (NID:g14556440)" FT misc_feature 7034013..7034777 FT /note="similar to Homo sapiens EST BI519828 FT (NID:g15344620)" FT misc_feature 7034071..7034810 FT /note="match to EST BG623689 (NID:g13675048)" FT misc_feature 7034138..7034608 FT /note="match to EST AW363660 (NID:g6868310)" FT misc_feature 7034220..7034840 FT /note="match to EST N63916 (NID:g1211745) za28a09.s1" FT misc_feature 7034241..7034846 FT /note="similar to Homo sapiens EST BF129280 FT (NID:g10968320)" FT misc_feature 7034249..7034617 FT /note="match to EST H13528 (NID:g878348) yj15c10.r1" FT misc_feature 7034278..7034460 FT /note="match to EST BE005087 (NID:g8265320)" FT misc_feature 7034321..7034829 FT /note="match to EST BF923534 (NID:g12319422)" FT misc_feature 7034390..7034658 FT /note="match to EST N95190 (NID:g1267594) zb61f12.s1" FT misc_feature 7034391..7034840 FT /note="match to EST AA135540 (NID:g1696589) zl09h05.s1" FT misc_feature 7034424..7034840 FT /note="match to EST AI672698 (NID:g4852429) we57e12.x1" FT misc_feature 7034477..7034845 FT /note="similar to Mus musculus EST BI105547 FT (NID:g14556440)" FT misc_feature 7034517..7034521 FT /note="match to EST BG479521 (NID:g13411800)" FT misc_feature 7034615..7034837 FT /note="match to EST D19736 (NID:g500052)" FT misc_feature 7034647..7034841 FT /note="match to EST AA705980 (NID:g2715898) ah25d09.s1" FT misc_feature 7034675..7034841 FT /note="match to EST N95190 (NID:g1267594) zb61f12.s1" FT repeat_region 7035091..7035173 FT /rpt_family="MIR" FT misc_feature 7035280..7035281 FT /note="similar to Homo sapiens EST BF129280 FT (NID:g10968320)" FT repeat_region 7035668..7035956 FT /rpt_family="Alu" FT repeat_region 7035786..7035807 FT /rpt_family="AT_rich" FT repeat_region 7037050..7037222 FT /rpt_family="MIR" FT repeat_region 7037494..7037598 FT /rpt_family="MIR" FT repeat_region 7037736..7038035 FT /rpt_family="Alu" FT repeat_region 7038018..7038061 FT /rpt_family="AT_rich" FT misc_feature 7038424..7038439 FT /note="match to EST BF030380 (NID:g10738092)" FT repeat_region 7038437..7038732 FT /rpt_family="Alu" FT repeat_region 7039184..7039223 FT /rpt_family="L2" FT repeat_region 7039256..7039373 FT /rpt_family="L2" FT repeat_region 7040106..7040396 FT /rpt_family="Alu" FT repeat_region 7040533..7040845 FT /rpt_family="Alu" FT repeat_region 7040818..7040845 FT /rpt_family="(A)n" FT repeat_region 7041317..7041618 FT /rpt_family="Alu" FT repeat_region 7041702..7042008 FT /rpt_family="Alu" FT repeat_region 7041986..7042036 FT /rpt_family="(TAA)n" FT repeat_region 7042196..7042216 FT /rpt_family="AT_rich" FT repeat_region 7042208..7042497 FT /rpt_family="Alu" FT misc_feature 7042579..7043047 FT /note="match to EST BE550360 (NID:g9792052)" FT misc_feature 7042826..7043209 FT /note="similar to Homo sapiens EST R24471 (NID:g779359) FT yh48d11.r1" FT misc_feature 7042895..7043370 FT /note="match to EST BE504875 (NID:g9707283) hz33g10.x1" FT misc_feature 7042919..7043561 FT /note="similar to Mus musculus EST BG079976 FT (NID:g12562533)" FT misc_feature 7043570..7044053 FT /note="match to EST AI609755 (NID:g4618922) tf82h02.x1" FT misc_feature 7043809..7046026 FT /note="CpG_island (%GC=72.3, o/e=0.80, #CpGs=252)" FT misc_feature 7043964..7043969 FT /note="match to EST BF923534 (NID:g12319422)" FT repeat_region 7044100..7044174 FT /rpt_family="C-rich" FT repeat_region 7044966..7045087 FT /rpt_family="(CGG)n" FT repeat_region 7045148..7045277 FT /rpt_family="(CGG)n" FT misc_feature 7045268..7045576 FT /note="match to EST AL524576 (NID:g12788069)" FT misc_feature 7045303..7045576 FT /note="similar to Mus musculus EST BG870384 FT (NID:g14220924)" FT misc_feature 7045304..7045576 FT /note="similar to Danio rerio EST BI876356 (NID:g16083627) FT fl71d08.y1" FT misc_feature 7045409..7045576 FT /note="match to EST BI196699 (NID:g14651719)" FT repeat_region 7045743..7045838 FT /rpt_family="MIR" FT repeat_region 7047276..7047377 FT /rpt_family="L2" FT repeat_region 7047487..7047532 FT /rpt_family="MIR" FT repeat_region 7047643..7047702 FT /rpt_family="MER1_type" FT repeat_region 7048129..7048292 FT /rpt_family="MIR" FT misc_feature 7048737..7048742 FT /note="match to EST D19736 (NID:g500052)" FT misc_feature 7049342..7049677 FT /note="match to EST BF946820 (NID:g12364095)" FT misc_feature 7049660..7050199 FT /note="match to EST AI741375 (NID:g5109663) wg20h11.x1" FT repeat_region 7050066..7050235 FT /rpt_family="MER1_type" FT repeat_region 7050273..7050303 FT /rpt_family="AT_rich" FT repeat_region 7050296..7050815 FT /rpt_family="L1" FT repeat_region 7050816..7051080 FT /rpt_family="Alu" FT repeat_region 7051081..7051137 FT /rpt_family="L1" FT repeat_region 7052627..7052753 FT /rpt_family="MIR" FT misc_feature 7052781..7053336 FT /note="match to EST BM152557 (NID:g17176912)" FT repeat_region 7053316..7053622 FT /rpt_family="Alu" FT misc_feature 7053316..7053331 FT /note="match to EST AA449720 (NID:g2163470) zx09b09.s1" FT misc_feature 7053329..7053834 FT /note="match to EST AW338086 (NID:g6834712) xw66d11.x1" FT repeat_region 7054312..7054390 FT /rpt_family="MIR" FT misc_feature 7054848..7054851 FT /note="match to EST AA393158 (NID:g2046128) zt73e08.r1" FT repeat_region 7055491..7055583 FT /rpt_family="MIR" FT misc_feature 7055777..7056088 FT /note="similar to Bos taurus EST AW314097 (NID:g6743353)" FT misc_feature 7055789..7056419 FT /note="match to EST BI909629 (NID:g16172893)" FT misc_feature 7055789..7056389 FT /note="match to EST BI196699 (NID:g14651719)" FT misc_feature 7055789..7056208 FT /note="similar to Danio rerio EST BI876356 (NID:g16083627) FT fl71d08.y1" FT misc_feature 7055789..7056246 FT /note="similar to Mus musculus EST BG870384 FT (NID:g14220924)" FT misc_feature 7055789..7055963 FT /note="match to EST AL524576 (NID:g12788069)" FT misc_feature 7056101..7056846 FT /note="similar to Mus musculus EST BI154267 FT (NID:g14614268)" FT misc_feature 7056156..7056912 FT /note="match to EST BF795676 (NID:g12100647)" FT misc_feature 7056472..7056475 FT /note="match to EST BG765971 (NID:g14076624)" FT misc_feature 7056522..7056985 FT /note="similar to Homo sapiens EST BG996703 FT (NID:g14400773)" FT misc_feature 7056627..7057132 FT /note="match to EST BE867774 (NID:g10316550)" FT misc_feature 7056641..7056825 FT /note="match to EST Z42579 (NID:g567329)" FT misc_feature 7056773..7057350 FT /note="match to EST BM053145 (NID:g16809159) ie70g09.y3" FT misc_feature 7056857..7057569 FT /note="match to EST BE621329 (NID:g9892269)" FT misc_feature 7057109..7057484 FT /note="match to EST R19859 (NID:g774493) yg31e10.r1" FT misc_feature 7057176..7057919 FT /note="match to EST BF791664 (NID:g12096718)" FT misc_feature 7057221..7057692 FT /note="match to EST AW404690 (NID:g6923747)" FT misc_feature 7057301..7057677 FT /note="match to EST W28453 (NID:g1308401)" FT misc_feature 7057361..7057919 FT /note="match to EST BM151494 (NID:g17174967)" FT misc_feature 7057433..7058205 FT /note="match to EST BI829835 (NID:g15941385)" FT misc_feature 7057448..7058136 FT /note="match to EST AL524575 (NID:g12788068)" FT misc_feature 7057463..7058349 FT /note="match to EST BE621584 (NID:g9892524)" FT misc_feature 7057573..7058447 FT /note="match to EST BM007893 (NID:g16522234)" FT misc_feature 7057678..7058069 FT /note="match to EST AW837140 (NID:g7931114)" FT misc_feature 7057815..7058282 FT /note="match to EST AA393158 (NID:g2046128) zt73e08.r1" FT misc_feature 7057849..7058254 FT /note="match to EST H28724 (NID:g899678) ym33g01.s1" FT misc_feature 7057856..7058364 FT /note="match to EST AA398558 (NID:g2051667) zt73e08.s1" FT misc_feature 7057909..7058124 FT /note="similar to Mus musculus EST AA174955 (NID:g1756094) FT ms78g02.r1" FT misc_feature 7057934..7058364 FT /note="match to EST BM126223 (NID:g17120775) if07e04.x1" FT misc_feature 7058081..7058364 FT /note="match to EST BM052830 (NID:g16808591) ie70g09.x2" FT misc_feature 7058156..7058434 FT /note="similar to Mus musculus EST AA174955 (NID:g1756094) FT ms78g02.r1" FT misc_feature 7058307 FT /note="match to EST H28724 (NID:g899678) ym33g01.s1" FT misc_feature 7058493..7059240 FT /note="match to EST BF032607 (NID:g10740319)" FT repeat_region 7058589..7058757 FT /rpt_family="MER1_type" FT misc_feature 7058716..7059114 FT /note="similar to Bos taurus EST BI541681 (NID:g15382793)" FT misc_feature 7058728..7059065 FT /note="match to EST AI351879 (NID:g4089085) qq21g07.x1" FT repeat_region 7058822..7058852 FT /rpt_family="AT_rich" FT misc_feature 7058823..7059080 FT /note="similar to Sus scrofa EST BE033071 (NID:g8328071)" FT misc_feature 7058845..7059233 FT /note="similar to Bos taurus EST BF604264 (NID:g11702702)" FT misc_feature 7058924..7059507 FT /note="match to EST BG765971 (NID:g14076624)" FT misc_feature 7059105..7059233 FT /note="similar to Sus scrofa EST BE033071 (NID:g8328071)" FT misc_feature 7059200..7059683 FT /note="match to EST AI859834 (NID:g5513439) wm21a08.x1" FT repeat_region 7059236..7059520 FT /rpt_family="Alu" FT misc_feature 7059467..7059682 FT /note="match to EST AA855093 (NID:g2942631) aj72g11.s1" FT misc_feature 7059527..7059637 FT /note="similar to Bos taurus EST BF604264 (NID:g11702702)" FT misc_feature 7059527..7059672 FT /note="similar to Sus scrofa EST BE033071 (NID:g8328071)" FT repeat_region 7059846..7060156 FT /rpt_family="Alu" FT misc_feature 7059853..7059871 FT /note="match to EST BG941768 (NID:g14341140) ax17b01.x1" FT repeat_region 7060439..7060582 FT /rpt_family="MER2_type" FT misc_feature 7060619..7061227 FT /note="match to EST AW451321 (NID:g6992097)" FT repeat_region 7060621..7060884 FT /rpt_family="MER2_type" FT misc_feature 7060760..7061293 FT /note="similar to Homo sapiens EST W30737 (NID:g1311796) FT zb77g06.r1" FT repeat_region 7060885..7060957 FT /rpt_family="MER2_type" FT misc_feature 7060954..7061685 FT /note="match to EST BG110504 (NID:g12604010)" FT misc_feature 7061123..7061522 FT /note="match to EST H55907 (NID:g1004551) yr02d08.s1" FT misc_feature 7061400..7061702 FT /note="match to EST N55390 (NID:g1198269) yz18c12.r1" FT misc_feature 7061443..7061829 FT /note="match to EST AA357266 (NID:g2009586)" FT misc_feature 7061633..7062109 FT /note="match to EST R35405 (NID:g792306) yg65a10.r1" FT misc_feature 7061782..7062418 FT /note="match to EST BI759673 (NID:g15751251)" FT misc_feature 7061784..7062249 FT /note="match to EST AA449720 (NID:g2163470) zx09b09.s1" FT misc_feature 7061784..7062045 FT /note="match to EST BG941768 (NID:g14341140) ax17b01.x1" FT repeat_region 7061812..7061834 FT /rpt_family="AT_rich" FT misc_feature 7061891..7062173 FT /note="match to EST Z42640 (NID:g570211)" FT misc_feature 7061909..7062160 FT /note="similar to Homo sapiens EST AL578153 FT (NID:g12941954)" FT misc_feature 7061910..7062466 FT /note="match to EST BF888314 (NID:g12279547)" FT misc_feature 7061921..7062840 FT /note="match to EST AL542570 (NID:g12874744)" FT misc_feature 7061937..7062408 FT /note="match to EST N99585 (NID:g1271017) yz80b12.r1" FT misc_feature 7061938..7062492 FT /note="match to EST AL571727 (NID:g12929311)" FT misc_feature 7062002..7062415 FT /note="match to EST AA357267 (NID:g2009587)" FT misc_feature 7062017..7062782 FT /note="match to EST BI826823 (NID:g15938373)" FT misc_feature 7062215..7062216 FT /note="match to EST BG928406 (NID:g14322929)" FT misc_feature 7062216..7062590 FT /note="similar to Homo sapiens EST AL578153 FT (NID:g12941954)" FT misc_feature 7062250..7062841 FT /note="match to EST BG928406 (NID:g14322929)" FT misc_feature 7062252..7062935 FT /note="match to EST BG290183 (NID:g13046721)" FT misc_feature 7062252..7062903 FT /note="match to EST AI096903 (NID:g3446485) qb58h04.x1" FT misc_feature 7062255..7062935 FT /note="match to EST AL542571 (NID:g12874746)" FT misc_feature 7062258..7062578 FT /note="match to EST BG941859 (NID:g14341231) ax18b10.x1" FT misc_feature 7062262..7062537 FT /note="match to EST AA410658 (NID:g2069763) zt29g05.r1" FT misc_feature 7062265..7062742 FT /note="match to EST R83543 (NID:g928420) yq12b06.r1" FT misc_feature 7062356..7062593 FT /note="match to EST AA345183 (NID:g1997418)" FT misc_feature 7062443..7062935 FT /note="match to EST BG031537 (NID:g12421918)" FT misc_feature 7062453..7062935 FT /note="match to EST BG180930 (NID:g12687633)" FT misc_feature 7062467..7062935 FT /note="match to EST BI517558 (NID:g15342350)" FT misc_feature 7062491..7062935 FT /note="match to EST BG576391 (NID:g13584044)" FT misc_feature 7062506..7062507 FT /note="match to EST N28384 (NID:g1146620) yx28b01.r1" FT misc_feature 7062534..7062899 FT /note="match to EST N28384 (NID:g1146620) yx28b01.r1" FT misc_feature 7062548..7062935 FT /note="match to EST AA926786 (NID:g3075683) om68b11.s1" FT misc_feature 7062548..7062943 FT /note="match to EST AA937158 (NID:g3095269) oo98h10.s1" FT misc_feature 7062549..7062935 FT /note="match to EST AA887226 (NID:g3002334) oj53d06.s1" FT misc_feature 7062594..7062597 FT /note="match to EST N99585 (NID:g1271017) yz80b12.r1" FT misc_feature 7062604..7062935 FT /note="match to EST BG479521 (NID:g13411800)" FT misc_feature 7062667..7062935 FT /note="similar to Mus musculus EST BE305354 (NID:g9156918)" FT misc_feature 7062687..7062935 FT /note="match to EST AW967141 (NID:g8156977)" FT misc_feature 7062729..7062732 FT /note="match to EST BI859657 (NID:g16000404)" FT misc_feature 7062766..7062935 FT /note="match to EST N24290 (NID:g1138440) yx13e07.r1" FT misc_feature 7062771..7062828 FT /note="match to EST AA345183 (NID:g1997418)" FT misc_feature 7062880..7062935 FT /note="similar to Mus musculus EST BB843383 FT (NID:g17081750)" FT misc_feature 7062896..7062935 FT /note="match to EST BF949047 (NID:g12366322)" FT repeat_region 7063183..7063477 FT /rpt_family="L2" FT repeat_region 7063620..7063751 FT /rpt_family="MIR" FT misc_feature 7064102..7064193 FT /note="match to EST BG941012 (NID:g14340384) ax08g10.x2" FT misc_feature 7064112..7064193 FT /note="match to EST AW967141 (NID:g8156977)" FT /note="match to EST BG479521 (NID:g13411800)" FT /note="similar to Mus musculus EST BE305354 (NID:g9156918)" FT /note="match to EST AL542571 (NID:g12874746)" FT /note="match to EST AA887226 (NID:g3002334) oj53d06.s1" FT /note="similar to Mus musculus EST BB843383 FT (NID:g17081750)" FT /note="match to EST BI517558 (NID:g15342350)" FT /note="match to EST BG576391 (NID:g13584044)" FT /note="match to EST BF949047 (NID:g12366322)" FT /note="match to EST BG031537 (NID:g12421918)" FT /note="match to EST N24290 (NID:g1138440) yx13e07.r1" FT /note="match to EST BG180930 (NID:g12687633)" FT misc_feature 7064112..7064160 FT /note="match to EST BG290183 (NID:g13046721)" FT misc_feature 7064112..7064145 FT /note="match to EST AA926786 (NID:g3075683) om68b11.s1" FT misc_feature 7064120..7064193 FT /note="match to EST BE842941 (NID:g10275319)" FT misc_feature 7064142..7064193 FT /note="match to EST N57392 (NID:g1201282) yw87h09.r1" FT repeat_region 7064213..7064242 FT /rpt_family="(TA)n" FT repeat_region 7064242..7064537 FT /rpt_family="Alu" FT repeat_region 7064824..7065112 FT /rpt_family="Alu" FT misc_feature 7065414..7066050 FT /note="match to EST BG012947 (NID:g12462468)" FT misc_feature 7065788..7065950 FT /note="match to EST BF949047 (NID:g12366322)" FT /note="match to EST AL542571 (NID:g12874746)" FT /note="match to EST AW967141 (NID:g8156977)" FT /note="match to EST BG576391 (NID:g13584044)" FT /note="match to EST BI517558 (NID:g15342350)" FT /note="match to EST BG479521 (NID:g13411800)" FT /note="match to EST BG941012 (NID:g14340384) ax08g10.x2" FT /note="similar to Mus musculus EST BB843383 FT (NID:g17081750)" FT /note="match to EST BG031537 (NID:g12421918)" FT /note="match to EST AA887226 (NID:g3002334) oj53d06.s1" FT misc_feature 7065788..7065965 FT /note="similar to Mus musculus EST BE305354 (NID:g9156918)" FT misc_feature 7065788..7065916 FT /note="match to EST N24290 (NID:g1138440) yx13e07.r1" FT misc_feature 7065788..7065831 FT /note="match to EST BG180930 (NID:g12687633)" FT misc_feature 7065788..7065927 FT /note="match to EST BE842941 (NID:g10275319)" FT misc_feature 7065788..7065912 FT /note="match to EST N57392 (NID:g1201282) yw87h09.r1" FT misc_feature 7065810..7065950 FT /note="match to EST BF874395 (NID:g12264525)" FT misc_feature 7065815..7065950 FT /note="match to EST BF030380 (NID:g10738092)" FT misc_feature 7065900..7065950 FT /note="match to EST AA345183 (NID:g1997418)" FT repeat_region 7066215..7066251 FT /rpt_family="(TCTA)n" FT repeat_region 7066263..7066524 FT /rpt_family="Alu" FT repeat_region 7066536..7066683 FT /rpt_family="Alu" FT repeat_region 7066969..7067272 FT /rpt_family="Alu" FT repeat_region 7067582..7067840 FT /rpt_family="Alu" FT misc_feature 7067599..7067960 FT /note="match to EST AA640635 (NID:g2565885) nr22c02.r1" FT misc_feature 7067766..7068138 FT /note="match to EST T89161 (NID:g717674) yd33a04.s1" FT repeat_region 7067948..7068178 FT /rpt_family="L1" FT misc_feature 7068159 FT /note="match to EST AA640635 (NID:g2565885) nr22c02.r1" FT misc_feature 7069099..7070402 FT /note="CpG_island (%GC=67.6, o/e=0.80, #CpGs=134)" FT misc_feature 7069698..7069766 FT /note="similar to Mus musculus EST BB843383 FT (NID:g17081750)" FT misc_feature 7069698..7069714 FT /note="match to EST AA345183 (NID:g1997418)" FT misc_feature 7069698..7069774 FT /note="match to EST BI517558 (NID:g15342350)" FT misc_feature 7069698..7069793 FT /note="match to EST BG941012 (NID:g14340384) ax08g10.x2" FT misc_feature 7069698..7069839 FT /note="match to EST BG576391 (NID:g13584044)" FT misc_feature 7069698..7069783 FT /note="match to EST BF030380 (NID:g10738092)" FT misc_feature 7069698..7069779 FT /note="match to EST AL542571 (NID:g12874746)" FT misc_feature 7069698..7069735 FT /note="match to EST AA887226 (NID:g3002334) oj53d06.s1" FT misc_feature 7069698..7069784 FT /note="match to EST BF949047 (NID:g12366322)" FT misc_feature 7069698..7069759 FT /note="match to EST BG031537 (NID:g12421918)" FT misc_feature 7069698..7069757 FT /note="match to EST BG479521 (NID:g13411800)" FT misc_feature 7069698..7069743 FT /note="match to EST AW967141 (NID:g8156977)" FT misc_feature 7069698..7069786 FT /note="match to EST BF874395 (NID:g12264525)" FT repeat_region 7070056..7070102 FT /rpt_family="GC_rich" FT misc_feature 7070962..7071284 FT /note="match to EST R41375 (NID:g816681) yf85b10.s1" FT repeat_region 7071233..7071652 FT /rpt_family="L1" FT repeat_region 7071658..7071689 FT /rpt_family="AT_rich" FT repeat_region 7071664..7071970 FT /rpt_family="Alu" FT repeat_region 7072000..7072323 FT /rpt_family="Alu" FT repeat_region 7072296..7072331 FT /rpt_family="(CAAAA)n" FT repeat_region 7073081..7073127 FT /rpt_family="MIR" FT repeat_region 7073333..7073814 FT /rpt_family="MaLR" FT repeat_region 7073816..7073879 FT /rpt_family="MIR" FT misc_feature 7073914..7074134 FT /note="match to EST AA911351 (NID:g3050715) oe76c04.s1" FT misc_feature 7074650..7074654 FT /note="match to EST AI939512 (NID:g5678301) qy29g10.x5" FT repeat_region 7075218..7075393 FT /rpt_family="MaLR" FT repeat_region 7075463..7075616 FT /rpt_family="MaLR" FT repeat_region 7075770..7075872 FT /rpt_family="MIR" FT repeat_region 7075931..7076340 FT /rpt_family="MaLR" FT misc_feature 7076245..7076251 FT /note="match to EST BG012947 (NID:g12462468)" FT repeat_region 7076841..7076868 FT /rpt_family="(T)n" FT repeat_region 7077869..7078029 FT /rpt_family="(CCCTG)n" FT repeat_region 7078308..7078353 FT /rpt_family="(TGG)n" FT repeat_region 7078582..7078694 FT /rpt_family="MaLR" FT repeat_region 7080103..7080290 FT /rpt_family="Alu" FT repeat_region 7080270..7080333 FT /rpt_family="AT_rich" FT repeat_region 7080326..7080611 FT /rpt_family="Alu" FT misc_feature 7080437..7080445 FT /note="match to EST BE005087 (NID:g8265320)" FT repeat_region 7080615..7080919 FT /rpt_family="Alu" FT repeat_region 7080925..7080962 FT /rpt_family="T-rich" FT repeat_region 7081031..7082839 FT /rpt_family="L1" FT repeat_region 7082847..7082980 FT /rpt_family="Alu" FT repeat_region 7083008..7083072 FT /rpt_family="L1" FT repeat_region 7083151..7083494 FT /rpt_family="L1" FT repeat_region 7083496..7083985 FT /rpt_family="ERV" FT repeat_region 7084196..7084262 FT /rpt_family="(TTTA)n" FT repeat_region 7084236..7084544 FT /rpt_family="Alu" FT repeat_region 7084637..7084902 FT /rpt_family="L2" FT repeat_region 7084926..7085209 FT /rpt_family="ERVL" FT misc_feature 7085124..7085135 FT /note="match to EST BM152557 (NID:g17176912)" FT repeat_region 7085391..7085593 FT /rpt_family="MER1_type" FT repeat_region 7085605..7085660 FT /rpt_family="T-rich" FT repeat_region 7085619..7085785 FT /rpt_family="Alu" FT repeat_region 7086085..7086198 FT /rpt_family="L1" FT repeat_region 7086222..7086752 FT /rpt_family="ERV1" FT misc_feature 7087315..7087320 FT /note="match to EST BE771934 (NID:g10225592)" FT repeat_region 7087872..7088164 FT /rpt_family="Alu" FT repeat_region 7088824..7089204 FT /rpt_family="ERV1" FT repeat_region 7089205..7089499 FT /rpt_family="Alu" FT repeat_region 7089500..7089528 FT /rpt_family="ERV1" FT repeat_region 7089529..7089828 FT /rpt_family="Alu" FT repeat_region 7089829..7089932 FT /rpt_family="ERV1" FT repeat_region 7089933..7090226 FT /rpt_family="Alu" FT repeat_region 7090227..7090817 FT /rpt_family="ERV1" FT repeat_region 7090840..7092861 FT /rpt_family="ERV1" FT repeat_region 7092862..7093388 FT /rpt_family="ERV1" FT repeat_region 7093538..7093685 FT /rpt_family="L1" FT repeat_region 7094066..7094113 FT /rpt_family="(TTTA)n" FT repeat_region 7094084..7094398 FT /rpt_family="Alu" FT repeat_region 7094402..7094708 FT /rpt_family="Alu" FT repeat_region 7095001..7095213 FT /rpt_family="L1" FT repeat_region 7095208..7095356 FT /rpt_family="(TTTC)n" FT repeat_region 7095329..7095675 FT /rpt_family="Alu" FT repeat_region 7095678..7096038 FT /rpt_family="L1" FT repeat_region 7096048..7096131 FT /rpt_family="MaLR" FT misc_feature 7096298..7096470 FT /note="match to EST BF594738 (NID:g11687062)" FT repeat_region 7096901..7097214 FT /rpt_family="Alu" FT repeat_region 7097189..7097208 FT /rpt_family="(A)n" FT repeat_region 7097896..7097955 FT /rpt_family="(TG)n" FT repeat_region 7098430..7098730 FT /rpt_family="L1" FT repeat_region 7098473..7099028 FT /rpt_family="L1" FT misc_feature 7099050..7099106 FT /note="match to EST BF594738 (NID:g11687062)" FT misc_feature 7099094 FT /note="match to EST AA878236 (NID:g2987201) oe61d03.s1" FT misc_feature 7099151..7099553 FT /note="match to EST AA878236 (NID:g2987201) oe61d03.s1" FT repeat_region 7099319..7099774 FT /rpt_family="MaLR" FT repeat_region 7099803..7100003 FT /rpt_family="MaLR" FT repeat_region 7100004..7100133 FT /rpt_family="MaLR" FT misc_feature 7100179..7100667 FT /note="match to EST AI939512 (NID:g5678301) qy29g10.x5" FT repeat_region 7100613..7100892 FT /rpt_family="L1" FT repeat_region 7100908..7101205 FT /rpt_family="Alu" FT repeat_region 7101214..7101502 FT /rpt_family="Alu" FT repeat_region 7101506..7101993 FT /rpt_family="L1" FT repeat_region 7101994..7102302 FT /rpt_family="Alu" FT repeat_region 7102303..7102771 FT /rpt_family="L1" FT repeat_region 7102772..7103084 FT /rpt_family="Alu" FT repeat_region 7103085..7103274 FT /rpt_family="L1" FT repeat_region 7103281..7103360 FT /rpt_family="CR1" FT repeat_region 7103407..7103443 FT /rpt_family="(TGGG)n" FT misc_feature 7103754..7104194 FT /note="match to EST BI001592 (NID:g14405666)" FT repeat_region 7104277..7104586 FT /rpt_family="Alu" FT repeat_region 7104556..7104586 FT /rpt_family="(CAAAAA)n" FT repeat_region 7104835..7104937 FT /rpt_family="MIR" FT repeat_region 7104905..7105015 FT /rpt_family="L2" FT misc_feature 7104995..7105056 FT /note="match to EST BF594738 (NID:g11687062)" FT repeat_region 7105170..7105237 FT /rpt_family="(CCCCG)n" FT repeat_region 7106274..7106550 FT /rpt_family="L2" FT repeat_region 7106758..7107049 FT /rpt_family="Alu" FT repeat_region 7107628..7107923 FT /rpt_family="Alu" FT repeat_region 7107629..7107652 FT /rpt_family="(TTTTG)n" FT repeat_region 7108129..7108440 FT /rpt_family="Alu" FT repeat_region 7108450..7108741 FT /rpt_family="Alu" FT repeat_region 7109655..7109695 FT /rpt_family="(TG)n" FT repeat_region 7109890..7110054 FT /rpt_family="MIR" FT repeat_region 7110928..7111032 FT /rpt_family="L2" FT repeat_region 7111053..7111086 FT /rpt_family="(TGAA)n" FT repeat_region 7111715..7111734 FT /rpt_family="(CAAAA)n" FT repeat_region 7111737..7112094 FT /rpt_family="MaLR" FT repeat_region 7112321..7112438 FT /rpt_family="ERVL" FT repeat_region 7112643..7112744 FT /rpt_family="L2" FT repeat_region 7113635..7113730 FT /rpt_family="MIR" FT repeat_region 7113831..7113913 FT /rpt_family="MaLR" FT misc_feature 7113887..7114122 FT /note="match to EST BE676909 (NID:g10037450)" FT misc_feature 7113889..7114133 FT /note="similar to Homo sapiens EST BG772262 FT (NID:g14082915)" FT repeat_region 7114137..7114411 FT /rpt_family="MaLR" FT repeat_region 7114434..7114588 FT /rpt_family="CR1" FT repeat_region 7114715..7114769 FT /rpt_family="L2" FT repeat_region 7114787..7114815 FT /rpt_family="AT_rich" FT repeat_region 7114802..7115101 FT /rpt_family="Alu" FT repeat_region 7115101..7115127 FT /rpt_family="(TTTA)n" FT repeat_region 7115173..7115462 FT /rpt_family="Alu" FT repeat_region 7116236..7116270 FT /rpt_family="(TTTG)n" FT repeat_region 7116244..7116543 FT /rpt_family="Alu" FT repeat_region 7116579..7116621 FT /rpt_family="(TTTA)n" FT repeat_region 7116596..7116904 FT /rpt_family="Alu" FT repeat_region 7116945..7117202 FT /rpt_family="Alu" FT repeat_region 7117297..7117480 FT /rpt_family="(AGGTG)n" FT repeat_region 7118062..7118179 FT /rpt_family="MIR" FT repeat_region 7119225..7119499 FT /rpt_family="L2" FT repeat_region 7119646..7119811 FT /rpt_family="(TGGA)n" FT repeat_region 7119827..7120004 FT /rpt_family="(TGGA)n" FT repeat_region 7120026..7120426 FT /rpt_family="(TGGA)n" FT repeat_region 7120442..7120610 FT /rpt_family="(TGGA)n" FT repeat_region 7120998..7121061 FT /rpt_family="MIR" FT repeat_region 7122088..7122444 FT /rpt_family="MaLR" FT repeat_region 7122542..7122857 FT /rpt_family="CR1" FT repeat_region 7123301..7123358 FT /rpt_family="CT-rich" FT repeat_region 7123378..7123415 FT /rpt_family="(CAAAAA)n" FT repeat_region 7123943..7123985 FT /rpt_family="(TCCC)n" FT repeat_region 7123999..7124134 FT /rpt_family="MIR" FT repeat_region 7124147..7124263 FT /rpt_family="MaLR" FT repeat_region 7124264..7124433 FT /rpt_family="ERVL" FT repeat_region 7124431..7124502 FT /rpt_family="ERVL" FT repeat_region 7124500..7124571 FT /rpt_family="ERVL" FT repeat_region 7124638..7124888 FT /rpt_family="ERVL" FT repeat_region 7124889..7125197 FT /rpt_family="Alu" FT repeat_region 7125203..7125338 FT /rpt_family="ERV1" FT repeat_region 7125698..7125830 FT /rpt_family="MIR" FT repeat_region 7125984..7126197 FT /rpt_family="ERV1" FT repeat_region 7126198..7126437 FT /rpt_family="Alu" FT repeat_region 7126438..7126697 FT /rpt_family="ERV1" FT repeat_region 7127232..7127407 FT /rpt_family="L1" FT repeat_region 7127408..7127697 FT /rpt_family="Alu" FT repeat_region 7127698..7127900 FT /rpt_family="L1" FT repeat_region 7127903..7128193 FT /rpt_family="Alu" FT repeat_region 7128198..7128297 FT /rpt_family="L1" FT repeat_region 7128481..7128591 FT /rpt_family="MIR" FT repeat_region 7128673..7128891 FT /rpt_family="MaLR" FT repeat_region 7130176..7130277 FT /rpt_family="L2" FT repeat_region 7130279..7130312 FT /rpt_family="(TG)n" FT repeat_region 7130641..7130846 FT /rpt_family="MER53" FT repeat_region 7131220..7131271 FT /rpt_family="L2" FT repeat_region 7132378..7133052 FT /rpt_family="(TG)n" FT repeat_region 7133093..7133261 FT /rpt_family="(TG)n" FT repeat_region 7133331..7133505 FT /rpt_family="(TG)n" FT repeat_region 7133552..7133710 FT /rpt_family="(TG)n" FT repeat_region 7133724..7133810 FT /rpt_family="(TG)n" FT repeat_region 7134262..7134532 FT /rpt_family="Alu" FT repeat_region 7134673..7134813 FT /rpt_family="L2" FT repeat_region 7135765..7135811 FT /rpt_family="MIR" FT repeat_region 7136995..7137113 FT /rpt_family="MIR" FT repeat_region 7137776..7137905 FT /rpt_family="MIR" FT repeat_region 7138196..7138275 FT /rpt_family="L2" FT repeat_region 7138276..7138502 FT /rpt_family="MER1_type" FT repeat_region 7138503..7138630 FT /rpt_family="L2" FT repeat_region 7138698..7138734 FT /rpt_family="MIR" FT repeat_region 7139970..7140095 FT /rpt_family="MIR" FT repeat_region 7140970..7141062 FT /rpt_family="L2" FT repeat_region 7141895..7141994 FT /rpt_family="MIR" FT repeat_region 7142140..7142326 FT /rpt_family="MIR" FT repeat_region 7143379..7143536 FT /rpt_family="L1" FT repeat_region 7143570..7143602 FT /rpt_family="(TTTTC)n" FT repeat_region 7143574..7143901 FT /rpt_family="Alu" FT repeat_region 7143745..7143767 FT /rpt_family="(TTTA)n" FT repeat_region 7143902..7144362 FT /rpt_family="L1" FT repeat_region 7144363..7144664 FT /rpt_family="Alu" FT repeat_region 7144665..7144762 FT /rpt_family="L1" FT misc_feature 7144762..7145221 FT /note="match to EST AI796559 (NID:g5362022) wh46g07.x1" FT repeat_region 7145191..7145234 FT /rpt_family="AT_rich" FT repeat_region 7145439..7145570 FT /rpt_family="L1" FT repeat_region 7145571..7145873 FT /rpt_family="Alu" FT misc_feature 7145697..7145706 FT /note="match to EST AA705980 (NID:g2715898) ah25d09.s1" FT repeat_region 7145856..7145918 FT /rpt_family="AT_rich" FT repeat_region 7145874..7146154 FT /rpt_family="L1" FT repeat_region 7145940..7145963 FT /rpt_family="AT_rich" FT repeat_region 7146285..7146443 FT /rpt_family="MIR" FT repeat_region 7146899..7146938 FT /rpt_family="MIR" FT repeat_region 7147287..7147383 FT /rpt_family="MER53" FT repeat_region 7147551..7147708 FT /rpt_family="MIR" FT repeat_region 7148116..7148533 FT /rpt_family="ERVL" FT repeat_region 7149709..7149960 FT /rpt_family="MIR" FT repeat_region 7150402..7150565 FT /rpt_family="MaLR" FT repeat_region 7150659..7150772 FT /rpt_family="MaLR" FT repeat_region 7150773..7151082 FT /rpt_family="Alu" FT repeat_region 7151059..7151084 FT /rpt_family="AT_rich" FT repeat_region 7151083..7151167 FT /rpt_family="MaLR" FT repeat_region 7152490..7152690 FT /rpt_family="MaLR" FT repeat_region 7152739..7152853 FT /rpt_family="L1" FT repeat_region 7153343..7153415 FT /rpt_family="MIR" FT repeat_region 7153888..7154189 FT /rpt_family="Alu" FT repeat_region 7154246..7154563 FT /rpt_family="L1" FT repeat_region 7154861..7155010 FT /rpt_family="Alu" FT repeat_region 7155058..7155228 FT /rpt_family="L1" FT repeat_region 7155236..7155347 FT /rpt_family="L1" FT repeat_region 7156956..7157080 FT /rpt_family="(CATATA)n" FT repeat_region 7157098..7157151 FT /rpt_family="(CA)n" FT repeat_region 7157143..7157268 FT /rpt_family="L1" FT repeat_region 7157271..7157469 FT /rpt_family="ERVL" FT repeat_region 7157757..7157956 FT /rpt_family="MIR" FT repeat_region 7158428..7158909 FT /rpt_family="MaLR" FT repeat_region 7159124..7159421 FT /rpt_family="L2" FT repeat_region 7159469..7159694 FT /rpt_family="L2" FT repeat_region 7159696..7159875 FT /rpt_family="MaLR" FT repeat_region 7159876..7159960 FT /rpt_family="ERV1" FT repeat_region 7159961..7160345 FT /rpt_family="ERV1" FT repeat_region 7160347..7160538 FT /rpt_family="MaLR" FT repeat_region 7160539..7160621 FT /rpt_family="L2" FT repeat_region 7160659..7160760 FT /rpt_family="ERVL" FT repeat_region 7161205..7161357 FT /rpt_family="L2" FT repeat_region 7161457..7161754 FT /rpt_family="Alu" FT repeat_region 7161956..7162086 FT /rpt_family="L1" FT repeat_region 7162539..7162585 FT /rpt_family="(TTCA)n" FT repeat_region 7162575..7162711 FT /rpt_family="L2" FT repeat_region 7163077..7163154 FT /rpt_family="Alu" FT repeat_region 7163178..7163313 FT /rpt_family="Alu" FT repeat_region 7163317..7163714 FT /rpt_family="ERV1" FT repeat_region 7163701..7164017 FT /rpt_family="MaLR" FT repeat_region 7164023..7164325 FT /rpt_family="Alu" FT repeat_region 7165129..7165496 FT /rpt_family="L1" FT repeat_region 7165477..7165500 FT /rpt_family="L1" FT repeat_region 7165501..7165808 FT /rpt_family="Alu" FT repeat_region 7165781..7165812 FT /rpt_family="(CAAAA)n" FT repeat_region 7165809..7165918 FT /rpt_family="L1" FT repeat_region 7165919..7166172 FT /rpt_family="Alu" FT repeat_region 7166173..7166414 FT /rpt_family="L1" FT repeat_region 7166636..7166750 FT /rpt_family="MIR" FT repeat_region 7167938..7168381 FT /rpt_family="MaLR" FT repeat_region 7169000..7169202 FT /rpt_family="MaLR" FT repeat_region 7169152..7169386 FT /rpt_family="ERVL" FT repeat_region 7170427..7170570 FT /rpt_family="MIR" FT repeat_region 7170964..7171201 FT /rpt_family="L2" FT repeat_region 7171379..7171677 FT /rpt_family="Alu" FT repeat_region 7171784..7172191 FT /rpt_family="MaLR" FT repeat_region 7173025..7173185 FT /rpt_family="MER1_type" FT repeat_region 7173268..7173308 FT /rpt_family="(TTC)n" FT repeat_region 7173275..7173574 FT /rpt_family="Alu" FT repeat_region 7173581..7173615 FT /rpt_family="(TTTG)n" FT repeat_region 7173586..7173898 FT /rpt_family="Alu" FT repeat_region 7174322..7174625 FT /rpt_family="MaLR" FT misc_feature 7174727..7174733 FT /note="match to EST BE621329 (NID:g9892269)" FT repeat_region 7174884..7175051 FT /rpt_family="MIR" FT repeat_region 7175129..7175213 FT /rpt_family="L2" FT repeat_region 7175261..7175569 FT /rpt_family="Alu" FT repeat_region 7175542..7175569 FT /rpt_family="(A)n" FT repeat_region 7175573..7176091 FT /rpt_family="L1" FT repeat_region 7176095..7176169 FT /rpt_family="MIR" FT repeat_region 7176171..7176467 FT /rpt_family="Alu" FT repeat_region 7176495..7176515 FT /rpt_family="L1" FT repeat_region 7176501..7176542 FT /rpt_family="AT_rich" FT repeat_region 7176516..7176825 FT /rpt_family="Alu" FT repeat_region 7176826..7177140 FT /rpt_family="L1" FT repeat_region 7177143..7177724 FT /rpt_family="L1" FT repeat_region 7177725..7177750 FT /rpt_family="(T)n" FT repeat_region 7178032..7180564 FT /rpt_family="L1" FT repeat_region 7179099..7179208 FT /rpt_family="T-rich" FT repeat_region 7180565..7180590 FT /rpt_family="(T)n" FT repeat_region 7180871..7181968 FT /rpt_family="L1" FT repeat_region 7182032..7182052 FT /rpt_family="AT_rich" FT repeat_region 7182055..7182335 FT /rpt_family="Alu" FT repeat_region 7182328..7182358 FT /rpt_family="(TC)n" FT repeat_region 7182349..7182433 FT /rpt_family="L1" FT repeat_region 7182362..7182538 FT /rpt_family="(TA)n" FT repeat_region 7182442..7182510 FT /rpt_family="L1" FT repeat_region 7182541..7182571 FT /rpt_family="AT_rich" FT repeat_region 7182562..7182753 FT /rpt_family="L1" FT repeat_region 7183023..7183262 FT /rpt_family="L1" FT repeat_region 7183372..7183510 FT /rpt_family="MIR" FT repeat_region 7183572..7183751 FT /rpt_family="(TCCA)n" FT repeat_region 7183755..7183889 FT /rpt_family="L2" FT repeat_region 7184751..7184883 FT /rpt_family="MaLR" FT repeat_region 7184943..7185065 FT /rpt_family="MaLR" FT repeat_region 7185247..7185395 FT /rpt_family="L2" FT repeat_region 7185657..7185764 FT /rpt_family="MER103" FT repeat_region 7185852..7185893 FT /rpt_family="MIR" FT repeat_region 7186216..7186340 FT /rpt_family="MIR" FT repeat_region 7186505..7186814 FT /rpt_family="MaLR" FT repeat_region 7186815..7187118 FT /rpt_family="Alu" FT repeat_region 7186970..7187008 FT /rpt_family="AT_rich" FT repeat_region 7187119..7187161 FT /rpt_family="MaLR" FT repeat_region 7187709..7187865 FT /rpt_family="MIR" FT repeat_region 7187977..7188101 FT /rpt_family="L2" FT repeat_region 7188437..7188582 FT /rpt_family="L2" FT repeat_region 7189532..7189669 FT /rpt_family="MER1_type" FT repeat_region 7189695..7189843 FT /rpt_family="MER1_type" FT repeat_region 7189927..7190096 FT /rpt_family="MIR" FT repeat_region 7190224..7190320 FT /rpt_family="L2" FT repeat_region 7190805..7191011 FT /rpt_family="L2" FT repeat_region 7191098..7191294 FT /rpt_family="L2" FT repeat_region 7191702..7191853 FT /rpt_family="MIR" FT repeat_region 7191963..7192179 FT /rpt_family="CT-rich" FT repeat_region 7192192..7192371 FT /rpt_family="CT-rich" FT repeat_region 7192365..7192623 FT /rpt_family="Alu" FT repeat_region 7192480..7192509 FT /rpt_family="AT_rich" FT misc_feature 7194128..7195467 FT /note="CpG_island (%GC=74.5, o/e=1.00, #CpGs=170)" FT repeat_region 7194163..7194227 FT /rpt_family="GC_rich" FT repeat_region 7194233..7194367 FT /rpt_family="C-rich" FT misc_feature 7194328..7194855 FT /note="similar to Mus musculus EST BB665559 FT (NID:g16499192)" FT repeat_region 7194406..7194474 FT /rpt_family="GC_rich" FT misc_feature 7194472..7194861 FT /note="match to EST AI962561 (NID:g5755274) wq42b10.x1" FT repeat_region 7194475..7194502 FT /rpt_family="(CTG)n" FT repeat_region 7194503..7194526 FT /rpt_family="GC_rich" FT misc_feature 7216863..7217289 FT /note="CpG_island (%GC=72.1, o/e=0.60, #CpGs=36)" FT repeat_region 7271092..7271591 FT /rpt_family="MaLR" FT repeat_region 7271610..7271903 FT /rpt_family="Alu" FT repeat_region 7272838..7273468 FT /rpt_family="L2" FT repeat_region 7274020..7274177 FT /rpt_family="MER2_type" FT repeat_region 7276047..7276449 FT /rpt_family="MaLR" FT repeat_region 7278749..7278852 FT /rpt_family="L2" FT repeat_region 7279733..7279841 FT /rpt_family="MIR" FT repeat_region 7282300..7282456 FT /rpt_family="L1" FT repeat_region 7282457..7282534 FT /rpt_family="MIR" FT repeat_region 7282535..7282559 FT /rpt_family="(TGAA)n" FT repeat_region 7282560..7282624 FT /rpt_family="MIR" FT repeat_region 7284402..7284542 FT /rpt_family="MIR" FT repeat_region 7284654..7284823 FT /rpt_family="(TTCA)n" FT repeat_region 7284835..7284936 FT /rpt_family="L2" FT repeat_region 7285010..7285131 FT /rpt_family="L2" FT repeat_region 7285126..7285179 FT /rpt_family="L2" FT repeat_region 7285474..7285656 FT /rpt_family="L2" FT repeat_region 7285991..7286195 FT /rpt_family="MIR" FT repeat_region 7286325..7286449 FT /rpt_family="MIR" FT repeat_region 7286456..7286729 FT /rpt_family="MaLR" FT repeat_region 7286764..7287059 FT /rpt_family="Alu" FT repeat_region 7288282..7288446 FT /rpt_family="MIR" FT repeat_region 7290102..7290252 FT /rpt_family="MaLR" FT repeat_region 7290273..7290317 FT /rpt_family="G-rich" FT repeat_region 7290319..7290361 FT /rpt_family="GA-rich" FT repeat_region 7290363..7290508 FT /rpt_family="MaLR" FT repeat_region 7290592..7290636 FT /rpt_family="L2" FT repeat_region 7290931..7291210 FT /rpt_family="L2" FT repeat_region 7291224..7291279 FT /rpt_family="L2" FT repeat_region 7292261..7292386 FT /rpt_family="MIR" FT repeat_region 7292395..7292452 FT /rpt_family="(TG)n" FT repeat_region 7292518..7292547 FT /rpt_family="(TTCA)n" FT repeat_region 7292560..7293051 FT /rpt_family="L2" FT repeat_region 7293517..7293596 FT /rpt_family="MIR" FT repeat_region 7294749..7295049 FT /rpt_family="Alu" FT repeat_region 7296395..7296884 FT /rpt_family="CT-rich" FT repeat_region 7296893..7296964 FT /rpt_family="C-rich" FT repeat_region 7298321..7298442 FT /rpt_family="MIR" FT repeat_region 7299417..7299480 FT /rpt_family="CR1" FT repeat_region 7299561..7299955 FT /rpt_family="AcHobo" FT repeat_region 7302263..7302391 FT /rpt_family="MIR" FT repeat_region 7302933..7303060 FT /rpt_family="L2" FT repeat_region 7304056..7304093 FT /rpt_family="L2" FT repeat_region 7304104..7304494 FT /rpt_family="L2" FT repeat_region 7304497..7304539 FT /rpt_family="(TG)n" FT repeat_region 7305659..7305763 FT /rpt_family="MIR" FT repeat_region 7305798..7305959 FT /rpt_family="L2" FT repeat_region 7306059..7306115 FT /rpt_family="CT-rich" FT repeat_region 7306756..7307057 FT /rpt_family="Alu" FT repeat_region 7309176..7309232 FT /rpt_family="MIR" FT repeat_region 7309484..7309655 FT /rpt_family="(TG)n" FT repeat_region 7310902..7311048 FT /rpt_family="MIR" FT repeat_region 7311938..7312058 FT /rpt_family="MIR" FT repeat_region 7312649..7313592 FT /rpt_family="L1" FT repeat_region 7313593..7313901 FT /rpt_family="Alu" FT repeat_region 7313902..7314021 FT /rpt_family="L1" FT repeat_region 7315006..7315122 FT /rpt_family="L2" FT repeat_region 7315394..7315532 FT /rpt_family="L2" FT repeat_region 7316055..7316365 FT /rpt_family="Alu" FT repeat_region 7316528..7316859 FT /rpt_family="Alu" FT repeat_region 7317051..7317096 FT /rpt_family="MIR" FT repeat_region 7317330..7317543 FT /rpt_family="L2" FT repeat_region 7317648..7317987 FT /rpt_family="(TCCA)n" FT repeat_region 7318011..7318108 FT /rpt_family="L2" FT repeat_region 7318266..7318312 FT /rpt_family="MIR" FT repeat_region 7319634..7319685 FT /rpt_family="MaLR" FT repeat_region 7319813..7320036 FT /rpt_family="MIR" FT repeat_region 7320194..7320384 FT /rpt_family="MIR" FT repeat_region 7320457..7320901 FT /rpt_family="L1" FT repeat_region 7320895..7321075 FT /rpt_family="L1" FT repeat_region 7321150..7321455 FT /rpt_family="Alu" FT repeat_region 7321748..7321884 FT /rpt_family="Alu" FT repeat_region 7322574..7322645 FT /rpt_family="CT-rich" FT repeat_region 7322663..7322676 FT /rpt_family="L1" FT repeat_region 7322677..7323092 FT /rpt_family="L1" FT repeat_region 7323093..7323241 FT /rpt_family="L1" FT repeat_region 7323242..7323659 FT /rpt_family="L2" FT repeat_region 7325725..7325907 FT /rpt_family="MIR" FT repeat_region 7326618..7326724 FT /rpt_family="MIR" FT repeat_region 7326993..7327051 FT /rpt_family="MIR" FT repeat_region 7327127..7327148 FT /rpt_family="(TGAA)n" FT repeat_region 7327332..7327487 FT /rpt_family="CR1" FT repeat_region 7327698..7327835 FT /rpt_family="L2" FT repeat_region 7328843..7329238 FT /rpt_family="MaLR" FT repeat_region 7329710..7329745 FT /rpt_family="MIR" FT repeat_region 7329746..7330062 FT /rpt_family="Alu" FT repeat_region 7330063..7330202 FT /rpt_family="MIR" FT repeat_region 7331355..7331423 FT /rpt_family="MaLR" FT repeat_region 7331424..7331535 FT /rpt_family="MER2_type" FT repeat_region 7331537..7331661 FT /rpt_family="MER2_type" FT repeat_region 7331667..7332081 FT /rpt_family="MaLR" FT repeat_region 7332390..7332558 FT /rpt_family="MIR" FT repeat_region 7332588..7332711 FT /rpt_family="L2" FT repeat_region 7332741..7332963 FT /rpt_family="L2" FT repeat_region 7333379..7333484 FT /rpt_family="MER1_type" FT repeat_region 7333566..7333703 FT /rpt_family="MIR" FT repeat_region 7333812..7333850 FT /rpt_family="L2" FT repeat_region 7334545..7334675 FT /rpt_family="MIR" FT repeat_region 7334645..7334746 FT /rpt_family="MIR" FT repeat_region 7335219..7335315 FT /rpt_family="MIR" FT repeat_region 7335851..7335962 FT /rpt_family="MER1_type" FT repeat_region 7336213..7336264 FT /rpt_family="L2" FT repeat_region 7336361..7336762 FT /rpt_family="L2" FT repeat_region 7337436..7337546 FT /rpt_family="MIR" FT repeat_region 7338575..7338746 FT /rpt_family="MIR" FT repeat_region 7338871..7338950 FT /rpt_family="MIR" FT repeat_region 7339132..7339294 FT /rpt_family="L2" FT repeat_region 7339805..7340127 FT /rpt_family="(TGGA)n" FT repeat_region 7340140..7340178 FT /rpt_family="(TGGA)n" FT repeat_region 7340223..7340360 FT /rpt_family="MIR" FT repeat_region 7340426..7340461 FT /rpt_family="AT_rich" FT repeat_region 7341089..7341494 FT /rpt_family="MaLR" FT repeat_region 7341679..7341757 FT /rpt_family="MIR" FT repeat_region 7341855..7341958 FT /rpt_family="MIR" FT repeat_region 7342055..7342137 FT /rpt_family="AcHobo" FT repeat_region 7342971..7343205 FT /rpt_family="L2" FT repeat_region 7343424..7343861 FT /rpt_family="L1" FT repeat_region 7343887..7343930 FT /rpt_family="L2" FT repeat_region 7344032..7344118 FT /rpt_family="Tip100" FT repeat_region 7345016..7345144 FT /rpt_family="MIR" FT repeat_region 7345299..7345411 FT /rpt_family="MIR" FT repeat_region 7347093..7347195 FT /rpt_family="MIR" FT repeat_region 7347314..7347366 FT /rpt_family="MIR" FT repeat_region 7347671..7348495 FT /rpt_family="L1" FT repeat_region 7348625..7348746 FT /rpt_family="L2" FT repeat_region 7348766..7348798 FT /rpt_family="AT_rich" FT repeat_region 7349138..7349357 FT /rpt_family="MIR" FT repeat_region 7350058..7350263 FT /rpt_family="MIR" FT repeat_region 7350270..7350579 FT /rpt_family="Alu" FT repeat_region 7353357..7353401 FT /rpt_family="CT-rich" FT repeat_region 7353403..7353682 FT /rpt_family="(TCCA)n" FT repeat_region 7353702..7353779 FT /rpt_family="(TCCA)n" FT repeat_region 7353893..7354053 FT /rpt_family="L2" FT repeat_region 7354060..7354181 FT /rpt_family="MIR" FT repeat_region 7354668..7354735 FT /rpt_family="MIR" FT repeat_region 7355233..7355287 FT /rpt_family="L2" FT repeat_region 7356188..7356304 FT /rpt_family="MIR" FT repeat_region 7356425..7356447 FT /rpt_family="(GA)n" FT repeat_region 7357104..7357308 FT /rpt_family="MaLR" FT repeat_region 7357674..7358013 FT /rpt_family="L2" FT repeat_region 7358014..7358422 FT /rpt_family="MaLR" FT repeat_region 7358423..7358543 FT /rpt_family="L2" FT repeat_region 7359974..7360146 FT /rpt_family="MIR" FT repeat_region 7360424..7360532 FT /rpt_family="L1" FT repeat_region 7360556..7360747 FT /rpt_family="Alu" FT repeat_region 7360748..7361054 FT /rpt_family="Alu" FT repeat_region 7361055..7361160 FT /rpt_family="Alu" FT repeat_region 7361864..7362125 FT /rpt_family="MIR" FT repeat_region 7362296..7362589 FT /rpt_family="Alu" FT repeat_region 7364423..7364600 FT /rpt_family="(CACCAT)n" FT repeat_region 7364622..7364979 FT /rpt_family="(CACCAT)n" FT repeat_region 7364991..7365172 FT /rpt_family="(CACCAT)n" FT repeat_region 7365187..7365385 FT /rpt_family="(CACCAT)n" FT repeat_region 7365400..7365598 FT /rpt_family="(CACCAT)n" FT repeat_region 7365611..7365672 FT /rpt_family="(CACCAT)n" FT repeat_region 7365684..7365859 FT /rpt_family="(CACCAT)n" FT repeat_region 7365860..7365887 FT /rpt_family="(CAT)n" FT repeat_region 7366397..7366579 FT /rpt_family="MIR" FT repeat_region 7366624..7366836 FT /rpt_family="MIR" FT repeat_region 7367927..7367977 FT /rpt_family="(TTCC)n" FT repeat_region 7368213..7368611 FT /rpt_family="L2" FT repeat_region 7368672..7369027 FT /rpt_family="CR1" FT repeat_region 7369041..7369253 FT /rpt_family="MIR" FT repeat_region 7370469..7370756 FT /rpt_family="MaLR" FT repeat_region 7370757..7371066 FT /rpt_family="Alu" FT repeat_region 7371067..7371135 FT /rpt_family="MaLR" FT repeat_region 7371196..7371252 FT /rpt_family="MIR" FT repeat_region 7371677..7371750 FT /rpt_family="MIR" FT repeat_region 7373994..7374029 FT /rpt_family="L1" FT repeat_region 7374030..7374334 FT /rpt_family="Alu" FT repeat_region 7374335..7375185 FT /rpt_family="L1" FT repeat_region 7375186..7375206 FT /rpt_family="(TA)n" FT repeat_region 7375207..7375518 FT /rpt_family="Alu" FT repeat_region 7375519..7375835 FT /rpt_family="L1" FT repeat_region 7375836..7375928 FT /rpt_family="(TTTC)n" FT repeat_region 7375929..7375974 FT /rpt_family="L1" FT repeat_region 7377584..7377742 FT /rpt_family="MIR" FT repeat_region 7377938..7378021 FT /rpt_family="L1" FT repeat_region 7378022..7378328 FT /rpt_family="Alu" FT repeat_region 7378329..7378427 FT /rpt_family="L1" FT repeat_region 7378777..7379026 FT /rpt_family="L1" FT repeat_region 7380042..7380409 FT /rpt_family="MaLR" FT repeat_region 7380987..7381160 FT /rpt_family="CR1" FT repeat_region 7381302..7381446 FT /rpt_family="MIR" FT repeat_region 7382107..7382147 FT /rpt_family="CR1" FT repeat_region 7382425..7382534 FT /rpt_family="MER1_type" FT repeat_region 7382536..7382825 FT /rpt_family="Alu" FT repeat_region 7384572..7384813 FT /rpt_family="AcHobo" FT repeat_region 7385888..7386076 FT /rpt_family="MIR" FT repeat_region 7387799..7388398 FT /rpt_family="(CA)n" FT repeat_region 7388413..7388583 FT /rpt_family="(CA)n" FT repeat_region 7388598..7388778 FT /rpt_family="(CA)n" FT repeat_region 7388793..7388963 FT /rpt_family="(CA)n" FT repeat_region 7388978..7389158 FT /rpt_family="(CA)n" FT repeat_region 7389173..7389314 FT /rpt_family="(CA)n" FT repeat_region 7389331..7389509 FT /rpt_family="(CA)n" FT repeat_region 7389526..7389849 FT /rpt_family="(CA)n" FT repeat_region 7390152..7390827 FT /rpt_family="L1" FT repeat_region 7391273..7391394 FT /rpt_family="L2" FT repeat_region 7391710..7391783 FT /rpt_family="MER1_type" FT repeat_region 7392798..7392838 FT /rpt_family="MIR" FT repeat_region 7393376..7393532 FT /rpt_family="MIR" FT repeat_region 7393709..7393863 FT /rpt_family="AcHobo" FT repeat_region 7394509..7394681 FT /rpt_family="MIR" FT repeat_region 7395208..7395353 FT /rpt_family="MIR" FT repeat_region 7395582..7395663 FT /rpt_family="MIR" FT repeat_region 7395995..7396299 FT /rpt_family="L2" FT repeat_region 7396360..7396639 FT /rpt_family="CR1" FT repeat_region 7397402..7397424 FT /rpt_family="(TGAA)n" FT repeat_region 7400056..7400157 FT /rpt_family="MIR" FT repeat_region 7400163..7400480 FT /rpt_family="L1" FT repeat_region 7400594..7400896 FT /rpt_family="L1" FT repeat_region 7401618..7401783 FT /rpt_family="MER1_type" FT repeat_region 7401823..7402122 FT /rpt_family="L2" FT repeat_region 7402189..7402216 FT /rpt_family="(CCA)n" FT repeat_region 7402331..7403121 FT /rpt_family="(TGGA)n" FT repeat_region 7404116..7404277 FT /rpt_family="L1" FT repeat_region 7404449..7404651 FT /rpt_family="L1" FT repeat_region 7405098..7405208 FT /rpt_family="MaLR" FT repeat_region 7405689..7405725 FT /rpt_family="(TA)n" FT repeat_region 7410939..7411638 FT /rpt_family="L1" FT repeat_region 7412179..7412290 FT /rpt_family="MIR" FT repeat_region 7412677..7412980 FT /rpt_family="Alu" FT repeat_region 7413074..7413270 FT /rpt_family="CT-rich" FT repeat_region 7413278..7413353 FT /rpt_family="(TCCA)n" FT repeat_region 7415119..7415414 FT /rpt_family="Alu" FT repeat_region 7415427..7415607 FT /rpt_family="L1" FT repeat_region 7415871..7416179 FT /rpt_family="L2" FT repeat_region 7416180..7416827 FT /rpt_family="ERV1" FT repeat_region 7416898..7417391 FT /rpt_family="MaLR" FT repeat_region 7417498..7417574 FT /rpt_family="L2" FT repeat_region 7417636..7418004 FT /rpt_family="L2" FT repeat_region 7418196..7418694 FT /rpt_family="(CA)n" FT repeat_region 7419209..7419352 FT /rpt_family="MIR" FT repeat_region 7419871..7420206 FT /rpt_family="L2" FT repeat_region 7420397..7420906 FT /rpt_family="MaLR" FT repeat_region 7421546..7421938 FT /rpt_family="MaLR" FT repeat_region 7421944..7422125 FT /rpt_family="MIR" FT repeat_region 7423045..7423268 FT /rpt_family="MIR" FT repeat_region 7423677..7423750 FT /rpt_family="MIR" FT repeat_region 7424432..7424609 FT /rpt_family="L2" FT repeat_region 7425010..7425116 FT /rpt_family="L2" FT repeat_region 7425149..7425308 FT /rpt_family="Alu" FT repeat_region 7425500..7425675 FT /rpt_family="AcHobo" FT repeat_region 7425920..7426028 FT /rpt_family="MIR" FT repeat_region 7426232..7426297 FT /rpt_family="MIR" FT repeat_region 7427642..7427689 FT /rpt_family="MIR" FT repeat_region 7428180..7428278 FT /rpt_family="Alu" FT repeat_region 7428337..7428530 FT /rpt_family="MIR" FT repeat_region 7429284..7429662 FT /rpt_family="MaLR" FT repeat_region 7430066..7430334 FT /rpt_family="L2" FT repeat_region 7430376..7430627 FT /rpt_family="L2" FT repeat_region 7430761..7430814 FT /rpt_family="MIR" FT repeat_region 7431534..7431689 FT /rpt_family="MIR" FT repeat_region 7432091..7432117 FT /rpt_family="(CAAA)n" FT repeat_region 7432700..7432783 FT /rpt_family="L2" FT repeat_region 7434122..7434224 FT /rpt_family="MIR" FT repeat_region 7434860..7435004 FT /rpt_family="MIR" FT misc_feature 7436454..7436645 FT /note="PCR on RP11 DNA to check sequence in HTG clone FT AC080003" FT repeat_region 7438313..7438728 FT /rpt_family="L1" FT repeat_region 7438746..7439454 FT /rpt_family="ERV1" FT repeat_region 7439637..7440886 FT /rpt_family="L1" FT repeat_region 7440887..7440906 FT /rpt_family="(GGAA)n" FT repeat_region 7440907..7441184 FT /rpt_family="L1" FT repeat_region 7441265..7441627 FT /rpt_family="L1" FT repeat_region 7443342..7443505 FT /rpt_family="C-rich" FT repeat_region 7443513..7443708 FT /rpt_family="(CCCCCA)n" FT repeat_region 7443748..7443958 FT /rpt_family="(CCCCCA)n" FT repeat_region 7443977..7444085 FT /rpt_family="(CCCCCA)n" FT repeat_region 7444125..7444288 FT /rpt_family="(CCCCCA)n" FT repeat_region 7444516..7444952 FT /rpt_family="MaLR" FT repeat_region 7445881..7446664 FT /rpt_family="L2" FT repeat_region 7447740..7447819 FT /rpt_family="CT-rich" FT repeat_region 7447902..7447926 FT /rpt_family="(GGGGA)n" FT repeat_region 7448114..7448167 FT /rpt_family="MaLR" FT repeat_region 7448840..7448907 FT /rpt_family="MaLR" FT repeat_region 7449117..7449151 FT /rpt_family="MIR" FT repeat_region 7449131..7449192 FT /rpt_family="MIR" FT repeat_region 7450114..7450224 FT /rpt_family="CT-rich" FT repeat_region 7450238..7450418 FT /rpt_family="CT-rich" FT repeat_region 7450436..7450611 FT /rpt_family="CT-rich" FT repeat_region 7450612..7451022 FT /rpt_family="(TCCC)n" FT repeat_region 7451024..7451118 FT /rpt_family="CT-rich" FT repeat_region 7451127..7451289 FT /rpt_family="MIR" FT repeat_region 7452425..7452883 FT /rpt_family="(TGAG)n" FT repeat_region 7452898..7452974 FT /rpt_family="(TGAG)n" FT repeat_region 7453003..7453026 FT /rpt_family="(CAG)n" FT repeat_region 7453396..7453559 FT /rpt_family="L2" FT repeat_region 7453868..7454168 FT /rpt_family="Alu" FT repeat_region 7454334..7454484 FT /rpt_family="MIR" FT repeat_region 7454607..7454788 FT /rpt_family="(TTGGGG)n" FT repeat_region 7454891..7455220 FT /rpt_family="(TTGGGG)n" FT repeat_region 7455431..7455616 FT /rpt_family="(TTGGGG)n" FT repeat_region 7455567..7455728 FT /rpt_family="(GGGTG)n" FT repeat_region 7455661..7455846 FT /rpt_family="(TTGGGG)n" FT repeat_region 7455799..7455978 FT /rpt_family="(GGGTG)n" FT repeat_region 7455873..7456056 FT /rpt_family="(TTGGGG)n" FT repeat_region 7455971..7456150 FT /rpt_family="(TTAGGG)n" FT repeat_region 7456363..7456709 FT /rpt_family="(TTGGGG)n" FT repeat_region 7456904..7457244 FT /rpt_family="(TTGGGG)n" FT repeat_region 7457273..7457427 FT /rpt_family="(TTGGGG)n" FT repeat_region 7457367..7457540 FT /rpt_family="(TTAGGG)n" FT repeat_region 7457634..7458007 FT /rpt_family="MaLR" FT repeat_region 7458031..7458058 FT /rpt_family="(TGAA)n" FT repeat_region 7458535..7458705 FT /rpt_family="MIR" FT repeat_region 7458752..7458848 FT /rpt_family="L2" FT repeat_region 7460356..7460662 FT /rpt_family="L2" FT repeat_region 7460854..7460994 FT /rpt_family="MIR" FT repeat_region 7461140..7461240 FT /rpt_family="MIR" FT repeat_region 7463969..7464092 FT /rpt_family="MIR" FT repeat_region 7464368..7464446 FT /rpt_family="L2" FT repeat_region 7464769..7464839 FT /rpt_family="MIR" FT repeat_region 7465014..7465135 FT /rpt_family="MIR" FT repeat_region 7465761..7466196 FT /rpt_family="L2" FT repeat_region 7466747..7466811 FT /rpt_family="MIR" FT repeat_region 7467585..7467724 FT /rpt_family="MIR" FT repeat_region 7467861..7468191 FT /rpt_family="MaLR" FT repeat_region 7468288..7468416 FT /rpt_family="L2" FT repeat_region 7469395..7469522 FT /rpt_family="MIR" FT repeat_region 7469690..7470031 FT /rpt_family="CR1" FT repeat_region 7470590..7470812 FT /rpt_family="MIR" FT repeat_region 7470826..7471002 FT /rpt_family="(TGG)n" FT repeat_region 7471003..7471032 FT /rpt_family="(ATG)n" FT repeat_region 7471340..7471507 FT /rpt_family="MER1_type" FT repeat_region 7471806..7471878 FT /rpt_family="MIR" FT repeat_region 7471881..7472134 FT /rpt_family="(TCCA)n" FT repeat_region 7472555..7472617 FT /rpt_family="L2" FT repeat_region 7472641..7472824 FT /rpt_family="L2" FT repeat_region 7473924..7474154 FT /rpt_family="L2" FT repeat_region 7475192..7475249 FT /rpt_family="L2" FT repeat_region 7475590..7475712 FT /rpt_family="L2" FT repeat_region 7475773..7475902 FT /rpt_family="L2" FT repeat_region 7475903..7475944 FT /rpt_family="(TGAA)n" FT repeat_region 7476459..7476879 FT /rpt_family="MaLR" FT repeat_region 7477427..7477463 FT /rpt_family="(CA)n" FT repeat_region 7477973..7478288 FT /rpt_family="ERVL" FT repeat_region 7479046..7479182 FT /rpt_family="(GCTG)n" FT repeat_region 7480022..7480339 FT /rpt_family="L2" FT repeat_region 7480361..7480446 FT /rpt_family="L2" FT repeat_region 7480718..7481266 FT /rpt_family="ERVL" FT repeat_region 7481569..7481670 FT /rpt_family="L2" FT repeat_region 7482233..7482310 FT /rpt_family="Tip100" FT repeat_region 7484602..7484765 FT /rpt_family="MaLR" FT repeat_region 7484766..7485069 FT /rpt_family="Alu" FT repeat_region 7485070..7485329 FT /rpt_family="MaLR" FT repeat_region 7485444..7485657 FT /rpt_family="L1" FT repeat_region 7488293..7488718 FT /rpt_family="MaLR" FT repeat_region 7490710..7490796 FT /rpt_family="L2" FT repeat_region 7492648..7492691 FT /rpt_family="MIR" FT repeat_region 7492813..7493261 FT /rpt_family="L2" FT repeat_region 7493329..7493393 FT /rpt_family="MIR" FT repeat_region 7493944..7494371 FT /rpt_family="L1" FT repeat_region 7494632..7495079 FT /rpt_family="MaLR" FT repeat_region 7495272..7495334 FT /rpt_family="MIR" FT repeat_region 7495724..7495797 FT /rpt_family="(CA)n" FT repeat_region 7495828..7496069 FT /rpt_family="L1" FT repeat_region 7496070..7496429 FT /rpt_family="MaLR" FT repeat_region 7496430..7496549 FT /rpt_family="L1" FT repeat_region 7497111..7497237 FT /rpt_family="MIR" FT repeat_region 7497342..7497432 FT /rpt_family="MIR" FT repeat_region 7497943..7498119 FT /rpt_family="MIR" FT repeat_region 7498155..7498212 FT /rpt_family="C-rich" FT repeat_region 7498722..7498914 FT /rpt_family="MIR" FT repeat_region 7499344..7499567 FT /rpt_family="MIR" FT repeat_region 7500790..7500941 FT /rpt_family="(TG)n" FT repeat_region 7504367..7504507 FT /rpt_family="MIR" FT repeat_region 7505159..7505263 FT /rpt_family="(CAGAGA)n" FT repeat_region 7506130..7506323 FT /rpt_family="MIR" FT repeat_region 7506327..7506514 FT /rpt_family="AcHobo" FT repeat_region 7507264..7507389 FT /rpt_family="MIR" FT repeat_region 7507438..7507635 FT /rpt_family="MIR" FT repeat_region 7507636..7507718 FT /rpt_family="MIR" FT repeat_region 7508184..7508232 FT /rpt_family="(TCCA)n" FT repeat_region 7508300..7508475 FT /rpt_family="MIR" FT repeat_region 7508892..7509200 FT /rpt_family="Alu" FT repeat_region 7509912..7509993 FT /rpt_family="GA-rich" FT repeat_region 7510042..7510077 FT /rpt_family="L1" FT repeat_region 7510078..7510362 FT /rpt_family="Alu" FT repeat_region 7510363..7510453 FT /rpt_family="L1" FT repeat_region 7510846..7511011 FT /rpt_family="ERVL" FT repeat_region 7512448..7512639 FT /rpt_family="L2" FT repeat_region 7513063..7513098 FT /rpt_family="(GA)n" FT repeat_region 7513128..7513166 FT /rpt_family="(CA)n" FT repeat_region 7513167..7513197 FT /rpt_family="(CA)n" FT repeat_region 7513217..7513272 FT /rpt_family="(CAGAGA)n" FT repeat_region 7514072..7514169 FT /rpt_family="GA-rich" FT repeat_region 7514788..7514910 FT /rpt_family="MIR" FT repeat_region 7516127..7516236 FT /rpt_family="L2" FT repeat_region 7516396..7516775 FT /rpt_family="ERVL" FT repeat_region 7516866..7516976 FT /rpt_family="MIR" FT repeat_region 7517537..7517720 FT /rpt_family="MIR" FT repeat_region 7517796..7517825 FT /rpt_family="(TTCA)n" FT repeat_region 7517832..7517923 FT /rpt_family="L2" FT repeat_region 7521157..7521212 FT /rpt_family="MIR" FT repeat_region 7522706..7522823 FT /rpt_family="MIR" FT repeat_region 7523453..7523596 FT /rpt_family="MIR" FT repeat_region 7523733..7523923 FT /rpt_family="MIR" FT repeat_region 7524322..7524619 FT /rpt_family="CT-rich" FT repeat_region 7524620..7524692 FT /rpt_family="C-rich" FT repeat_region 7524695..7524863 FT /rpt_family="CT-rich" FT repeat_region 7524989..7525096 FT /rpt_family="MIR" FT repeat_region 7525131..7525170 FT /rpt_family="L2" FT repeat_region 7525823..7526166 FT /rpt_family="MaLR" FT repeat_region 7527580..7527762 FT /rpt_family="CT-rich" FT repeat_region 7528002..7528084 FT /rpt_family="MER1_type" FT repeat_region 7528086..7528553 FT /rpt_family="L1" FT repeat_region 7528562..7528762 FT /rpt_family="MER1_type" FT repeat_region 7528941..7529412 FT /rpt_family="MaLR" FT repeat_region 7529744..7529790 FT /rpt_family="(TC)n" FT repeat_region 7529804..7529922 FT /rpt_family="L2" FT repeat_region 7530142..7530441 FT /rpt_family="Alu" FT repeat_region 7530503..7530880 FT /rpt_family="MaLR" FT repeat_region 7530887..7531159 FT /rpt_family="L2" FT repeat_region 7532798..7532979 FT /rpt_family="MIR" FT repeat_region 7532987..7533091 FT /rpt_family="MIR" FT repeat_region 7534061..7534180 FT /rpt_family="MIR" FT repeat_region 7534536..7534559 FT /rpt_family="(TTTTG)n" FT repeat_region 7534732..7534912 FT /rpt_family="MIR" FT repeat_region 7535445..7535567 FT /rpt_family="MIR" FT repeat_region 7535892..7535918 FT /rpt_family="(TGAA)n" FT repeat_region 7536183..7536625 FT /rpt_family="MaLR" FT repeat_region 7537157..7537351 FT /rpt_family="MIR" FT repeat_region 7537843..7538053 FT /rpt_family="MIR" FT repeat_region 7538163..7538304 FT /rpt_family="CR1" FT repeat_region 7538569..7538678 FT /rpt_family="MIR" FT repeat_region 7538903..7539022 FT /rpt_family="MIR" FT repeat_region 7539180..7539253 FT /rpt_family="L2" FT repeat_region 7539283..7539397 FT /rpt_family="L2" FT repeat_region 7539453..7539725 FT /rpt_family="Alu" FT repeat_region 7540315..7540338 FT /rpt_family="(CA)n" FT repeat_region 7540665..7540877 FT /rpt_family="MIR" FT repeat_region 7540983..7541100 FT /rpt_family="MIR" FT repeat_region 7541280..7541357 FT /rpt_family="CT-rich" FT repeat_region 7541864..7541961 FT /rpt_family="(CCCCG)n" FT repeat_region 7542525..7542619 FT /rpt_family="MIR" FT repeat_region 7543980..7544430 FT /rpt_family="MaLR" FT repeat_region 7544443..7544548 FT /rpt_family="MIR" FT repeat_region 7544991..7545577 FT /rpt_family="(TCCA)n" FT repeat_region 7545578..7545757 FT /rpt_family="(TCCA)n" FT repeat_region 7547535..7547893 FT /rpt_family="MaLR" FT repeat_region 7549253..7549587 FT /rpt_family="L2" FT repeat_region 7550261..7550344 FT /rpt_family="MIR" FT repeat_region 7550661..7550803 FT /rpt_family="MaLR" FT repeat_region 7551377..7551423 FT /rpt_family="L2" FT repeat_region 7551837..7551888 FT /rpt_family="(TG)n" FT repeat_region 7551988..7552120 FT /rpt_family="MIR" FT repeat_region 7553028..7553283 FT /rpt_family="L2" FT repeat_region 7555056..7555335 FT /rpt_family="L1" FT repeat_region 7557316..7557563 FT /rpt_family="L2" FT repeat_region 7557759..7557913 FT /rpt_family="L2" FT repeat_region 7557924..7558209 FT /rpt_family="L2" FT repeat_region 7558390..7558564 FT /rpt_family="(TCCA)n" FT repeat_region 7558592..7558763 FT /rpt_family="(TCCA)n" FT repeat_region 7559048..7559169 FT /rpt_family="MIR" FT repeat_region 7559639..7559693 FT /rpt_family="MIR" FT repeat_region 7559955..7560161 FT /rpt_family="MER1_type" FT repeat_region 7561375..7561511 FT /rpt_family="MIR" FT repeat_region 7563114..7563480 FT /rpt_family="(TCCA)n" FT repeat_region 7563493..7563670 FT /rpt_family="(TCCA)n" FT repeat_region 7563704..7564153 FT /rpt_family="L2" FT repeat_region 7564201..7564323 FT /rpt_family="MER1_type" FT repeat_region 7564333..7564755 FT /rpt_family="MaLR" FT repeat_region 7564973..7565135 FT /rpt_family="MIR" FT repeat_region 7565340..7565475 FT /rpt_family="CR1" FT repeat_region 7566026..7566283 FT /rpt_family="MaLR" FT repeat_region 7566348..7566460 FT /rpt_family="MIR" FT repeat_region 7567124..7568090 FT /rpt_family="(ATG)n" FT repeat_region 7568202..7568236 FT /rpt_family="MIR" FT repeat_region 7568277..7568357 FT /rpt_family="MaLR" FT repeat_region 7568395..7568508 FT /rpt_family="MaLR" FT repeat_region 7568624..7568688 FT /rpt_family="MaLR" FT repeat_region 7568722..7568776 FT /rpt_family="MIR" FT repeat_region 7568816..7569866 FT /rpt_family="L1" FT repeat_region 7569894..7570492 FT /rpt_family="MER1_type" FT repeat_region 7570958..7571259 FT /rpt_family="Alu" FT repeat_region 7572917..7573013 FT /rpt_family="L2" FT repeat_region 7573294..7573333 FT /rpt_family="L2" FT repeat_region 7573946..7575056 FT /rpt_family="MER1_type" FT repeat_region 7575115..7575216 FT /rpt_family="MER1_type" FT repeat_region 7575233..7575409 FT /rpt_family="Alu" FT repeat_region 7575706..7575880 FT /rpt_family="L2" FT repeat_region 7576285..7576382 FT /rpt_family="GA-rich" FT repeat_region 7576937..7577327 FT /rpt_family="MER1_type" FT repeat_region 7577325..7577432 FT /rpt_family="MER1_type" FT repeat_region 7578249..7578307 FT /rpt_family="L2" FT repeat_region 7578494..7578721 FT /rpt_family="MER1_type" FT repeat_region 7578784..7578855 FT /rpt_family="L2" FT repeat_region 7579698..7580099 FT /rpt_family="MaLR" FT repeat_region 7580384..7580553 FT /rpt_family="MIR" FT repeat_region 7580969..7581007 FT /rpt_family="AT_rich" FT repeat_region 7581113..7581276 FT /rpt_family="MIR" FT repeat_region 7581386..7581732 FT /rpt_family="L2" FT repeat_region 7581931..7582234 FT /rpt_family="Alu" FT repeat_region 7582688..7582875 FT /rpt_family="MIR" FT repeat_region 7582884..7583154 FT /rpt_family="L1" FT repeat_region 7583623..7583794 FT /rpt_family="L1" FT repeat_region 7583813..7584053 FT /rpt_family="MIR" FT repeat_region 7584365..7584421 FT /rpt_family="A-rich" FT repeat_region 7584704..7584754 FT /rpt_family="L2" FT misc_feature complement(7584942..7774746) FT /note="Quality: Phrap Quality >=40 99.1% of Sequence; FT Estimated Total Number of Errors is 1.0.; STS Content:; FT L14199 HUM4S1198; L14184 HUM4S1167; L14083 HUM4S1017" FT repeat_region 7772772..7772947 FT /rpt_family="L2" FT repeat_region 7772966..7773047 FT /rpt_family="Alu" FT repeat_region 7773059..7773190 FT /rpt_family="(TA)n" FT repeat_region 7773349..7773401 FT /rpt_family="MIR" FT repeat_region 7774129..7774210 FT /rpt_family="L2" FT repeat_region 7775001..7775034 FT /rpt_family="MIR" FT repeat_region 7776670..7776874 FT /rpt_family="Alu" FT repeat_region 7777279..7777356 FT /rpt_family="L2" FT repeat_region 7777394..7777569 FT /rpt_family="MIR" FT repeat_region 7777957..7778094 FT /rpt_family="MIR" FT repeat_region 7778102..7778142 FT /rpt_family="(TG)n" FT repeat_region 7779464..7779632 FT /rpt_family="L2" FT repeat_region 7779803..7779954 FT /rpt_family="MIR" FT repeat_region 7781365..7781560 FT /rpt_family="MIR" FT repeat_region 7782259..7782373 FT /rpt_family="Alu" FT repeat_region 7784874..7785166 FT /rpt_family="Alu" FT repeat_region 7786125..7786240 FT /rpt_family="L2" FT repeat_region 7786852..7786928 FT /rpt_family="L2" FT repeat_region 7787382..7787679 FT /rpt_family="Alu" FT repeat_region 7788445..7788495 FT /rpt_family="MER1_type" FT repeat_region 7788528..7788594 FT /rpt_family="MER1_type" FT repeat_region 7788614..7788648 FT /rpt_family="L2" FT repeat_region 7788751..7788832 FT /rpt_family="ERV1" FT repeat_region 7788846..7789382 FT /rpt_family="ERV1" FT repeat_region 7790770..7790873 FT /rpt_family="MIR" FT repeat_region 7792063..7792084 FT /rpt_family="AT_rich" FT repeat_region 7793078..7793241 FT /rpt_family="MIR" FT repeat_region 7793302..7793597 FT /rpt_family="Alu" FT repeat_region 7793685..7794813 FT /rpt_family="MER1_type" FT repeat_region 7794889..7794923 FT /rpt_family="AT_rich" FT repeat_region 7795014..7795208 FT /rpt_family="MER1_type" FT repeat_region 7796245..7796552 FT /rpt_family="Alu" FT repeat_region 7797141..7797429 FT /rpt_family="Alu" FT repeat_region 7797728..7798194 FT /rpt_family="L1" FT repeat_region 7798195..7798499 FT /rpt_family="Alu" FT repeat_region 7798505..7798797 FT /rpt_family="Alu" FT repeat_region 7798798..7799778 FT /rpt_family="L1" FT repeat_region 7800808..7800956 FT /rpt_family="MIR" FT repeat_region 7802728..7802922 FT /rpt_family="CR1" FT repeat_region 7803550..7803668 FT /rpt_family="Alu" FT repeat_region 7804160..7804228 FT /rpt_family="MIR" FT repeat_region 7804360..7804655 FT /rpt_family="Alu" FT repeat_region 7806801..7806926 FT /rpt_family="Alu" FT repeat_region 7807022..7807065 FT /rpt_family="MIR" FT repeat_region 7807252..7807398 FT /rpt_family="MIR" FT repeat_region 7807409..7807502 FT /rpt_family="L2" FT repeat_region 7808721..7808868 FT /rpt_family="MIR" FT repeat_region 7810351..7810757 FT /rpt_family="MaLR" FT repeat_region 7810787..7810951 FT /rpt_family="L1" FT repeat_region 7811115..7811140 FT /rpt_family="MIR" FT repeat_region 7811589..7811889 FT /rpt_family="Alu" FT repeat_region 7811891..7811968 FT /rpt_family="L2" FT repeat_region 7812039..7812202 FT /rpt_family="L2" FT repeat_region 7812302..7812469 FT /rpt_family="MER1_type" FT repeat_region 7813345..7813581 FT /rpt_family="MaLR" FT repeat_region 7815798..7816644 FT /rpt_family="L1" FT repeat_region 7816671..7817148 FT /rpt_family="L1" FT repeat_region 7817219..7817374 FT /rpt_family="MIR" FT repeat_region 7818766..7819047 FT /rpt_family="L1" FT repeat_region 7819048..7819346 FT /rpt_family="Alu" FT repeat_region 7819347..7819425 FT /rpt_family="L1" FT repeat_region 7819509..7819718 FT /rpt_family="L1" FT repeat_region 7819771..7820115 FT /rpt_family="ERVL" FT repeat_region 7820486..7820615 FT /rpt_family="MIR" FT repeat_region 7821294..7821473 FT /rpt_family="L2" FT repeat_region 7821510..7821691 FT /rpt_family="MIR" FT repeat_region 7821691..7822326 FT /rpt_family="L2" FT repeat_region 7822564..7822851 FT /rpt_family="Alu" FT repeat_region 7822872..7823044 FT /rpt_family="MIR" FT repeat_region 7823195..7823319 FT /rpt_family="L2" FT repeat_region 7823922..7824116 FT /rpt_family="MIR" FT repeat_region 7824301..7824619 FT /rpt_family="Alu" FT repeat_region 7824768..7824822 FT /rpt_family="L2" FT repeat_region 7825033..7825072 FT /rpt_family="GA-rich" FT repeat_region 7826375..7826637 FT /rpt_family="L1" FT repeat_region 7827152..7827584 FT /rpt_family="L1" FT repeat_region 7828535..7828597 FT /rpt_family="L1" FT repeat_region 7828621..7829016 FT /rpt_family="L1" FT repeat_region 7829017..7829317 FT /rpt_family="Alu" FT repeat_region 7829318..7829546 FT /rpt_family="L1" FT repeat_region 7829578..7829757 FT /rpt_family="L1" FT repeat_region 7830406..7830581 FT /rpt_family="MIR" FT repeat_region 7830594..7830964 FT /rpt_family="MaLR" FT repeat_region 7831228..7831959 FT /rpt_family="L1" FT repeat_region 7832326..7832345 FT /rpt_family="(TTA)n" FT repeat_region 7832350..7832619 FT /rpt_family="Alu" FT repeat_region 7833120..7833140 FT /rpt_family="AT_rich" FT repeat_region 7834353..7835316 FT /rpt_family="L1" FT repeat_region 7835317..7835614 FT /rpt_family="Alu" FT repeat_region 7835615..7835816 FT /rpt_family="L1" FT repeat_region 7835817..7835864 FT /rpt_family="(CA)n" FT repeat_region 7835865..7836247 FT /rpt_family="L1" FT repeat_region 7836259..7836406 FT /rpt_family="L1" FT repeat_region 7837762..7837979 FT /rpt_family="L1" FT repeat_region 7837955..7838178 FT /rpt_family="L1" FT repeat_region 7838179..7838474 FT /rpt_family="Alu" FT repeat_region 7838475..7838639 FT /rpt_family="L1" FT repeat_region 7838925..7838966 FT /rpt_family="L1" FT repeat_region 7838967..7839325 FT /rpt_family="MaLR" FT repeat_region 7839326..7839463 FT /rpt_family="L1" FT repeat_region 7839464..7839757 FT /rpt_family="Alu" FT repeat_region 7839758..7840026 FT /rpt_family="L1" FT repeat_region 7840165..7840193 FT /rpt_family="AT_rich" FT repeat_region 7840562..7840593 FT /rpt_family="(CA)n" FT repeat_region 7840748..7840779 FT /rpt_family="(TA)n" FT repeat_region 7840780..7841093 FT /rpt_family="Alu" FT repeat_region 7841094..7841186 FT /rpt_family="(TA)n" FT repeat_region 7841552..7841639 FT /rpt_family="MIR" FT repeat_region 7841764..7841872 FT /rpt_family="MIR" FT repeat_region 7841990..7842056 FT /rpt_family="(TG)n" FT repeat_region 7842057..7842338 FT /rpt_family="Alu" FT repeat_region 7842591..7842714 FT /rpt_family="L1" FT repeat_region 7842811..7843121 FT /rpt_family="ERVL" FT repeat_region 7843588..7843649 FT /rpt_family="GA-rich" FT repeat_region 7844029..7844059 FT /rpt_family="(A)n" FT repeat_region 7844225..7844280 FT /rpt_family="GA-rich" FT repeat_region 7844408..7844431 FT /rpt_family="AT_rich" FT repeat_region 7845211..7845239 FT /rpt_family="(CAAAAA)n" FT repeat_region 7845636..7845854 FT /rpt_family="L2" FT repeat_region 7845855..7846009 FT /rpt_family="MaLR" FT repeat_region 7846010..7846029 FT /rpt_family="(GA)n" FT repeat_region 7846030..7846206 FT /rpt_family="MaLR" FT repeat_region 7846207..7846399 FT /rpt_family="L2" FT repeat_region 7846867..7847138 FT /rpt_family="Alu" FT repeat_region 7847139..7847160 FT /rpt_family="(TTA)n" FT repeat_region 7847896..7848042 FT /rpt_family="L1" FT repeat_region 7848358..7848406 FT /rpt_family="L2" FT repeat_region 7849665..7849728 FT /rpt_family="ERVL" FT repeat_region 7849729..7849804 FT /rpt_family="(TGGA)n" FT repeat_region 7849806..7849987 FT /rpt_family="GA-rich" FT repeat_region 7849991..7850517 FT /rpt_family="ERVL" FT repeat_region 7851151..7851265 FT /rpt_family="L2" FT repeat_region 7851685..7851845 FT /rpt_family="L2" FT repeat_region 7852568..7852775 FT /rpt_family="ERVL" FT repeat_region 7852797..7853007 FT /rpt_family="ERVL" FT repeat_region 7853123..7854018 FT /rpt_family="ERVL" FT repeat_region 7854050..7854518 FT /rpt_family="ERVL" FT repeat_region 7854612..7854749 FT /rpt_family="ERVL" FT repeat_region 7854750..7854819 FT /rpt_family="Ricksha" FT repeat_region 7854820..7854953 FT /rpt_family="ERVL" FT repeat_region 7854993..7855189 FT /rpt_family="ERVL" FT repeat_region 7855747..7855794 FT /rpt_family="L2" FT repeat_region 7857977..7858266 FT /rpt_family="Alu" FT repeat_region 7858539..7858774 FT /rpt_family="MIR" FT repeat_region 7859659..7860000 FT /rpt_family="L1" FT repeat_region 7860045..7860072 FT /rpt_family="AT_rich" FT repeat_region 7860866..7861162 FT /rpt_family="Alu" FT repeat_region 7861632..7861878 FT /rpt_family="Alu" FT repeat_region 7861934..7862193 FT /rpt_family="MER2_type" FT repeat_region 7862060..7862195 FT /rpt_family="MER2_type" FT repeat_region 7862206..7862349 FT /rpt_family="MIR" FT repeat_region 7862639..7862670 FT /rpt_family="(CCTCG)n" FT repeat_region 7863778..7864077 FT /rpt_family="Alu" FT repeat_region 7864121..7864151 FT /rpt_family="GC_rich" FT repeat_region 7864152..7864349 FT /rpt_family="L1" FT unsure 7865668..7865893 FT /note="Unresolved tandem repeat." FT unsure complement(7905507..7905530) FT /note="Sequence derived from one plasmid subclone." FT repeat_region 7906202..7906373 FT /rpt_family="MIR" FT repeat_region 7906421..7906448 FT /rpt_family="(TTTG)n" FT repeat_region 7906451..7906734 FT /rpt_family="Alu" FT repeat_region 7907876..7908079 FT /rpt_family="MIR" FT repeat_region 7908466..7908747 FT /rpt_family="Alu" FT repeat_region 7909137..7909282 FT /rpt_family="MIR" FT repeat_region 7909328..7909528 FT /rpt_family="MER2_type" FT repeat_region 7909674..7909951 FT /rpt_family="Alu" FT repeat_region 7910313..7910442 FT /rpt_family="L2" FT repeat_region 7910875..7911076 FT /rpt_family="MIR" FT repeat_region 7911441..7911604 FT /rpt_family="MER1_type" FT repeat_region 7911986..7912062 FT /rpt_family="MIR" FT repeat_region 7913275..7913458 FT /rpt_family="MIR" FT repeat_region 7913872..7914467 FT /rpt_family="L1" FT repeat_region 7914470..7914571 FT /rpt_family="L1" FT repeat_region 7914583..7914827 FT /rpt_family="Alu" FT repeat_region 7914834..7915135 FT /rpt_family="Alu" FT repeat_region 7915140..7915200 FT /rpt_family="MER1_type" FT repeat_region 7915605..7915782 FT /rpt_family="L1" FT repeat_region 7915783..7916081 FT /rpt_family="Alu" FT repeat_region 7916082..7916475 FT /rpt_family="L1" FT repeat_region 7916476..7916775 FT /rpt_family="Alu" FT repeat_region 7916776..7916909 FT /rpt_family="Alu" FT repeat_region 7916911..7917098 FT /rpt_family="L1" FT repeat_region 7917100..7917221 FT /rpt_family="Alu" FT repeat_region 7917273..7917459 FT /rpt_family="MIR" FT repeat_region 7917615..7917653 FT /rpt_family="AT_rich" FT repeat_region 7918758..7918936 FT /rpt_family="MIR" FT repeat_region 7918997..7919151 FT /rpt_family="L1" FT repeat_region 7919662..7919767 FT /rpt_family="MIR" FT repeat_region 7921135..7921336 FT /rpt_family="centr" FT repeat_region 7921362..7921991 FT /rpt_family="L1" FT repeat_region 7922676..7922748 FT /rpt_family="(TA)n" FT repeat_region 7922777..7922905 FT /rpt_family="MIR" FT repeat_region 7922909..7923211 FT /rpt_family="Alu" FT repeat_region 7923228..7923518 FT /rpt_family="L1" FT repeat_region 7923571..7923857 FT /rpt_family="Alu" FT repeat_region 7924429..7924746 FT /rpt_family="Alu" FT repeat_region 7924994..7925202 FT /rpt_family="MaLR" FT repeat_region 7925203..7925491 FT /rpt_family="Alu" FT repeat_region 7925492..7925660 FT /rpt_family="MaLR" FT repeat_region 7925931..7926005 FT /rpt_family="MIR" FT repeat_region 7926368..7926891 FT /rpt_family="ERV1" FT repeat_region 7927158..7927289 FT /rpt_family="Alu" FT repeat_region 7927292..7927599 FT /rpt_family="Alu" FT repeat_region 7927607..7927753 FT /rpt_family="MIR" FT repeat_region 7928463..7928733 FT /rpt_family="Alu" FT repeat_region 7929009..7929218 FT /rpt_family="MIR" FT repeat_region 7929270..7929391 FT /rpt_family="Alu" FT repeat_region 7930111..7930412 FT /rpt_family="Alu" FT repeat_region 7930558..7930678 FT /rpt_family="MIR" FT repeat_region 7931693..7931872 FT /rpt_family="MIR" FT repeat_region 7931873..7932453 FT /rpt_family="ERV1" FT repeat_region 7932488..7932776 FT /rpt_family="Alu" FT repeat_region 7932900..7933053 FT /rpt_family="L1" FT repeat_region 7933117..7933407 FT /rpt_family="Alu" FT repeat_region 7933588..7933883 FT /rpt_family="Alu" FT repeat_region 7934475..7934767 FT /rpt_family="Alu" FT repeat_region 7934890..7935019 FT /rpt_family="MaLR" FT repeat_region 7935020..7935319 FT /rpt_family="Alu" FT repeat_region 7935320..7935694 FT /rpt_family="MaLR" FT repeat_region 7936227..7936317 FT /rpt_family="L2" FT repeat_region 7936929..7937058 FT /rpt_family="MIR" FT repeat_region 7938032..7938226 FT /rpt_family="Alu" FT repeat_region 7938310..7938607 FT /rpt_family="Alu" FT repeat_region 7939082..7939163 FT /rpt_family="MIR" FT repeat_region 7939213..7939513 FT /rpt_family="Alu" FT misc_feature 7940564..7941853 FT /note="CpG_island (%GC=75.6, o/e=1.00, #CpGs=167)" FT repeat_region 7940589..7940616 FT /rpt_family="GC_rich" FT repeat_region 7941484..7941511 FT /rpt_family="GC_rich" FT repeat_region 7941605..7941671 FT /rpt_family="GC_rich" FT repeat_region 7942048..7942345 FT /rpt_family="Alu" FT repeat_region 7942486..7942532 FT /rpt_family="L2" FT repeat_region 7942547..7942676 FT /rpt_family="Alu" FT repeat_region 7942681..7943161 FT /rpt_family="L2" FT repeat_region 7943259..7943548 FT /rpt_family="Alu" FT repeat_region 7944022..7944505 FT /rpt_family="MaLR" FT repeat_region 7944635..7944863 FT /rpt_family="Alu" FT repeat_region 7945150..7945280 FT /rpt_family="AcHobo" FT repeat_region 7945287..7945580 FT /rpt_family="Alu" FT repeat_region 7945588..7945669 FT /rpt_family="(TA)n" FT repeat_region 7945671..7945701 FT /rpt_family="(TTTA)n" FT repeat_region 7945704..7945984 FT /rpt_family="Alu" FT repeat_region 7945993..7946021 FT /rpt_family="AT_rich" FT repeat_region 7946022..7946309 FT /rpt_family="AcHobo" FT repeat_region 7946717..7946851 FT /rpt_family="CR1" FT repeat_region 7946852..7947172 FT /rpt_family="Alu" FT repeat_region 7947173..7947269 FT /rpt_family="CR1" FT repeat_region 7947704..7947933 FT /rpt_family="MaLR" FT repeat_region 7947934..7948351 FT /rpt_family="MaLR" FT repeat_region 7948352..7948620 FT /rpt_family="MaLR" FT repeat_region 7948622..7948654 FT /rpt_family="L1" FT repeat_region 7948655..7948970 FT /rpt_family="Alu" FT repeat_region 7948971..7948981 FT /rpt_family="L1" FT repeat_region 7948982..7949278 FT /rpt_family="Alu" FT repeat_region 7949279..7949371 FT /rpt_family="L1" FT repeat_region 7949372..7949683 FT /rpt_family="Alu" FT repeat_region 7949684..7949764 FT /rpt_family="L1" FT repeat_region 7949950..7950142 FT /rpt_family="MIR" FT repeat_region 7950146..7950464 FT /rpt_family="Alu" FT repeat_region 7950488..7950767 FT /rpt_family="L2" FT repeat_region 7950908..7951133 FT /rpt_family="L2" FT repeat_region 7951220..7951276 FT /rpt_family="CT-rich" FT repeat_region 7951472..7951658 FT /rpt_family="L2" FT repeat_region 7952873..7953232 FT /rpt_family="MaLR" FT repeat_region 7953671..7953747 FT /rpt_family="MIR" FT repeat_region 7953808..7953879 FT /rpt_family="(TCCA)n" FT repeat_region 7953935..7954243 FT /rpt_family="Alu" FT repeat_region 7954388..7954510 FT /rpt_family="MIR" FT repeat_region 7954599..7954841 FT /rpt_family="MIR" FT repeat_region 7954858..7954885 FT /rpt_family="(GGA)n" FT repeat_region 7954941..7955252 FT /rpt_family="Alu" FT repeat_region 7955301..7955320 FT /rpt_family="(T)n" FT repeat_region 7955662..7955748 FT /rpt_family="L1" FT repeat_region 7955804..7956092 FT /rpt_family="Alu" FT repeat_region 7956100..7956175 FT /rpt_family="L1" FT repeat_region 7956176..7956488 FT /rpt_family="Alu" FT repeat_region 7956489..7956594 FT /rpt_family="L1" FT repeat_region 7956595..7956897 FT /rpt_family="Alu" FT repeat_region 7956898..7956916 FT /rpt_family="L1" FT repeat_region 7956976..7957287 FT /rpt_family="Alu" FT repeat_region 7957461..7957592 FT /rpt_family="Alu" FT repeat_region 7957593..7957903 FT /rpt_family="Alu" FT repeat_region 7957904..7957976 FT /rpt_family="Alu" FT repeat_region 7957977..7958066 FT /rpt_family="ERVL" FT repeat_region 7958219..7958590 FT /rpt_family="L2" FT repeat_region 7958611..7959101 FT /rpt_family="ERV1" FT repeat_region 7959133..7959326 FT /rpt_family="L2" FT repeat_region 7959426..7959542 FT /rpt_family="ERV1" FT repeat_region 7959543..7959833 FT /rpt_family="Alu" FT repeat_region 7959834..7960093 FT /rpt_family="ERV1" FT repeat_region 7960134..7960201 FT /rpt_family="ERV1" FT repeat_region 7960270..7960317 FT /rpt_family="ERV1" FT repeat_region 7960318..7960637 FT /rpt_family="Alu" FT repeat_region 7960638..7960829 FT /rpt_family="ERV1" FT repeat_region 7961333..7961657 FT /rpt_family="Alu" FT repeat_region 7962355..7962515 FT /rpt_family="MIR" FT repeat_region 7962519..7962941 FT /rpt_family="ERVL" FT repeat_region 7963217..7963530 FT /rpt_family="Alu" FT repeat_region 7963679..7963981 FT /rpt_family="Alu" FT repeat_region 7963982..7964286 FT /rpt_family="Alu" FT repeat_region 7964949..7965100 FT /rpt_family="MaLR" FT repeat_region 7965571..7965745 FT /rpt_family="MER1_type" FT repeat_region 7965935..7966244 FT /rpt_family="Alu" FT repeat_region 7966494..7966710 FT /rpt_family="L2" FT repeat_region 7968977..7969088 FT /rpt_family="MIR" FT repeat_region 7969976..7970581 FT /rpt_family="L1" FT repeat_region 7970586..7970879 FT /rpt_family="Alu" FT repeat_region 7970903..7971200 FT /rpt_family="Alu" FT repeat_region 7971458..7971496 FT /rpt_family="(CA)n" FT repeat_region 7973225..7973317 FT /rpt_family="MIR" FT repeat_region 7974055..7974139 FT /rpt_family="L2" FT repeat_region 7974803..7974839 FT /rpt_family="(TG)n" FT repeat_region 7974840..7974955 FT /rpt_family="L2" FT repeat_region 7974956..7975257 FT /rpt_family="Alu" FT repeat_region 7975258..7975359 FT /rpt_family="L2" FT repeat_region 7975536..7975870 FT /rpt_family="ERVL" FT repeat_region 7975901..7976530 FT /rpt_family="(TCCA)n" FT repeat_region 7976534..7976582 FT /rpt_family="ERVL" FT repeat_region 7976664..7976953 FT /rpt_family="Alu" FT repeat_region 7977014..7977154 FT /rpt_family="CR1" FT repeat_region 7977371..7977928 FT /rpt_family="ERV1" FT repeat_region 7977977..7978214 FT /rpt_family="L2" FT repeat_region 7978258..7978376 FT /rpt_family="L2" FT repeat_region 7978381..7978476 FT /rpt_family="ERV1" FT repeat_region 7978479..7978526 FT /rpt_family="(CA)n" FT repeat_region 7978528..7978604 FT /rpt_family="ERV1" FT repeat_region 7978606..7978709 FT /rpt_family="(CA)n" FT repeat_region 7978710..7979087 FT /rpt_family="MaLR" FT repeat_region 7979088..7979164 FT /rpt_family="(CA)n" FT repeat_region 7979236..7979555 FT /rpt_family="Alu" FT repeat_region 7979573..7979836 FT /rpt_family="L1" FT repeat_region 7981162..7981462 FT /rpt_family="ERV1" FT repeat_region 7981494..7981815 FT /rpt_family="MaLR" FT repeat_region 7981816..7982159 FT /rpt_family="ERV1" FT repeat_region 7982160..7982460 FT /rpt_family="Alu" FT repeat_region 7982461..7982665 FT /rpt_family="ERV1" FT repeat_region 7982666..7982967 FT /rpt_family="Alu" FT repeat_region 7982968..7983313 FT /rpt_family="ERV1" FT repeat_region 7983314..7983375 FT /rpt_family="MaLR" FT repeat_region 7983439..7983604 FT /rpt_family="MIR" FT repeat_region 7984429..7984729 FT /rpt_family="Alu" FT repeat_region 7988022..7988094 FT /rpt_family="MIR" FT repeat_region 7988170..7988327 FT /rpt_family="MER1_type" FT repeat_region 7988402..7988697 FT /rpt_family="Alu" FT repeat_region 7988708..7989004 FT /rpt_family="Alu" FT repeat_region 7989031..7989145 FT /rpt_family="Alu" FT repeat_region 7989753..7990049 FT /rpt_family="Alu" FT repeat_region 7990076..7990244 FT /rpt_family="MIR" FT repeat_region 7990378..7990587 FT /rpt_family="MIR" FT repeat_region 7990798..7991105 FT /rpt_family="Alu" FT repeat_region 7991153..7991424 FT /rpt_family="L1" FT repeat_region 7991437..7991490 FT /rpt_family="L1" FT repeat_region 7991644..7991702 FT /rpt_family="L2" FT repeat_region 7991939..7992208 FT /rpt_family="Alu" FT repeat_region 7992225..7992247 FT /rpt_family="(TTTG)n" FT repeat_region 7994950..7994996 FT /rpt_family="MIR" FT repeat_region 7995129..7995424 FT /rpt_family="Alu" FT repeat_region 7995440..7995640 FT /rpt_family="MER1_type" FT repeat_region 7995825..7996501 FT /rpt_family="L1" FT repeat_region 7996497..7996900 FT /rpt_family="L1" FT repeat_region 7997599..7997733 FT /rpt_family="MIR" FT repeat_region 7997852..7998018 FT /rpt_family="MER1_type" FT repeat_region 7998152..7998787 FT /rpt_family="L1" FT repeat_region 7998788..7999096 FT /rpt_family="Alu" FT repeat_region 7999097..7999596 FT /rpt_family="L1" FT repeat_region 7999597..7999912 FT /rpt_family="Alu" FT repeat_region 7999913..8000272 FT /rpt_family="L1" FT repeat_region 8000519..8000673 FT /rpt_family="L1" FT repeat_region 8000710..8000789 FT /rpt_family="MER1_type" FT repeat_region 8000791..8001084 FT /rpt_family="Alu" FT repeat_region 8001091..8001310 FT /rpt_family="MIR" FT repeat_region 8002064..8002220 FT /rpt_family="MIR" FT repeat_region 8002230..8002265 FT /rpt_family="MIR" FT repeat_region 8004700..8004847 FT /rpt_family="L2" FT repeat_region 8004853..8005225 FT /rpt_family="MER2_type" FT repeat_region 8005284..8005591 FT /rpt_family="Alu" FT repeat_region 8006445..8006599 FT /rpt_family="MER1_type" FT repeat_region 8006700..8006789 FT /rpt_family="L2" FT repeat_region 8006927..8007070 FT /rpt_family="L2" FT repeat_region 8007075..8007107 FT /rpt_family="L2" FT repeat_region 8008984..8009065 FT /rpt_family="MIR" FT repeat_region 8010288..8010471 FT /rpt_family="MER1_type" FT repeat_region 8011112..8011422 FT /rpt_family="Alu" FT repeat_region 8011569..8011682 FT /rpt_family="MIR" FT repeat_region 8013187..8013284 FT /rpt_family="MIR" FT repeat_region 8013702..8013962 FT /rpt_family="(TCCA)n" FT repeat_region 8013976..8014400 FT /rpt_family="(TCCA)n" FT repeat_region 8014466..8014550 FT /rpt_family="(TCCA)n" FT repeat_region 8014586..8014648 FT /rpt_family="(TCCA)n" FT repeat_region 8014681..8014794 FT /rpt_family="L2" FT repeat_region 8014883..8014939 FT /rpt_family="MIR" FT repeat_region 8014940..8015250 FT /rpt_family="Alu" FT repeat_region 8015251..8015406 FT /rpt_family="MIR" FT repeat_region 8016177..8016210 FT /rpt_family="(GGGAGA)n" FT repeat_region 8016212..8016243 FT /rpt_family="(TG)n" FT repeat_region 8016317..8016440 FT /rpt_family="L2" FT repeat_region 8016583..8016639 FT /rpt_family="polypyrimidine" FT repeat_region 8016640..8016947 FT /rpt_family="Alu" FT repeat_region 8017587..8017610 FT /rpt_family="AT_rich" FT repeat_region 8017757..8018070 FT /rpt_family="Alu" FT repeat_region 8018304..8018752 FT /rpt_family="ERV1" FT repeat_region 8019008..8019314 FT /rpt_family="Alu" FT repeat_region 8019439..8019734 FT /rpt_family="Alu" FT repeat_region 8020087..8020159 FT /rpt_family="MIR" FT repeat_region 8020648..8020707 FT /rpt_family="MIR" FT repeat_region 8022571..8022883 FT /rpt_family="Alu" FT repeat_region 8024629..8024809 FT /rpt_family="CT-rich" FT repeat_region 8024967..8025634 FT /rpt_family="L1" FT repeat_region 8026455..8026518 FT /rpt_family="MIR" FT repeat_region 8026642..8026954 FT /rpt_family="Alu" FT repeat_region 8027728..8028026 FT /rpt_family="Alu" FT repeat_region 8028395..8028590 FT /rpt_family="MaLR" FT repeat_region 8028746..8028923 FT /rpt_family="MaLR" FT repeat_region 8030109..8030524 FT /rpt_family="(CTCA)n" FT repeat_region 8031302..8031339 FT /rpt_family="(A)n" FT repeat_region 8033279..8033453 FT /rpt_family="MIR" FT repeat_region 8033454..8033753 FT /rpt_family="Alu" FT repeat_region 8033754..8033796 FT /rpt_family="MIR" FT repeat_region 8035980..8036182 FT /rpt_family="(TGGG)n" FT repeat_region 8036218..8036401 FT /rpt_family="(TGGG)n" FT repeat_region 8036427..8036601 FT /rpt_family="(TGGG)n" FT repeat_region 8036633..8036806 FT /rpt_family="(TGGG)n" FT repeat_region 8038301..8038517 FT /rpt_family="MIR" FT repeat_region 8038532..8038618 FT /rpt_family="(CA)n" FT repeat_region 8038620..8038973 FT /rpt_family="MER2_type" FT repeat_region 8038989..8039105 FT /rpt_family="(CA)n" FT repeat_region 8039188..8039368 FT /rpt_family="(CA)n" FT repeat_region 8039832..8040051 FT /rpt_family="MIR" FT repeat_region 8040283..8040358 FT /rpt_family="L2" FT repeat_region 8040644..8040780 FT /rpt_family="L2" FT repeat_region 8041602..8041623 FT /rpt_family="(T)n" FT repeat_region 8041693..8041789 FT /rpt_family="L2" FT repeat_region 8042056..8042366 FT /rpt_family="Alu" FT repeat_region 8043168..8043237 FT /rpt_family="MIR" FT repeat_region 8043348..8043650 FT /rpt_family="Alu" FT repeat_region 8043692..8043726 FT /rpt_family="(CAA)n" FT repeat_region 8043783..8044285 FT /rpt_family="ERV1" FT repeat_region 8044286..8044588 FT /rpt_family="Alu" FT repeat_region 8044596..8044895 FT /rpt_family="Alu" FT repeat_region 8044896..8045071 FT /rpt_family="ERV1" FT repeat_region 8045132..8045461 FT /rpt_family="MaLR" FT repeat_region 8046168..8046342 FT /rpt_family="L1" FT repeat_region 8046364..8046393 FT /rpt_family="(CA)n" FT repeat_region 8046397..8046418 FT /rpt_family="(TC)n" FT repeat_region 8047096..8047403 FT /rpt_family="Alu" FT repeat_region 8048412..8048743 FT /rpt_family="MaLR" FT repeat_region 8049081..8049141 FT /rpt_family="(TCC)n" FT repeat_region 8050171..8050321 FT /rpt_family="MIR" FT repeat_region 8050770..8050996 FT /rpt_family="L2" FT repeat_region 8051117..8051455 FT /rpt_family="ERV1" FT repeat_region 8051456..8051754 FT /rpt_family="Alu" FT repeat_region 8051755..8052013 FT /rpt_family="ERV1" FT repeat_region 8052962..8052993 FT /rpt_family="ERV1" FT repeat_region 8052994..8053319 FT /rpt_family="Alu" FT repeat_region 8053320..8053895 FT /rpt_family="ERV1" FT repeat_region 8054804..8055237 FT /rpt_family="ERV1" FT repeat_region 8055377..8055714 FT /rpt_family="MaLR" FT repeat_region 8056103..8056319 FT /rpt_family="L2" FT repeat_region 8057250..8057373 FT /rpt_family="L2" FT repeat_region 8057518..8057540 FT /rpt_family="AT_rich" FT repeat_region 8057558..8057866 FT /rpt_family="Alu" FT repeat_region 8058021..8058325 FT /rpt_family="Alu" FT repeat_region 8058378..8058684 FT /rpt_family="Alu" FT repeat_region 8058814..8059112 FT /rpt_family="Alu" FT repeat_region 8059192..8059387 FT /rpt_family="L1" FT repeat_region 8060390..8060841 FT /rpt_family="ERV1" FT repeat_region 8060969..8061345 FT /rpt_family="ERV1" FT repeat_region 8061346..8061664 FT /rpt_family="Alu" FT repeat_region 8061665..8061857 FT /rpt_family="ERV1" FT repeat_region 8063115..8063171 FT /rpt_family="G-rich" FT repeat_region 8063782..8064020 FT /rpt_family="L2" FT repeat_region 8064164..8064465 FT /rpt_family="Alu" FT repeat_region 8064800..8065091 FT /rpt_family="Alu" FT repeat_region 8065170..8065354 FT /rpt_family="MIR" FT repeat_region 8065475..8065981 FT /rpt_family="ERV1" FT repeat_region 8065982..8066342 FT /rpt_family="MaLR" FT repeat_region 8066367..8066632 FT /rpt_family="L1" FT repeat_region 8066695..8066978 FT /rpt_family="Alu" FT repeat_region 8066992..8067368 FT /rpt_family="L1" FT repeat_region 8067369..8067670 FT /rpt_family="Alu" FT repeat_region 8067671..8067746 FT /rpt_family="L1" FT repeat_region 8067747..8068045 FT /rpt_family="Alu" FT repeat_region 8068046..8068161 FT /rpt_family="(GGAA)n" FT repeat_region 8068162..8068496 FT /rpt_family="L1" FT repeat_region 8068168..8068650 FT /rpt_family="L1" FT repeat_region 8068665..8068880 FT /rpt_family="MIR" FT repeat_region 8071278..8071433 FT /rpt_family="(TG)n" FT repeat_region 8071508..8071684 FT /rpt_family="(TG)n" FT repeat_region 8071738..8072054 FT /rpt_family="(TG)n" FT repeat_region 8072467..8072558 FT /rpt_family="GA-rich" FT repeat_region 8075450..8075532 FT /rpt_family="L1" FT repeat_region 8075533..8075844 FT /rpt_family="Alu" FT repeat_region 8075845..8075899 FT /rpt_family="L1" FT repeat_region 8075900..8076199 FT /rpt_family="Alu" FT repeat_region 8076200..8076500 FT /rpt_family="L1" FT repeat_region 8076501..8076810 FT /rpt_family="Alu" FT repeat_region 8076811..8077137 FT /rpt_family="L1" FT repeat_region 8077138..8077438 FT /rpt_family="Alu" FT repeat_region 8077439..8077502 FT /rpt_family="L1" FT repeat_region 8078874..8078957 FT /rpt_family="L1" FT repeat_region 8079597..8079698 FT /rpt_family="MIR" FT repeat_region 8080396..8080485 FT /rpt_family="MIR" FT repeat_region 8081287..8081477 FT /rpt_family="L1" FT repeat_region 8081478..8081509 FT /rpt_family="(CGTG)n" FT repeat_region 8081510..8081534 FT /rpt_family="L1" FT repeat_region 8083648..8083791 FT /rpt_family="(TG)n" FT repeat_region 8083948..8084142 FT /rpt_family="MIR" FT repeat_region 8084469..8084489 FT /rpt_family="(TGAA)n" FT repeat_region 8084669..8084859 FT /rpt_family="MER1_type" FT repeat_region 8084932..8085022 FT /rpt_family="MIR" FT repeat_region 8088077..8088371 FT /rpt_family="Alu" FT repeat_region 8090160..8090312 FT /rpt_family="MIR" FT repeat_region 8090420..8090653 FT /rpt_family="MIR" FT repeat_region 8090720..8090870 FT /rpt_family="MER1_type" FT repeat_region 8091180..8091482 FT /rpt_family="Alu" FT repeat_region 8091551..8091586 FT /rpt_family="(TGAA)n" FT repeat_region 8092023..8092114 FT /rpt_family="MIR" FT repeat_region 8092237..8092997 FT /rpt_family="L1" FT repeat_region 8092999..8093735 FT /rpt_family="L1" FT repeat_region 8093103..8093736 FT /rpt_family="L1" FT repeat_region 8093737..8094024 FT /rpt_family="Alu" FT repeat_region 8094025..8094049 FT /rpt_family="L1" FT repeat_region 8094050..8094547 FT /rpt_family="ERV1" FT repeat_region 8094548..8094574 FT /rpt_family="L1" FT repeat_region 8094575..8094875 FT /rpt_family="Alu" FT repeat_region 8094876..8094961 FT /rpt_family="L1" FT repeat_region 8095056..8095194 FT /rpt_family="L1" FT repeat_region 8095176..8095327 FT /rpt_family="L1" FT repeat_region 8095331..8096029 FT /rpt_family="L1" FT repeat_region 8096030..8096492 FT /rpt_family="ERV1" FT repeat_region 8096493..8096545 FT /rpt_family="L1" FT repeat_region 8096550..8096610 FT /rpt_family="Mariner" FT repeat_region 8096624..8096659 FT /rpt_family="(TCCC)n" FT repeat_region 8096660..8096805 FT /rpt_family="CT-rich" FT repeat_region 8096806..8096821 FT /rpt_family="L1" FT repeat_region 8096822..8097130 FT /rpt_family="Alu" FT repeat_region 8097131..8097292 FT /rpt_family="L1" FT repeat_region 8097293..8097409 FT /rpt_family="Alu" FT repeat_region 8097410..8098046 FT /rpt_family="L1" FT repeat_region 8098732..8098774 FT /rpt_family="(GGGA)n" FT repeat_region 8099415..8099505 FT /rpt_family="L2" FT repeat_region 8100008..8100189 FT /rpt_family="MER1_type" FT repeat_region 8100348..8100488 FT /rpt_family="MIR" FT repeat_region 8101291..8101601 FT /rpt_family="Alu" FT repeat_region 8101818..8102016 FT /rpt_family="L1" FT repeat_region 8102020..8102190 FT /rpt_family="MIR" FT repeat_region 8102192..8102503 FT /rpt_family="Alu" FT gene complement(8108221..8160538) FT /gene="ABLIM2" FT mRNA complement(join(8108221..8108364,8160407..8160538)) FT /gene="ABLIM2" FT CDS complement(join(<8108221..8108364,8160407..8160416)) FT /codon_start=1 FT /gene="ABLIM2" FT /product="unknown" FT /note="Homo sapiens actin binding LIM protein 2 (ABLIM2), FT mRNA.; H_NH0117J13.1 This gene was based on gi(27477050) FT Continues as H_NH1258F18.1" FT /protein_id="AAY40931.1" FT /translation="MSAVSQPQAAPSPLEKSPSTAILCNTCGNVCKGEVLRVQDKYFHI FT KCFVCK" FT misc_feature 8153941..8154406 FT /note="CpG_island (%GC=62.2, o/e=0.68, #CpGs=34)" FT misc_feature 8159729..8161260 FT /note="CpG_island (%GC=71.9, o/e=0.74, #CpGs=166)" FT gene 8201094..8242830 FT /gene="FLJ20356" FT mRNA join(8201094..8201132,8206894..8207093,8211475..8211549, FT 8214428..8214555,8216202..8216307,8217838..8217984, FT 8218684..8218894,8219998..8220074,8221062..8221257, FT 8224567..8224697,8226902..8226943,8228707..8230371, FT 8233703..8233883,8235090..8235240,8237160..8237282, FT 8238005..8238155,8239201..8239397,8242425..8242830) FT /gene="FLJ20356" FT misc_feature 8202260..8202470 FT /gene="FLJ20356" FT /note="CpG_island (%GC=64.0, o/e=0.79, #CpGs=19)" FT CDS join(8206922..8207093,8211475..8211549,8214428..8214555, FT 8216202..8216307,8217838..8217984,8218684..8218894, FT 8219998..8220074,8221062..8221257,8224567..8224697, FT 8226902..8226943,8228707..8230371,8233703..8233883, FT 8235090..8235240,8237160..8237282,8238005..8238155, FT 8239201..8239397,8242425..8242682) FT /codon_start=1 FT /gene="FLJ20356" FT /product="unknown" FT /note="Homo sapiens SH3 domain and tetratricopeptide FT repeats 1 (SH3TC1), mRNA.; H_NH0117J13.2 This gene was FT based on gi(21361603)" FT /protein_id="AAY40932.1" FT /translation="MENLPAVTTEEPTPMGRGPVGPSGGGSTRDQVRTVVMRPSVSWEK FT AGPEEAKAPVRGDEAPPARVAGPAAGTPPCQMGVYPTDLTLQLLAVRRKSRLRDPGLQQ FT TLRGQLRLLENDSREMARVLGELSARLLSIHSDQDRIVVTFKTFEEIWKFSTYHALGFT FT HHCLANLLMDQAFWLLLPSEEEETAIQVHVDENALRLTHESLLIQEGPFFVLCPDHHVR FT VMTGPRDAGNGPQALRQASGAPQGEAAPETDSSPPSPSVSSEEVAVAAAPEPLIPFHQW FT ALRIPQDPIDDAMGGPVMPGNPLMAVGLASALADFQGSGPEEMTFRGGDLIEILGAQVP FT SLPWCVGRHAASGRVGFVRSSLISMQGPVSELESAIFLNEEEKSFFSEGCFSEEDARQL FT LRRMSGTDVCSVYSLDSVEEAETEQPQEKEIPPPCLSLEPQETLQKVKNVLEQCKTCPG FT CPQEPASWGLCAASSDVSLQDPEEPSFCLEAEDDWEDPEALSSLLLFLNAPGYKASFRG FT LYDVALPWLSSVFRSFSDEEELTGRLAQARGAAKKAGLLMALARLCFLLGRLCSRRLKL FT SQARVYFEEALGALEGSFGDLFLVVAVYANLASIYRKQKNREKCAQVVPKAMALLLGTP FT DHICSTEAEGELLQLALRRAVGGQSLQAEARACFLLARHHVHLKQPEEALPFLERLLLL FT HRDSGAPEAAWLSDCYLLLADIYSRKCLPHLVLSCVKVASLRTRGSLAGSLRSVNLVLQ FT NAPQPHSLPAQTSHYLRQALASLTPGTGQALRGPLYTSLAQLYSHHGCHGPAITFMTQA FT VEASAIAGVRAIVDHLVALAWLHVLHGQSPVALDILQSVRDAVVASEDQEGVIANMVAV FT ALKRTGRTRQAAESYYRALRVARDLGQQRNQAVGLANFGALCLHAGASRLAQHYLLEAV FT RLFSRLPLGECGRDFTHVLLQLGHLCTRQGPAQQGKGYYEWALLVAVEMGHVESQLRAV FT QRLCHFYSAVMPSEAQCVIYHELQLSLACKVADKVLEGQLLETISQLYLSLGTERAYKS FT ALDYTKRSLGIFIDLQKKEKEAHAWLQAGKIYYILRQSELVDLYIQVAQNVALYTGDPN FT LGLELFEAAGDIFFDGAWEREKAVSFYRDRALPLAVTTGNRKAELRLCNKLVALLATLE FT EPQEGLEFAHMALALSITLGDRLNERVAYHRLAALQHRLGHGELAEHFYLKALSLCNSP FT LEFDEETLYYVKVYLVLGDIIFYDLKDPFDAAGYYQLALAAAVDLGNKKAQLKIYTRLA FT TIYHNFLLDREKSLFFYQKARTFATELNVRRVNLPPLPLCGWAPWLAPSHPR" FT repeat_region 8263116..8263480 FT /rpt_family="ERVL" FT repeat_region 8265374..8265484 FT /rpt_family="(CAGAGA)n" FT repeat_region 8265485..8265691 FT /rpt_family="ERV1" FT repeat_region 8265699..8265761 FT /rpt_family="(CAGAGA)n" FT repeat_region 8265833..8265945 FT /rpt_family="L1" FT repeat_region 8266077..8266259 FT /rpt_family="L1" FT repeat_region 8266290..8266359 FT /rpt_family="AT_rich" FT repeat_region 8267785..8267987 FT /rpt_family="MIR" FT repeat_region 8268028..8268080 FT /rpt_family="MIR" FT repeat_region 8268081..8268254 FT /rpt_family="MIR" FT repeat_region 8269222..8269264 FT /rpt_family="MIR" FT repeat_region 8269575..8269644 FT /rpt_family="MIR" FT repeat_region 8270318..8270750 FT /rpt_family="MER1_type" FT repeat_region 8271107..8271187 FT /rpt_family="MIR" FT misc_feature 8271215..8272091 FT /note="CpG_island (%GC=76.7, o/e=0.80, #CpGs=114)" FT repeat_region 8271604..8271625 FT /rpt_family="GC_rich" FT repeat_region 8271640..8271688 FT /rpt_family="GC_rich" FT repeat_region 8272189..8272316 FT /rpt_family="MIR" FT repeat_region 8272991..8273086 FT /rpt_family="MER103" FT repeat_region 8273265..8273611 FT /rpt_family="MaLR" FT repeat_region 8274358..8274574 FT /rpt_family="L2" FT repeat_region 8274789..8274902 FT /rpt_family="MIR" FT repeat_region 8275852..8276202 FT /rpt_family="L2" FT repeat_region 8276280..8276346 FT /rpt_family="CR1" FT repeat_region 8277503..8277631 FT /rpt_family="MIR" FT repeat_region 8277816..8277858 FT /rpt_family="Tip100" FT repeat_region 8277926..8278092 FT /rpt_family="MIR" FT repeat_region 8278577..8278690 FT /rpt_family="MIR" FT repeat_region 8279216..8279494 FT /rpt_family="L2" FT repeat_region 8279704..8279805 FT /rpt_family="Tip100" FT repeat_region 8280460..8280559 FT /rpt_family="MIR" FT repeat_region 8280685..8280750 FT /rpt_family="CT-rich" FT repeat_region 8281636..8281704 FT /rpt_family="L2" FT repeat_region 8282664..8282811 FT /rpt_family="MIR" FT repeat_region 8283153..8283315 FT /rpt_family="MIR" FT repeat_region 8284819..8284957 FT /rpt_family="(TGAA)n" FT repeat_region 8286310..8286381 FT /rpt_family="L2" FT repeat_region 8286467..8286564 FT /rpt_family="MIR" FT repeat_region 8286588..8287017 FT /rpt_family="MaLR" FT repeat_region 8287831..8287989 FT /rpt_family="MIR" FT repeat_region 8288578..8288727 FT /rpt_family="MIR" FT repeat_region 8289050..8289089 FT /rpt_family="MIR" FT repeat_region 8289090..8289471 FT /rpt_family="MaLR" FT repeat_region 8289472..8289625 FT /rpt_family="MIR" FT repeat_region 8290000..8290301 FT /rpt_family="Alu" FT repeat_region 8290302..8290593 FT /rpt_family="Alu" FT repeat_region 8290606..8290673 FT /rpt_family="(TTCC)n" FT repeat_region 8290676..8290976 FT /rpt_family="Alu" FT repeat_region 8290983..8291174 FT /rpt_family="MER1_type" FT repeat_region 8292190..8292360 FT /rpt_family="L1" FT repeat_region 8292565..8292655 FT /rpt_family="MIR" FT repeat_region 8293378..8293470 FT /rpt_family="CR1" FT repeat_region 8294631..8294786 FT /rpt_family="L2" FT unsure 8296282..8296962 FT /note="Unresolved tandem repeat." FT repeat_region 8296310..8296771 FT /rpt_family="(TCCA)n" FT repeat_region 8296783..8296834 FT /rpt_family="CT-rich" FT repeat_region 8296825..8296946 FT /rpt_family="(TCCA)n" FT repeat_region 8299166..8299457 FT /rpt_family="L2" FT repeat_region 8299457..8300008 FT /rpt_family="L2" FT repeat_region 8300009..8301568 FT /rpt_family="L1" FT repeat_region 8301569..8301866 FT /rpt_family="Alu" FT repeat_region 8301867..8302452 FT /rpt_family="L1" FT repeat_region 8302499..8303199 FT /rpt_family="L1" FT repeat_region 8303264..8303634 FT /rpt_family="L1" FT repeat_region 8303702..8303768 FT /rpt_family="MIR" FT repeat_region 8304260..8304446 FT /rpt_family="L2" FT repeat_region 8304455..8304890 FT /rpt_family="MaLR" FT repeat_region 8305020..8305140 FT /rpt_family="L2" FT repeat_region 8305624..8305656 FT /rpt_family="(TCCA)n" FT repeat_region 8306271..8306371 FT /rpt_family="MIR" FT repeat_region 8306372..8306659 FT /rpt_family="Alu" FT repeat_region 8306660..8306696 FT /rpt_family="MIR" FT repeat_region 8306867..8306930 FT /rpt_family="MER2_type" FT repeat_region 8307073..8307247 FT /rpt_family="MIR" FT repeat_region 8309012..8309221 FT /rpt_family="MIR" FT repeat_region 8310249..8310526 FT /rpt_family="Alu" FT repeat_region 8311253..8311380 FT /rpt_family="MIR" FT repeat_region 8311665..8312118 FT /rpt_family="MaLR" FT repeat_region 8312123..8312397 FT /rpt_family="L2" FT repeat_region 8314072..8314737 FT /rpt_family="L1" FT repeat_region 8314756..8315047 FT /rpt_family="L1" FT repeat_region 8315049..8315274 FT /rpt_family="L1" FT repeat_region 8315275..8315570 FT /rpt_family="Alu" FT repeat_region 8315571..8315848 FT /rpt_family="L1" FT repeat_region 8315977..8316141 FT /rpt_family="MIR" FT repeat_region 8316195..8316395 FT /rpt_family="L1" FT repeat_region 8317029..8317127 FT /rpt_family="MIR" FT repeat_region 8317156..8317275 FT /rpt_family="Tip100" FT repeat_region 8318658..8319032 FT /rpt_family="ERVL" FT repeat_region 8319479..8319772 FT /rpt_family="Alu" FT repeat_region 8319982..8320108 FT /rpt_family="MER1_type" FT repeat_region 8320260..8320446 FT /rpt_family="MIR" FT repeat_region 8320447..8320745 FT /rpt_family="Alu" FT repeat_region 8320746..8320817 FT /rpt_family="MIR" FT repeat_region 8321015..8321125 FT /rpt_family="L2" FT repeat_region 8321126..8321360 FT /rpt_family="MIR" FT repeat_region 8321175..8321360 FT /rpt_family="MIR" FT misc_feature 8322004..8322249 FT /note="match to EST BG217250 (NID:g13743271)" FT repeat_region 8322011..8322186 FT /rpt_family="L2" FT misc_feature 8322125..8322249 FT /note="match to EST AI191061 (NID:g3742270) qe25c07.x1" FT repeat_region 8322200..8322332 FT /rpt_family="MIR" FT repeat_region 8322541..8322904 FT /rpt_family="MaLR" FT repeat_region 8322907..8323086 FT /rpt_family="(CAT)n" FT repeat_region 8323129..8323308 FT /rpt_family="(CAT)n" FT repeat_region 8323342..8323400 FT /rpt_family="(CAT)n" FT misc_feature 8323684..8323759 FT /note="match to EST BG217250 (NID:g13743271)" FT repeat_region 8323799..8324097 FT /rpt_family="Alu" FT misc_feature 8323853..8323970 FT /note="match to EST BG217250 (NID:g13743271)" FT repeat_region 8324367..8324465 FT /rpt_family="MIR" FT repeat_region 8324475..8324919 FT /rpt_family="ERVL" FT repeat_region 8325301..8325470 FT /rpt_family="MER1_type" FT misc_feature 8325446..8325692 FT /note="match to EST BG217250 (NID:g13743271)" FT misc_feature 8325446..8325693 FT /note="match to EST AI191061 (NID:g3742270) qe25c07.x1" FT repeat_region 8325599..8325663 FT /rpt_family="MIR" FT repeat_region 8325766..8325965 FT /rpt_family="L1" FT misc_feature 8326050..8326051 FT /note="match to EST AI191061 (NID:g3742270) qe25c07.x1" FT repeat_region 8326528..8326760 FT /rpt_family="MIR" FT misc_feature 8326774..8326778 FT /note="match to EST AV691645 (NID:g10293508)" FT repeat_region 8326878..8326928 FT /rpt_family="L2" FT repeat_region 8327249..8327609 FT /rpt_family="ERVL" FT repeat_region 8327762..8327829 FT /rpt_family="L2" FT repeat_region 8328362..8328462 FT /rpt_family="L1" FT repeat_region 8328494..8328653 FT /rpt_family="L1" FT repeat_region 8328632..8328853 FT /rpt_family="L1" FT repeat_region 8329056..8329357 FT /rpt_family="Alu" FT repeat_region 8329598..8329753 FT /rpt_family="L1" FT repeat_region 8329754..8329961 FT /rpt_family="MER1_type" FT repeat_region 8329962..8330001 FT /rpt_family="L1" FT repeat_region 8330947..8331022 FT /rpt_family="MER1_type?" FT repeat_region 8331244..8331403 FT /rpt_family="MIR" FT repeat_region 8333241..8333376 FT /rpt_family="MaLR" FT repeat_region 8333814..8334170 FT /rpt_family="MaLR" FT repeat_region 8335276..8335394 FT /rpt_family="MIR" FT repeat_region 8335802..8335913 FT /rpt_family="ERV1" FT repeat_region 8335859..8336319 FT /rpt_family="ERV1" FT repeat_region 8336365..8336424 FT /rpt_family="MIR" FT repeat_region 8336926..8337117 FT /rpt_family="MER1_type" FT repeat_region 8337628..8337918 FT /rpt_family="L1" FT repeat_region 8337921..8338005 FT /rpt_family="L1" FT repeat_region 8338006..8338035 FT /rpt_family="(CA)n" FT repeat_region 8338036..8338145 FT /rpt_family="L1" FT repeat_region 8338155..8338660 FT /rpt_family="ERVL" FT repeat_region 8338736..8338891 FT /rpt_family="L1" FT repeat_region 8338896..8339232 FT /rpt_family="MER2_type" FT repeat_region 8339262..8339393 FT /rpt_family="L1" FT repeat_region 8339395..8339698 FT /rpt_family="Alu" FT misc_feature 8339395..8339409 FT /note="match to EST AI992213 (NID:g5839118) ws41a09.x1" FT repeat_region 8339726..8340668 FT /rpt_family="L1" FT repeat_region 8340745..8341815 FT /rpt_family="L1" FT repeat_region 8341816..8342111 FT /rpt_family="Alu" FT repeat_region 8342112..8342296 FT /rpt_family="L1" FT repeat_region 8342984..8343290 FT /rpt_family="Alu" FT repeat_region 8343472..8343514 FT /rpt_family="Alu" FT repeat_region 8343530..8343756 FT /rpt_family="ERVL" FT repeat_region 8343772..8344366 FT /rpt_family="centr" FT repeat_region 8344375..8344457 FT /rpt_family="L2" FT repeat_region 8345805..8345897 FT /rpt_family="MIR" FT repeat_region 8346694..8346764 FT /rpt_family="MIR" FT repeat_region 8347123..8347410 FT /rpt_family="L1" FT repeat_region 8347929..8348030 FT /rpt_family="MIR" FT repeat_region 8348191..8348239 FT /rpt_family="L2" FT repeat_region 8348692..8348715 FT /rpt_family="GC_rich" FT repeat_region 8349085..8349129 FT /rpt_family="(TTAGGG)n" FT repeat_region 8349660..8349747 FT /rpt_family="MIR" FT repeat_region 8350097..8350225 FT /rpt_family="MIR" FT repeat_region 8350230..8350570 FT /rpt_family="Alu" FT repeat_region 8350628..8350906 FT /rpt_family="MaLR" FT repeat_region 8350907..8351200 FT /rpt_family="Alu" FT repeat_region 8351201..8351227 FT /rpt_family="MaLR" FT repeat_region 8351228..8351479 FT /rpt_family="Alu" FT repeat_region 8351480..8351535 FT /rpt_family="MaLR" FT repeat_region 8352437..8352505 FT /rpt_family="(TTCA)n" FT repeat_region 8353337..8353555 FT /rpt_family="MIR" FT repeat_region 8354660..8354996 FT /rpt_family="ERVL" FT repeat_region 8355351..8355430 FT /rpt_family="MaLR" FT repeat_region 8356187..8356333 FT /rpt_family="L1" FT repeat_region 8356334..8356706 FT /rpt_family="MaLR" FT repeat_region 8356707..8356906 FT /rpt_family="L1" FT misc_feature 8356789..8357249 FT /note="match to EST W57990 (NID:g1364702) zd21a05.r1" FT misc_feature 8356817..8357500 FT /note="similar to EST BM672029 (NID:g18981933)" FT misc_feature 8356824..8357219 FT /note="match to EST BF941727 (NID:g12359047)" FT misc_feature 8357037..8357595 FT /note="match to EST AU144393 (NID:g11005914)" FT misc_feature 8357041..8357370 FT /note="match to EST BF432390 (NID:g11444521)" FT misc_feature 8357098 FT /note="match to EST AA317958 (NID:g1970306)" FT misc_feature 8357139..8357785 FT /note="match to EST BE971025 (NID:g10583958)" FT misc_feature 8357324..8358186 FT /note="match to EST BG696052 (NID:g13960794)" FT misc_feature 8357546..8357890 FT /note="similar to Homo sapiens EST AW883502 (NID:g8045618)" FT misc_feature 8357680..8358443 FT /note="match to EST AU117606 (NID:g10932587)" FT repeat_region 8357827..8357941 FT /rpt_family="MIR" FT misc_feature 8357878..8358253 FT /note="match to EST AA317958 (NID:g1970306)" FT misc_feature 8358246..8358734 FT /note="similar to EST BM720113 (NID:g19039144)" FT misc_feature 8358759..8358938 FT /note="similar to Homo sapiens EST BF923625 FT (NID:g12319513)" FT misc_feature 8359033..8359490 FT /note="match to EST AW162768 (NID:g6301801) au88h03.x1" FT repeat_region 8359136..8359268 FT /rpt_family="L1" FT misc_feature 8359253 FT /note="match to EST BE048458 (NID:g8365511) hr49c03.x1" FT misc_feature 8359282..8359722 FT /note="match to EST BE048458 (NID:g8365511) hr49c03.x1" FT misc_feature 8359288..8359769 FT /note="match to EST BF836308 (NID:g12188082)" FT misc_feature 8359368..8359721 FT /note="match to EST AA228717 (NID:g1851378) nc47h12.r1" FT repeat_region 8359570..8360188 FT /rpt_family="ERV1" FT repeat_region 8360189..8360732 FT /rpt_family="ERV1" FT repeat_region 8360819..8361528 FT /rpt_family="ERV1" FT repeat_region 8362200..8362498 FT /rpt_family="Alu" FT repeat_region 8362869..8363182 FT /rpt_family="Alu" FT misc_feature 8363430..8363434 FT /note="similar to Homo sapiens EST AL574843 FT (NID:g12935434)" FT repeat_region 8365307..8365849 FT /rpt_family="ERV1" FT misc_feature 8365610..8365612 FT /note="match to EST AI970847 (NID:g5767673) wr20e10.x1" FT repeat_region 8365850..8366095 FT /rpt_family="ERV1" FT misc_feature 8367069..8367461 FT /note="match to EST AI285872 (NID:g3924105) qh96f02.x1" FT repeat_region 8367234..8367422 FT /rpt_family="MIR" FT misc_feature 8367552 FT /note="match to EST BF058603 (NID:g10812499)" FT misc_feature 8368007..8368347 FT /note="match to EST AA452552 (NID:g2166221) zx35f07.s1" FT misc_feature 8368074..8368563 FT /note="match to EST BE467143 (NID:g9512918) hz62c07.x1" FT misc_feature 8368165..8368807 FT /note="similar to EST BM423424 (NID:g18391636)" FT misc_feature 8368193..8368648 FT /note="match to EST R32133 (NID:g787976) yh72f10.r1" FT misc_feature 8368214..8368801 FT /note="match to EST AI970847 (NID:g5767673) wr20e10.x1" FT misc_feature 8368328..8368807 FT /note="match to EST BF058603 (NID:g10812499)" FT misc_feature 8368331..8368807 FT /note="similar to EST BM682926 (NID:g18992822)" FT misc_feature 8368331..8368332 FT /note="match to EST AI202423 (NID:g3755029) qs71f05.x1" FT misc_feature 8368332..8368807 FT /note="similar to EST BM544518 (NID:g18775846)" FT misc_feature 8368332..8368541 FT /note="match to EST AI682383 (NID:g4892565) wc52e08.x1" FT misc_feature 8368335..8368525 FT /note="match to EST AA007625 (NID:g1463611) zh99f07.s1" FT misc_feature 8368398..8368807 FT /note="match to EST AI992213 (NID:g5839118) ws41a09.x1" FT misc_feature 8368428..8368807 FT /note="match to EST AL562319 (NID:g12910621)" FT misc_feature 8368432..8368807 FT /note="similar to EST BM558522 (NID:g18801338)" FT misc_feature 8368443..8368811 FT /note="match to EST AI202423 (NID:g3755029) qs71f05.x1" FT misc_feature 8368513..8368807 FT /note="match to EST AL562260 (NID:g12910506)" FT misc_feature 8368570..8368756 FT /note="match to EST AV691645 (NID:g10293508)" FT misc_feature 8368621..8368807 FT /note="similar to EST BM707426 (NID:g19020684)" FT misc_feature 8368648..8368807 FT /note="match to EST BF850672 (NID:g12237834)" FT misc_feature 8368653..8368807 FT /note="match to EST AA452737 (NID:g2166406) zx35f07.r1" FT misc_feature 8368655..8368807 FT /note="match to EST AW899513 (NID:g8063718)" FT misc_feature 8368660..8368807 FT /note="match to EST T78298 (NID:g696807) yc99b11.r1" FT misc_feature 8368790..8368807 FT /note="match to EST AA007662 (NID:g1463654) zh99f07.r1" FT repeat_region 8368925..8369240 FT /rpt_family="Alu" FT misc_feature 8369320..8369505 FT /note="match to EST AA527241 (NID:g2269310) ng35f01.s1" FT repeat_region 8369415..8369736 FT /rpt_family="Alu" FT repeat_region 8370458..8370706 FT /rpt_family="Alu" FT repeat_region 8371120..8371186 FT /rpt_family="MIR" FT repeat_region 8371844..8371985 FT /rpt_family="L2" FT misc_feature 8372325..8372763 FT /note="match to EST AW854210 (NID:g7949903)" FT misc_feature 8372325..8373013 FT /note="match to EST AW854062 (NID:g7949755)" FT misc_feature 8372325..8373026 FT /note="match to EST AW854078 (NID:g7949771)" FT misc_feature 8372436..8373054 FT /note="match to EST AW854139 (NID:g7949832)" FT misc_feature 8372635..8372721 FT /note="similar to EST BM423424 (NID:g18391636)" FT /note="similar to EST BM707426 (NID:g19020684)" FT /note="similar to EST BM544518 (NID:g18775846)" FT /note="match to EST T78298 (NID:g696807) yc99b11.r1" FT /note="similar to EST BM558522 (NID:g18801338)" FT /note="match to EST AA007662 (NID:g1463654) zh99f07.r1" FT /note="match to EST AV691645 (NID:g10293508)" FT /note="match to EST AA452737 (NID:g2166406) zx35f07.r1" FT /note="match to EST AL562260 (NID:g12910506)" FT /note="match to EST AL562319 (NID:g12910621)" FT /note="match to EST AI992213 (NID:g5839118) ws41a09.x1" FT /note="match to EST AW899513 (NID:g8063718)" FT misc_feature 8372635..8372723 FT /note="similar to EST BM682926 (NID:g18992822)" FT misc_feature 8372647..8372721 FT /note="match to EST F12169 (NID:g706510)" FT misc_feature 8372648..8372721 FT /note="match to EST BF229146 (NID:g11165774)" FT misc_feature 8373447..8373451 FT /note="match to EST AA452737 (NID:g2166406) zx35f07.r1" FT repeat_region 8373539..8373664 FT /rpt_family="MER1_type" FT repeat_region 8373836..8374124 FT /rpt_family="Alu" FT repeat_region 8374218..8374267 FT /rpt_family="MER1_type" FT repeat_region 8374842..8374909 FT /rpt_family="ERV1" FT misc_feature 8375063..8375355 FT /note="similar to Homo sapiens EST AL574932 FT (NID:g12935609)" FT misc_feature 8375284..8375355 FT /note="match to EST BG421176 (NID:g13327682)" FT misc_feature 8375288..8375357 FT /note="match to EST AW899513 (NID:g8063718)" FT misc_feature 8375288..8375344 FT /note="match to EST AI992213 (NID:g5839118) ws41a09.x1" FT misc_feature 8375288..8375355 FT /note="similar to EST BM558522 (NID:g18801338)" FT /note="similar to EST BM544518 (NID:g18775846)" FT /note="similar to EST BM707426 (NID:g19020684)" FT /note="match to EST BF229146 (NID:g11165774)" FT /note="match to EST AV691645 (NID:g10293508)" FT /note="match to EST AL562260 (NID:g12910506)" FT /note="match to EST AI682383 (NID:g4892565) wc52e08.x1" FT /note="match to EST BF058603 (NID:g10812499)" FT /note="similar to EST BM423424 (NID:g18391636)" FT misc_feature 8375301..8375355 FT /note="similar to Bos taurus EST BI681444 (NID:g15634364)" FT misc_feature 8375325..8375355 FT /note="match to EST BM010643 (NID:g16524997)" FT misc_feature 8375348..8375355 FT /note="match to EST BI855999 (NID:g15996746)" FT misc_feature 8375795..8376239 FT /note="similar to Homo sapiens EST AL574932 FT (NID:g12935609)" FT repeat_region 8376149..8376277 FT /rpt_family="MER1_type" FT repeat_region 8376281..8376360 FT /rpt_family="L2" FT misc_feature 8376699 FT /note="match to EST T65260 (NID:g674305) yc79b10.r1" FT misc_feature 8376705..8376879 FT /note="similar to EST BM544518 (NID:g18775846)" FT /note="match to EST F12169 (NID:g706510)" FT /note="match to EST T78298 (NID:g696807) yc99b11.r1" FT /note="similar to Homo sapiens EST AL574932 FT (NID:g12935609)" FT /note="similar to EST BM423424 (NID:g18391636)" FT /note="similar to EST BM558522 (NID:g18801338)" FT /note="match to EST BI855999 (NID:g15996746)" FT /note="match to EST AA007662 (NID:g1463654) zh99f07.r1" FT /note="match to EST AL562260 (NID:g12910506)" FT /note="match to EST AI682383 (NID:g4892565) wc52e08.x1" FT /note="match to EST BG421176 (NID:g13327682)" FT /note="match to EST BM010643 (NID:g16524997)" FT /note="similar to Bos taurus EST BI681444 (NID:g15634364)" FT /note="match to EST BF229146 (NID:g11165774)" FT /note="match to EST AL562319 (NID:g12910621)" FT /note="similar to EST BM707426 (NID:g19020684)" FT misc_feature 8376705..8376741 FT /note="match to EST AV691645 (NID:g10293508)" FT misc_feature 8376705..8376789 FT /note="match to EST BF058603 (NID:g10812499)" FT misc_feature 8376726..8376879 FT /note="match to EST W42896 (NID:g1327387) zc25c05.r1" FT misc_feature 8376743..8376879 FT /note="match to EST T65260 (NID:g674305) yc79b10.r1" FT misc_feature 8376756..8376879 FT /note="match to EST R54351 (NID:g816253) yg74g09.r1" FT misc_feature 8376795..8376879 FT /note="match to EST BE696074 (NID:g10083234)" FT misc_feature 8376835..8376879 FT /note="match to EST BG419556 (NID:g13326062)" FT repeat_region 8377384..8377926 FT /rpt_family="L1" FT repeat_region 8378066..8378089 FT /rpt_family="AT_rich" FT misc_feature 8379743..8380037 FT /note="match to EST BF368783 (NID:g11330808)" FT repeat_region 8379973..8380062 FT /rpt_family="MIR" FT repeat_region 8381516..8381665 FT /rpt_family="Alu" FT repeat_region 8381913..8382215 FT /rpt_family="Alu" FT repeat_region 8383018..8383153 FT /rpt_family="MIR" FT misc_feature 8383217..8383334 FT /note="match to EST AA207238 (NID:g1802731) zq73h03.r1" FT misc_feature 8383219..8383427 FT /note="similar to EST BM544518 (NID:g18775846)" FT misc_feature 8383219..8383267 FT /note="similar to EST BM707426 (NID:g19020684)" FT misc_feature 8383219..8383257 FT /note="match to EST BF229146 (NID:g11165774)" FT misc_feature 8383219..8383253 FT /note="match to EST F12169 (NID:g706510)" FT /note="match to EST T78298 (NID:g696807) yc99b11.r1" FT misc_feature 8383219..8383228 FT /note="match to EST T65260 (NID:g674305) yc79b10.r1" FT misc_feature 8383219..8383693 FT /note="match to EST BE696074 (NID:g10083234)" FT misc_feature 8383219..8383285 FT /note="similar to Homo sapiens EST AL574932 FT (NID:g12935609)" FT misc_feature 8383219..8383334 FT /note="match to EST BG419556 (NID:g13326062)" FT /note="match to EST BG421176 (NID:g13327682)" FT /note="match to EST BM010643 (NID:g16524997)" FT /note="match to EST BI855999 (NID:g15996746)" FT /note="match to EST R54351 (NID:g816253) yg74g09.r1" FT /note="similar to EST BM558522 (NID:g18801338)" FT /note="match to EST AA007662 (NID:g1463654) zh99f07.r1" FT /note="match to EST W42896 (NID:g1327387) zc25c05.r1" FT /note="similar to Bos taurus EST BI681444 (NID:g15634364)" FT /note="match to EST AL562260 (NID:g12910506)" FT /note="match to EST AL562319 (NID:g12910621)" FT misc_feature 8383219..8383311 FT /note="match to EST AI682383 (NID:g4892565) wc52e08.x1" FT misc_feature 8383225..8383334 FT /note="match to EST AW246259 (NID:g6589252)" FT misc_feature 8383287..8383293 FT /note="similar to Homo sapiens EST AL574932 FT (NID:g12935609)" FT repeat_region 8383411..8383579 FT /rpt_family="MIR" FT repeat_region 8384439..8384743 FT /rpt_family="Alu" FT repeat_region 8385054..8385256 FT /rpt_family="MaLR" FT misc_feature 8385409..8385746 FT /note="similar to Homo sapiens EST BG988976 FT (NID:g14393046)" FT repeat_region 8386813..8386878 FT /rpt_family="MIR" FT repeat_region 8386944..8387122 FT /rpt_family="(CACCT)n" FT misc_feature 8387110..8387280 FT /note="match to EST BF746661 (NID:g12073337)" FT misc_feature 8387324..8387805 FT /note="match to EST AI821192 (NID:g5440271) ac84e12.y5" FT misc_feature 8387762..8388078 FT /note="match to EST BF913670 (NID:g12305128)" FT misc_feature 8387773..8388295 FT /note="match to EST AI732179 (NID:g5053292) ac84e12.x5" FT repeat_region 8388012..8388313 FT /rpt_family="Alu" FT repeat_region 8388887..8389087 FT /rpt_family="MIR" FT repeat_region 8390016..8390125 FT /rpt_family="L2" FT misc_feature 8390900..8390942 FT /note="match to EST BG421176 (NID:g13327682)" FT misc_feature 8390900..8391061 FT /note="similar to Bos taurus EST BI681444 (NID:g15634364)" FT misc_feature 8390900..8391013 FT /note="match to EST BM010643 (NID:g16524997)" FT /note="match to EST BG419556 (NID:g13326062)" FT /note="match to EST AA207238 (NID:g1802731) zq73h03.r1" FT /note="match to EST BI855999 (NID:g15996746)" FT /note="match to EST R54351 (NID:g816253) yg74g09.r1" FT /note="match to EST AW246259 (NID:g6589252)" FT /note="similar to EST BM558522 (NID:g18801338)" FT /note="match to EST AA007662 (NID:g1463654) zh99f07.r1" FT /note="match to EST AL562260 (NID:g12910506)" FT /note="match to EST AL562319 (NID:g12910621)" FT misc_feature 8390900..8391007 FT /note="match to EST W42896 (NID:g1327387) zc25c05.r1" FT misc_feature 8390921..8391034 FT /note="similar to Mus musculus EST BF785818 FT (NID:g12090854)" FT misc_feature 8391318..8391461 FT /note="match to EST BG421176 (NID:g13327682)" FT misc_feature 8391332..8391461 FT /note="similar to Sus scrofa EST BI182361 (NID:g14656770)" FT misc_feature 8391336..8391461 FT /note="similar to Sus scrofa EST BI182400 (NID:g14656809)" FT misc_feature 8391339..8391461 FT /note="match to EST AW246259 (NID:g6589252)" FT /note="match to EST BI855999 (NID:g15996746)" FT /note="match to EST R54351 (NID:g816253) yg74g09.r1" FT /note="match to EST BM010643 (NID:g16524997)" FT /note="match to EST AA207238 (NID:g1802731) zq73h03.r1" FT /note="match to EST BG419556 (NID:g13326062)" FT misc_feature 8391339..8391366 FT /note="match to EST AA007662 (NID:g1463654) zh99f07.r1" FT misc_feature 8391339..8391429 FT /note="match to EST AL562260 (NID:g12910506)" FT misc_feature 8391339..8391404 FT /note="match to EST AL562319 (NID:g12910621)" FT misc_feature 8391339..8391419 FT /note="similar to EST BM558522 (NID:g18801338)" FT misc_feature 8391349..8391461 FT /note="similar to Bos taurus EST BE845860 (NID:g10282684)" FT /note="match to EST BG674467 (NID:g13905863)" FT misc_feature 8391363..8391461 FT /note="similar to Mus musculus EST BF785818 FT (NID:g12090854)" FT misc_feature 8391523 FT /note="match to EST R54351 (NID:g816253) yg74g09.r1" FT repeat_region 8391550..8391851 FT /rpt_family="Alu" FT repeat_region 8391853..8392081 FT /rpt_family="Alu" FT repeat_region 8392726..8392802 FT /rpt_family="(TATATG)n" FT repeat_region 8393322..8393555 FT /rpt_family="MIR" FT misc_feature 8393541..8393545 FT /note="similar to Homo sapiens EST BG988976 FT (NID:g14393046)" FT repeat_region 8393765..8393998 FT /rpt_family="MER1_type" FT misc_feature 8394060..8394189 FT /note="match to EST BG421176 (NID:g13327682)" FT misc_feature 8394060..8394154 FT /note="match to EST BM010643 (NID:g16524997)" FT misc_feature 8394060..8394166 FT /note="match to EST AA207238 (NID:g1802731) zq73h03.r1" FT misc_feature 8394060..8394105 FT /note="match to EST BI855999 (NID:g15996746)" FT misc_feature 8394060..8394087 FT /note="match to EST AW246259 (NID:g6589252)" FT misc_feature 8394060..8394180 FT /note="match to EST BG674467 (NID:g13905863)" FT /note="similar to Mus musculus EST BF785818 FT (NID:g12090854)" FT /note="match to EST BG419556 (NID:g13326062)" FT /note="similar to Bos taurus EST BE845860 (NID:g10282684)" FT /note="similar to Sus scrofa EST BI182361 (NID:g14656770)" FT /note="similar to Sus scrofa EST BI182400 (NID:g14656809)" FT misc_feature 8394072..8394180 FT /note="match to EST AW885495 (NID:g8047507)" FT misc_feature 8394162..8394180 FT /note="match to EST AW402036 (NID:g6920722)" FT misc_feature 8394266 FT /note="match to EST AW246259 (NID:g6589252)" FT repeat_region 8394359..8394577 FT /rpt_family="L1" FT repeat_region 8394742..8394853 FT /rpt_family="5S" FT repeat_region 8394931..8395244 FT /rpt_family="Alu" FT repeat_region 8395332..8395390 FT /rpt_family="(CA)n" FT misc_feature 8395777..8396067 FT /note="match to EST BG223391 (NID:g12708912)" FT misc_feature 8396347..8396453 FT /note="match to EST AW885495 (NID:g8047507)" FT misc_feature 8396347..8396469 FT /note="match to EST BG674467 (NID:g13905863)" FT /note="match to EST AW402036 (NID:g6920722)" FT /note="similar to Mus musculus EST BF785818 FT (NID:g12090854)" FT /note="match to EST BG419556 (NID:g13326062)" FT /note="similar to Bos taurus EST BE845860 (NID:g10282684)" FT /note="similar to Sus scrofa EST BI182361 (NID:g14656770)" FT /note="similar to Sus scrofa EST BI182400 (NID:g14656809)" FT misc_feature 8396379..8396382 FT /note="match to EST W42896 (NID:g1327387) zc25c05.r1" FT misc_feature 8396410 FT /note="match to EST BE928937 (NID:g10455013)" FT misc_feature 8396420..8396469 FT /note="match to EST BE928937 (NID:g10455013)" FT repeat_region 8396979..8397155 FT /rpt_family="(TGGG)n" FT repeat_region 8397256..8397447 FT /rpt_family="MIR" FT repeat_region 8398122..8398430 FT /rpt_family="Alu" FT misc_feature 8398658..8398846 FT /note="match to EST BF369669 (NID:g11331694)" FT misc_feature 8398664..8398781 FT /note="match to EST BG419556 (NID:g13326062)" FT misc_feature 8398664..8398752 FT /note="similar to Bos taurus EST BE845860 (NID:g10282684)" FT misc_feature 8398664..8398853 FT /note="match to EST BE928937 (NID:g10455013)" FT misc_feature 8398664..8398846 FT /note="match to EST BG674467 (NID:g13905863)" FT /note="match to EST AW402036 (NID:g6920722)" FT /note="similar to Mus musculus EST BF785818 FT (NID:g12090854)" FT /note="similar to Sus scrofa EST BI182361 (NID:g14656770)" FT /note="similar to Sus scrofa EST BI182400 (NID:g14656809)" FT misc_feature 8398707..8398846 FT /note="match to EST AL523772 (NID:g12787265)" FT misc_feature 8398774..8398846 FT /note="match to EST BF724168 (NID:g12040077) bx01g02.y2" FT misc_feature 8398777..8398846 FT /note="match to EST AL524179 (NID:g12787672)" FT misc_feature 8398807..8398846 FT /note="match to EST BI056470 (NID:g14464000)" FT repeat_region 8399606..8399898 FT /rpt_family="Alu" FT repeat_region 8399901..8400204 FT /rpt_family="L1" FT repeat_region 8400205..8400502 FT /rpt_family="Alu" FT repeat_region 8400503..8400529 FT /rpt_family="L1" FT misc_feature 8400663..8401115 FT /note="match to EST BF330249 (NID:g11300997)" FT misc_feature 8401283..8401363 FT /note="similar to Mus musculus EST BF785818 FT (NID:g12090854)" FT misc_feature 8401283..8401379 FT /note="match to EST AL524179 (NID:g12787672)" FT /note="similar to Homo sapiens EST AL574843 FT (NID:g12935434)" FT /note="match to EST AL523772 (NID:g12787265)" FT /note="match to EST BF724168 (NID:g12040077) bx01g02.y2" FT /note="match to EST BG674467 (NID:g13905863)" FT /note="match to EST AW402036 (NID:g6920722)" FT /note="match to EST BI056470 (NID:g14464000)" FT /note="match to EST BF369669 (NID:g11331694)" FT /note="similar to Sus scrofa EST BI182361 (NID:g14656770)" FT /note="similar to Sus scrofa EST BI182400 (NID:g14656809)" FT repeat_region 8401546..8401675 FT /rpt_family="Alu" FT repeat_region 8401692..8402012 FT /rpt_family="Alu" FT repeat_region 8402486..8403011 FT /rpt_family="MER1_type" FT misc_feature 8404817..8405033 FT /note="similar to Homo sapiens EST BF856470 FT (NID:g12244227)" FT misc_feature 8405297..8405601 FT /note="match to EST BF997780 (NID:g12404103)" FT misc_feature 8406178..8406716 FT /note="match to EST AI874267 (NID:g5548316) tz63g06.x1" FT misc_feature 8406796..8407017 FT /note="match to EST AW438558 (NID:g6973864) xu36g10.x1" FT misc_feature 8407366..8407640 FT /note="match to EST AA283974 (NID:g1928317) zs48e11.r1" FT misc_feature 8407682..8407768 FT /note="match to EST AW402036 (NID:g6920722)" FT misc_feature 8407682..8407773 FT /note="match to EST BI056470 (NID:g14464000)" FT misc_feature 8407682..8407770 FT /note="match to EST AL524179 (NID:g12787672)" FT /note="similar to Homo sapiens EST AL574843 FT (NID:g12935434)" FT /note="match to EST AL523772 (NID:g12787265)" FT /note="match to EST BF724168 (NID:g12040077) bx01g02.y2" FT /note="match to EST BG674467 (NID:g13905863)" FT /note="match to EST BF369669 (NID:g11331694)" FT /note="similar to Sus scrofa EST BI182361 (NID:g14656770)" FT misc_feature 8407682..8407776 FT /note="similar to Sus scrofa EST BI182400 (NID:g14656809)" FT misc_feature 8407708..8407770 FT /note="similar to EST BM456773 (NID:g18505813)" FT misc_feature 8407737..8407770 FT /note="match to EST BI916811 (NID:g16180765)" FT repeat_region 8407880..8408128 FT /rpt_family="MaLR" FT repeat_region 8408129..8409127 FT /rpt_family="ERVK" FT repeat_region 8409128..8409321 FT /rpt_family="MaLR" FT repeat_region 8409598..8409692 FT /rpt_family="MER1_type" FT repeat_region 8409987..8410016 FT /rpt_family="(A)n" FT repeat_region 8410372..8410537 FT /rpt_family="ERV1" FT repeat_region 8410533..8410816 FT /rpt_family="ERV1" FT repeat_region 8410886..8410957 FT /rpt_family="L1" FT misc_feature 8411233..8411392 FT /note="similar to Homo sapiens EST BF990511 FT (NID:g12396836)" FT misc_feature 8411631..8412011 FT /note="similar to Homo sapiens EST BF926305 FT (NID:g12323443)" FT repeat_region 8411771..8411925 FT /rpt_family="MER1_type" FT misc_feature 8411939..8412043 FT /note="match to EST BG674467 (NID:g13905863)" FT misc_feature 8411939..8412082 FT /note="match to EST BI916811 (NID:g16180765)" FT /note="match to EST AL524179 (NID:g12787672)" FT /note="similar to EST BM456773 (NID:g18505813)" FT /note="similar to Homo sapiens EST AL574843 FT (NID:g12935434)" FT /note="match to EST AL523772 (NID:g12787265)" FT /note="match to EST BF724168 (NID:g12040077) bx01g02.y2" FT /note="match to EST BF369669 (NID:g11331694)" FT misc_feature 8411939..8412048 FT /note="similar to Sus scrofa EST BI182361 (NID:g14656770)" FT misc_feature 8411944..8412082 FT /note="match to EST BE888898 (NID:g10345662)" FT misc_feature 8411945..8411989 FT /note="match to EST BI056470 (NID:g14464000)" FT misc_feature 8411997..8412082 FT /note="match to EST AU141142 (NID:g11002663)" FT misc_feature 8413069..8413473 FT /note="similar to Homo sapiens EST BF356090 FT (NID:g11315164)" FT repeat_region 8413485..8413628 FT /rpt_family="L2" FT misc_feature 8413613..8413614 FT /note="match to EST BG674467 (NID:g13905863)" FT repeat_region 8414123..8414297 FT /rpt_family="(TGGA)n" FT misc_feature 8416019..8416108 FT /note="match to EST AL524179 (NID:g12787672)" FT /note="match to EST AU141142 (NID:g11002663)" FT /note="match to EST BE888898 (NID:g10345662)" FT /note="similar to Homo sapiens EST AL574843 FT (NID:g12935434)" FT /note="match to EST AL523772 (NID:g12787265)" FT /note="match to EST BI916811 (NID:g16180765)" FT /note="similar to EST BM456773 (NID:g18505813)" FT misc_feature 8416019..8416102 FT /note="match to EST BF724168 (NID:g12040077) bx01g02.y2" FT misc_feature 8416019..8416067 FT /note="match to EST BF369669 (NID:g11331694)" FT misc_feature 8416069..8416108 FT /note="match to EST BF850672 (NID:g12237834)" FT misc_feature 8416581..8416655 FT /note="match to EST AL523772 (NID:g12787265)" FT /note="match to EST BI916811 (NID:g16180765)" FT /note="match to EST BE888898 (NID:g10345662)" FT /note="match to EST AL524179 (NID:g12787672)" FT /note="match to EST AU141142 (NID:g11002663)" FT /note="match to EST BI553257 (NID:g15440569)" FT /note="similar to EST BM456773 (NID:g18505813)" FT /note="similar to Homo sapiens EST AL574843 FT (NID:g12935434)" FT /note="match to EST BF850672 (NID:g12237834)" FT misc_feature 8416635..8416655 FT /note="match to EST BM149479 (NID:g17171124)" FT repeat_region 8417129..8417157 FT /rpt_family="AT_rich" FT repeat_region 8417330..8417373 FT /rpt_family="AT_rich" FT misc_feature 8417493..8417564 FT /note="similar to Homo sapiens EST AL574843 FT (NID:g12935434)" FT misc_feature 8417493..8417726 FT /note="match to EST BI916811 (NID:g16180765)" FT /note="match to EST BE888898 (NID:g10345662)" FT /note="match to EST AL524179 (NID:g12787672)" FT /note="match to EST AU141142 (NID:g11002663)" FT /note="match to EST BI553257 (NID:g15440569)" FT /note="match to EST BM149479 (NID:g17171124)" FT /note="similar to EST BM456773 (NID:g18505813)" FT /note="match to EST AL523772 (NID:g12787265)" FT misc_feature 8417493..8417650 FT /note="match to EST BF850672 (NID:g12237834)" FT misc_feature 8417591..8417951 FT /note="match to EST AW298740 (NID:g6705376)" FT misc_feature 8417623..8417726 FT /note="similar to Homo sapiens EST AL574843 FT (NID:g12935434)" FT misc_feature 8417716..8417726 FT /note="match to EST AU099693 (NID:g13550822)" FT misc_feature 8418093..8418094 FT /note="match to EST AW298740 (NID:g6705376)" FT misc_feature 8418105..8418280 FT /note="match to EST BE888898 (NID:g10345662)" FT misc_feature 8418105..8418144 FT /note="similar to Homo sapiens EST AL574843 FT (NID:g12935434)" FT misc_feature 8418105..8418262 FT /note="match to EST BI916811 (NID:g16180765)" FT /note="match to EST AL524179 (NID:g12787672)" FT /note="match to EST AU141142 (NID:g11002663)" FT /note="match to EST BI553257 (NID:g15440569)" FT /note="match to EST AU099693 (NID:g13550822)" FT /note="match to EST BM149479 (NID:g17171124)" FT /note="similar to EST BM456773 (NID:g18505813)" FT /note="match to EST AL523772 (NID:g12787265)" FT misc_feature 8418219..8418267 FT /note="similar to Homo sapiens EST AL574843 FT (NID:g12935434)" FT repeat_region 8419159..8419336 FT /rpt_family="MIR" FT repeat_region 8419343..8420036 FT /rpt_family="L1" FT repeat_region 8420040..8420206 FT /rpt_family="Alu" FT repeat_region 8420208..8420313 FT /rpt_family="L1" FT repeat_region 8420314..8420616 FT /rpt_family="Alu" FT repeat_region 8420617..8420744 FT /rpt_family="L1" FT repeat_region 8420745..8420869 FT /rpt_family="Alu" FT repeat_region 8420870..8420880 FT /rpt_family="L1" FT repeat_region 8420881..8421190 FT /rpt_family="Alu" FT repeat_region 8421191..8421388 FT /rpt_family="L1" FT repeat_region 8421713..8421903 FT /rpt_family="MIR" FT repeat_region 8421960..8422050 FT /rpt_family="MIR" FT repeat_region 8422092..8422854 FT /rpt_family="ERV1" FT repeat_region 8422872..8423570 FT /rpt_family="ERV1" FT misc_feature 8423513..8423533 FT /note="similar to Homo sapiens EST T06091 (NID:g317240)" FT misc_feature 8423658..8423842 FT /note="similar to Homo sapiens EST T06091 (NID:g317240)" FT repeat_region 8423842..8424121 FT /rpt_family="ERV1" FT repeat_region 8424128..8424261 FT /rpt_family="ERV1" FT misc_feature 8428284..8428289 FT /note="match to EST BG419556 (NID:g13326062)" FT repeat_region 8428429..8428467 FT /rpt_family="ERV1" FT repeat_region 8428458..8428748 FT /rpt_family="ERV1" FT repeat_region 8428749..8429492 FT /rpt_family="ERV1" FT misc_feature 8430078..8430213 FT /note="match to EST AU141142 (NID:g11002663)" FT misc_feature 8430078..8430204 FT /note="match to EST BI553257 (NID:g15440569)" FT misc_feature 8430078..8430175 FT /note="match to EST AU099693 (NID:g13550822)" FT misc_feature 8430078..8430159 FT /note="match to EST BM149479 (NID:g17171124)" FT misc_feature 8430078..8430156 FT /note="similar to EST BM456773 (NID:g18505813)" FT repeat_region 8430446..8430505 FT /rpt_family="MER1_type" FT repeat_region 8430528..8430629 FT /rpt_family="Alu" FT repeat_region 8430667..8430876 FT /rpt_family="ERVL" FT repeat_region 8430908..8431465 FT /rpt_family="ERV1" FT repeat_region 8431541..8431658 FT /rpt_family="Alu" FT repeat_region 8431723..8431803 FT /rpt_family="L2" FT misc_feature 8432214..8433169 FT /note="similar to EST BM456449 (NID:g18505489)" FT misc_feature 8432215..8432217 FT /note="match to EST BM149479 (NID:g17171124)" FT repeat_region 8432301..8432601 FT /rpt_family="Alu" FT repeat_region 8433213..8433347 FT /rpt_family="L2" FT repeat_region 8433968..8434259 FT /rpt_family="Alu" FT repeat_region 8434262..8434282 FT /rpt_family="AT_rich" FT repeat_region 8434564..8434776 FT /rpt_family="MER1_type" FT repeat_region 8434976..8435275 FT /rpt_family="MaLR" FT misc_feature 8435108..8435112 FT /note="match to EST BE696074 (NID:g10083234)" FT repeat_region 8435620..8435775 FT /rpt_family="ERV1" FT repeat_region 8435776..8435798 FT /rpt_family="(TAA)n" FT repeat_region 8435799..8436108 FT /rpt_family="ERV1" FT repeat_region 8436109..8436936 FT /rpt_family="ERV1" FT repeat_region 8436937..8437246 FT /rpt_family="Alu" FT repeat_region 8437247..8438237 FT /rpt_family="ERV1" FT repeat_region 8438238..8438437 FT /rpt_family="ERV1" FT repeat_region 8438439..8438734 FT /rpt_family="Alu" FT misc_feature 8438645..8438648 FT /note="match to EST BE781475 (NID:g10202673)" FT repeat_region 8438740..8438877 FT /rpt_family="(TA)n" FT repeat_region 8438878..8439007 FT /rpt_family="ERV1" FT repeat_region 8439254..8439650 FT /rpt_family="ERV1" FT repeat_region 8439631..8439775 FT /rpt_family="ERV1" FT repeat_region 8439766..8440993 FT /rpt_family="ERV1" FT repeat_region 8440972..8441476 FT /rpt_family="ERV1" FT repeat_region 8441457..8441569 FT /rpt_family="ERV1" FT repeat_region 8441571..8442053 FT /rpt_family="ERV1" FT misc_feature 8442375..8442448 FT /note="match to EST BI916811 (NID:g16180765)" FT misc_feature 8442375..8442416 FT /note="match to EST AL524179 (NID:g12787672)" FT misc_feature 8442375..8442394 FT /note="match to EST AL523772 (NID:g12787265)" FT misc_feature 8442388..8442418 FT /note="match to EST BE888898 (NID:g10345662)" FT misc_feature 8442693..8443168 FT /note="match to EST BE781475 (NID:g10202673)" FT misc_feature 8442884..8443168 FT /note="match to EST BG106949 (NID:g12600795)" FT misc_feature 8442988..8443168 FT /note="match to EST BG751175 (NID:g14061828)" FT repeat_region 8443456..8444009 FT /rpt_family="ERVK" FT repeat_region 8444184..8444779 FT /rpt_family="MaLR" FT repeat_region 8445164..8445390 FT /rpt_family="MIR" FT repeat_region 8445480..8445703 FT /rpt_family="Alu" FT repeat_region 8445739..8445866 FT /rpt_family="MIR" FT repeat_region 8445907..8446128 FT /rpt_family="L1" FT repeat_region 8446129..8446424 FT /rpt_family="Alu" FT repeat_region 8446425..8446610 FT /rpt_family="L1" FT repeat_region 8446668..8446830 FT /rpt_family="MER1_type" FT repeat_region 8446883..8447016 FT /rpt_family="Alu" FT repeat_region 8447088..8447384 FT /rpt_family="L2" FT repeat_region 8447967..8448091 FT /rpt_family="L2" FT misc_feature 8448200..8448317 FT /note="similar to EST BM546004 (NID:g18778606)" FT misc_feature 8448203..8448317 FT /note="match to EST BG751175 (NID:g14061828)" FT /note="match to EST BG106949 (NID:g12600795)" FT repeat_region 8448607..8448632 FT /rpt_family="(TTA)n" FT repeat_region 8448648..8448902 FT /rpt_family="Alu" FT repeat_region 8449260..8449334 FT /rpt_family="MIR" FT repeat_region 8450803..8450942 FT /rpt_family="L2" FT misc_feature 8451396..8451615 FT /note="match to EST BG751175 (NID:g14061828)" FT /note="match to EST BG106949 (NID:g12600795)" FT misc_feature 8451425..8451615 FT /note="similar to EST BM546004 (NID:g18778606)" FT misc_feature 8451425..8451604 FT /note="match to EST BE781475 (NID:g10202673)" FT misc_feature 8451502..8451615 FT /note="match to EST BG105749 (NID:g12599595)" FT repeat_region 8451672..8451962 FT /rpt_family="Alu" FT repeat_region 8452346..8452378 FT /rpt_family="ERVK" FT repeat_region 8452520..8452792 FT /rpt_family="Alu" FT repeat_region 8452809..8452939 FT /rpt_family="MaLR" FT repeat_region 8454179..8454484 FT /rpt_family="Alu" FT repeat_region 8455082..8455212 FT /rpt_family="Alu" FT repeat_region 8456894..8456954 FT /rpt_family="L2" FT repeat_region 8457011..8457075 FT /rpt_family="L2" FT repeat_region 8457301..8457489 FT /rpt_family="L1" FT repeat_region 8457513..8458624 FT /rpt_family="MER2_type" FT repeat_region 8458632..8458783 FT /rpt_family="Alu" FT repeat_region 8458789..8460178 FT /rpt_family="MER2_type" FT repeat_region 8460179..8460481 FT /rpt_family="Alu" FT repeat_region 8460482..8460643 FT /rpt_family="MER2_type" FT repeat_region 8460644..8460934 FT /rpt_family="Alu" FT repeat_region 8460935..8461008 FT /rpt_family="MER2_type" FT repeat_region 8461015..8461183 FT /rpt_family="MIR" FT repeat_region 8461459..8461624 FT /rpt_family="L2" FT repeat_region 8462070..8462229 FT /rpt_family="L1" FT repeat_region 8462292..8462577 FT /rpt_family="Alu" FT repeat_region 8462582..8462874 FT /rpt_family="Alu" FT repeat_region 8463856..8464150 FT /rpt_family="Alu" FT repeat_region 8464152..8464464 FT /rpt_family="Alu" FT repeat_region 8465348..8465409 FT /rpt_family="L1" FT repeat_region 8465864..8465946 FT /rpt_family="MER1_type" FT repeat_region 8465945..8466086 FT /rpt_family="MER1_type" FT repeat_region 8466597..8466953 FT /rpt_family="L1" FT repeat_region 8468420..8468530 FT /rpt_family="MIR" FT repeat_region 8469200..8469499 FT /rpt_family="Alu" FT repeat_region 8473527..8473578 FT /rpt_family="L2" FT repeat_region 8473751..8473833 FT /rpt_family="L1" FT repeat_region 8473907..8474045 FT /rpt_family="L2" FT repeat_region 8477153..8477287 FT /rpt_family="L2" FT repeat_region 8478464..8478767 FT /rpt_family="Alu" FT repeat_region 8481045..8481595 FT /rpt_family="MER2_type" FT repeat_region 8481596..8481810 FT /rpt_family="Alu" FT repeat_region 8481816..8482438 FT /rpt_family="ERV1" FT repeat_region 8482439..8483225 FT /rpt_family="ERV1" FT repeat_region 8483226..8483307 FT /rpt_family="ERV1" FT repeat_region 8483314..8483351 FT /rpt_family="Alu" FT repeat_region 8483354..8484099 FT /rpt_family="MER2_type" FT repeat_region 8484126..8484569 FT /rpt_family="ERV1" FT repeat_region 8484570..8484945 FT /rpt_family="ERV1" FT repeat_region 8484944..8485147 FT /rpt_family="ERV1" FT repeat_region 8485167..8485824 FT /rpt_family="ERV1" FT repeat_region 8489989..8490436 FT /rpt_family="ERV1" FT repeat_region 8490437..8491038 FT /rpt_family="MER2_type" FT repeat_region 8491039..8491176 FT /rpt_family="ERV1" FT repeat_region 8491177..8491504 FT /rpt_family="Alu" FT repeat_region 8491505..8491977 FT /rpt_family="ERV1" FT repeat_region 8493701..8493813 FT /rpt_family="ERV1" FT repeat_region 8493814..8494100 FT /rpt_family="MER2_type" FT repeat_region 8494101..8494252 FT /rpt_family="ERV1" FT repeat_region 8494253..8494779 FT /rpt_family="ERV1" FT repeat_region 8494780..8495344 FT /rpt_family="ERV1" FT repeat_region 8495345..8495449 FT /rpt_family="MER2_type" FT repeat_region 8495454..8495799 FT /rpt_family="MER2_type" FT repeat_region 8495822..8496502 FT /rpt_family="ERV1" FT repeat_region 8496511..8496635 FT /rpt_family="ERV1" FT repeat_region 8496636..8496697 FT /rpt_family="MER2_type" FT repeat_region 8496975..8497134 FT /rpt_family="MIR" FT repeat_region 8497169..8497367 FT /rpt_family="MER1_type" FT repeat_region 8497448..8498073 FT /rpt_family="ERV1" FT repeat_region 8498505..8498531 FT /rpt_family="(T)n" FT repeat_region 8498548..8498588 FT /rpt_family="AT_rich" FT repeat_region 8498667..8499090 FT /rpt_family="ERV1" FT repeat_region 8499091..8499397 FT /rpt_family="Alu" FT repeat_region 8499398..8499531 FT /rpt_family="ERV1" FT repeat_region 8499786..8500046 FT /rpt_family="L1" FT repeat_region 8500054..8500279 FT /rpt_family="MaLR" FT repeat_region 8501246..8501302 FT /rpt_family="(GGGTG)n" FT repeat_region 8501386..8501660 FT /rpt_family="L1" FT repeat_region 8501678..8501935 FT /rpt_family="Alu" FT repeat_region 8501937..8502251 FT /rpt_family="Alu" FT repeat_region 8502382..8502671 FT /rpt_family="Alu" FT repeat_region 8502862..8502909 FT /rpt_family="L2" FT repeat_region 8503088..8503318 FT /rpt_family="MIR" FT repeat_region 8503389..8503449 FT /rpt_family="polypyrimidine" FT repeat_region 8503497..8503622 FT /rpt_family="MIR" FT repeat_region 8504095..8504624 FT /rpt_family="MaLR" FT repeat_region 8504804..8504868 FT /rpt_family="MIR" FT repeat_region 8507324..8507426 FT /rpt_family="MIR" FT repeat_region 8507427..8507785 FT /rpt_family="MaLR" FT repeat_region 8507786..8507849 FT /rpt_family="MIR" FT repeat_region 8509251..8509334 FT /rpt_family="CT-rich" FT repeat_region 8509617..8509933 FT /rpt_family="Alu" FT repeat_region 8510920..8510969 FT /rpt_family="GA-rich" FT repeat_region 8511116..8511173 FT /rpt_family="ERVL" FT repeat_region 8511336..8511402 FT /rpt_family="MIR" FT repeat_region 8511692..8511796 FT /rpt_family="L2" FT repeat_region 8511911..8512303 FT /rpt_family="MaLR" FT repeat_region 8513091..8513228 FT /rpt_family="MaLR" FT repeat_region 8513235..8513345 FT /rpt_family="Ricksha" FT repeat_region 8513332..8513575 FT /rpt_family="Ricksha" FT repeat_region 8513566..8513787 FT /rpt_family="Ricksha" FT repeat_region 8513788..8514091 FT /rpt_family="Alu" FT repeat_region 8514092..8514645 FT /rpt_family="Ricksha" FT repeat_region 8514650..8514876 FT /rpt_family="Alu" FT repeat_region 8514877..8515219 FT /rpt_family="MaLR" FT repeat_region 8515225..8515797 FT /rpt_family="L1" FT repeat_region 8515802..8515976 FT /rpt_family="L1" FT repeat_region 8515977..8516296 FT /rpt_family="Alu" FT repeat_region 8516297..8516530 FT /rpt_family="L1" FT repeat_region 8516686..8516993 FT /rpt_family="Alu" FT repeat_region 8516994..8517114 FT /rpt_family="L2" FT repeat_region 8517188..8517406 FT /rpt_family="L2" FT repeat_region 8517431..8517525 FT /rpt_family="L2" FT repeat_region 8517790..8518220 FT /rpt_family="ERV1" FT repeat_region 8518225..8518534 FT /rpt_family="Alu" FT repeat_region 8519213..8519341 FT /rpt_family="MIR" FT repeat_region 8520398..8520698 FT /rpt_family="Alu" FT repeat_region 8521571..8521680 FT /rpt_family="MIR" FT repeat_region 8521830..8522178 FT /rpt_family="MaLR" FT repeat_region 8522367..8523058 FT /rpt_family="L1" FT repeat_region 8523135..8523446 FT /rpt_family="Alu" FT repeat_region 8523463..8523546 FT /rpt_family="L1" FT repeat_region 8523614..8523694 FT /rpt_family="MIR" FT repeat_region 8523688..8523797 FT /rpt_family="L2" FT repeat_region 8524351..8524427 FT /rpt_family="MIR" FT repeat_region 8524428..8524458 FT /rpt_family="(TGAA)n" FT repeat_region 8525445..8525631 FT /rpt_family="MIR" FT repeat_region 8525716..8525830 FT /rpt_family="L2" FT repeat_region 8525867..8526032 FT /rpt_family="L1" FT repeat_region 8526033..8526350 FT /rpt_family="Alu" FT repeat_region 8526743..8526851 FT /rpt_family="MER1_type" FT repeat_region 8528070..8528179 FT /rpt_family="MIR" FT repeat_region 8528716..8528954 FT /rpt_family="L1" FT repeat_region 8528955..8529088 FT /rpt_family="Alu" FT repeat_region 8529293..8529448 FT /rpt_family="L1" FT repeat_region 8529459..8529842 FT /rpt_family="L1" FT repeat_region 8529856..8530160 FT /rpt_family="Alu" FT repeat_region 8530161..8530294 FT /rpt_family="Alu" FT repeat_region 8530295..8530676 FT /rpt_family="L1" FT repeat_region 8530677..8531032 FT /rpt_family="MaLR" FT repeat_region 8531033..8531570 FT /rpt_family="L1" FT repeat_region 8531571..8531703 FT /rpt_family="Alu" FT repeat_region 8531704..8531992 FT /rpt_family="Alu" FT repeat_region 8531993..8532015 FT /rpt_family="Alu" FT repeat_region 8532016..8532747 FT /rpt_family="L1" FT repeat_region 8532750..8533079 FT /rpt_family="Alu" FT repeat_region 8533099..8533158 FT /rpt_family="L1" FT repeat_region 8533159..8533485 FT /rpt_family="Alu" FT repeat_region 8533486..8533855 FT /rpt_family="L1" FT repeat_region 8533866..8533936 FT /rpt_family="Alu" FT repeat_region 8533937..8534283 FT /rpt_family="ERV1" FT repeat_region 8534285..8534475 FT /rpt_family="MaLR" FT repeat_region 8534632..8534940 FT /rpt_family="Alu" FT repeat_region 8535280..8535586 FT /rpt_family="Alu" FT repeat_region 8535933..8536043 FT /rpt_family="Tip100" FT repeat_region 8536044..8536620 FT /rpt_family="ERV1" FT repeat_region 8536621..8537006 FT /rpt_family="MaLR" FT repeat_region 8537007..8537249 FT /rpt_family="ERV1" FT repeat_region 8537280..8537385 FT /rpt_family="Tip100" FT repeat_region 8537390..8537598 FT /rpt_family="Tip100" FT repeat_region 8537860..8537967 FT /rpt_family="L2" FT repeat_region 8538713..8538834 FT /rpt_family="L2" FT repeat_region 8540556..8540657 FT /rpt_family="MIR" FT repeat_region 8540803..8540985 FT /rpt_family="MIR" FT repeat_region 8542151..8542300 FT /rpt_family="MIR" FT repeat_region 8542427..8542809 FT /rpt_family="MaLR" FT repeat_region 8543192..8543487 FT /rpt_family="Alu" FT repeat_region 8543592..8543679 FT /rpt_family="Alu" FT repeat_region 8543700..8544081 FT /rpt_family="L2" FT repeat_region 8545311..8545752 FT /rpt_family="MaLR" FT repeat_region 8546215..8546388 FT /rpt_family="L2" FT repeat_region 8547615..8547976 FT /rpt_family="ERV1" FT repeat_region 8547980..8548069 FT /rpt_family="MaLR" FT repeat_region 8548079..8548504 FT /rpt_family="ERV1" FT repeat_region 8548647..8548753 FT /rpt_family="MaLR" FT repeat_region 8549006..8549147 FT /rpt_family="ERV1" FT repeat_region 8549141..8549534 FT /rpt_family="ERV1" FT repeat_region 8550026..8550446 FT /rpt_family="ERVL" FT repeat_region 8550447..8550489 FT /rpt_family="CT-rich" FT repeat_region 8550490..8550543 FT /rpt_family="ERVL" FT repeat_region 8550562..8550639 FT /rpt_family="AcHobo" FT repeat_region 8551744..8551937 FT /rpt_family="MaLR" FT repeat_region 8552937..8553257 FT /rpt_family="Alu" FT repeat_region 8553295..8553559 FT /rpt_family="MaLR" FT repeat_region 8554115..8554259 FT /rpt_family="L2" FT repeat_region 8554269..8554381 FT /rpt_family="CR1" FT repeat_region 8554360..8554529 FT /rpt_family="L2" FT repeat_region 8554732..8554839 FT /rpt_family="L2" FT repeat_region 8554904..8554974 FT /rpt_family="MIR" FT repeat_region 8554986..8555015 FT /rpt_family="MIR" FT repeat_region 8555496..8555794 FT /rpt_family="Alu" FT repeat_region 8555928..8556469 FT /rpt_family="MaLR" FT repeat_region 8556757..8557100 FT /rpt_family="MER2_type" FT repeat_region 8557101..8557411 FT /rpt_family="Alu" FT repeat_region 8557412..8557529 FT /rpt_family="MER2_type" FT repeat_region 8558346..8558382 FT /rpt_family="L2" FT repeat_region 8558572..8558866 FT /rpt_family="Alu" FT repeat_region 8559322..8559349 FT /rpt_family="MIR" FT repeat_region 8560494..8560590 FT /rpt_family="MIR" FT repeat_region 8561101..8561504 FT /rpt_family="ERVL" FT repeat_region 8561546..8561704 FT /rpt_family="L2" FT repeat_region 8562213..8562379 FT /rpt_family="AcHobo" FT repeat_region 8562823..8563004 FT /rpt_family="MIR" FT repeat_region 8563005..8563308 FT /rpt_family="Alu" FT repeat_region 8563309..8563352 FT /rpt_family="MIR" FT repeat_region 8563379..8563464 FT /rpt_family="(CACCAT)n" FT repeat_region 8563480..8563909 FT /rpt_family="ERV1" FT repeat_region 8563935..8565242 FT /rpt_family="ERV1" FT repeat_region 8565243..8565548 FT /rpt_family="Alu" FT repeat_region 8565557..8565848 FT /rpt_family="Alu" FT repeat_region 8565849..8566668 FT /rpt_family="ERV1" FT repeat_region 8566669..8566691 FT /rpt_family="(TTTG)n" FT repeat_region 8566692..8566844 FT /rpt_family="ERV1" FT repeat_region 8566845..8567121 FT /rpt_family="Alu" FT repeat_region 8567122..8567203 FT /rpt_family="ERV1" FT repeat_region 8567204..8567234 FT /rpt_family="(TTA)n" FT repeat_region 8567235..8567615 FT /rpt_family="ERV1" FT repeat_region 8567616..8567919 FT /rpt_family="Alu" FT repeat_region 8567920..8568022 FT /rpt_family="ERV1" FT repeat_region 8568023..8568290 FT /rpt_family="Alu" FT repeat_region 8568291..8568557 FT /rpt_family="ERV1" FT repeat_region 8568558..8568868 FT /rpt_family="Alu" FT repeat_region 8568869..8569018 FT /rpt_family="ERV1" FT repeat_region 8569021..8569169 FT /rpt_family="ERV1" FT repeat_region 8569170..8569694 FT /rpt_family="ERV1" FT repeat_region 8569695..8570423 FT /rpt_family="ERV1" FT repeat_region 8570426..8570543 FT /rpt_family="ERV1" FT repeat_region 8570544..8570755 FT /rpt_family="Alu" FT repeat_region 8570756..8571294 FT /rpt_family="ERV1" FT repeat_region 8571295..8571591 FT /rpt_family="Alu" FT repeat_region 8571592..8572501 FT /rpt_family="ERV1" FT repeat_region 8572583..8572709 FT /rpt_family="Alu" FT repeat_region 8572715..8573616 FT /rpt_family="ERV1" FT repeat_region 8573617..8573842 FT /rpt_family="MIR" FT repeat_region 8574239..8574407 FT /rpt_family="MIR" FT repeat_region 8574954..8575103 FT /rpt_family="Alu" FT repeat_region 8575870..8576088 FT /rpt_family="Alu" FT repeat_region 8576089..8576382 FT /rpt_family="Alu" FT repeat_region 8576392..8576545 FT /rpt_family="MIR" FT repeat_region 8577642..8577821 FT /rpt_family="CT-rich" FT repeat_region 8577822..8577886 FT /rpt_family="polypyrimidine" FT repeat_region 8578019..8578133 FT /rpt_family="L1" FT repeat_region 8578252..8578305 FT /rpt_family="CT-rich" FT repeat_region 8578313..8578497 FT /rpt_family="Alu" FT repeat_region 8578498..8578540 FT /rpt_family="(TTTA)n" FT repeat_region 8578541..8578652 FT /rpt_family="Alu" FT repeat_region 8579100..8579178 FT /rpt_family="L2" FT repeat_region 8579446..8579569 FT /rpt_family="MIR" FT repeat_region 8579853..8579923 FT /rpt_family="(TG)n" FT repeat_region 8581005..8581093 FT /rpt_family="MIR" FT repeat_region 8581152..8581300 FT /rpt_family="MIR" FT repeat_region 8581297..8581348 FT /rpt_family="MIR" FT repeat_region 8581810..8581916 FT /rpt_family="CT-rich" FT repeat_region 8585742..8585860 FT /rpt_family="(CATG)n" FT repeat_region 8586202..8586286 FT /rpt_family="L2" FT repeat_region 8586489..8586638 FT /rpt_family="Mariner" FT repeat_region 8587501..8587525 FT /rpt_family="(CCTG)n" FT repeat_region 8588603..8588705 FT /rpt_family="MIR" FT repeat_region 8589284..8589354 FT /rpt_family="MIR" FT repeat_region 8590219..8590253 FT /rpt_family="(TGAG)n" FT repeat_region 8590607..8590897 FT /rpt_family="Alu" FT repeat_region 8591638..8591657 FT /rpt_family="(T)n" FT repeat_region 8593390..8593455 FT /rpt_family="Tc2" FT repeat_region 8594495..8594515 FT /rpt_family="GC_rich" FT repeat_region 8596176..8596248 FT /rpt_family="MIR" FT repeat_region 8596391..8596499 FT /rpt_family="MER1_type" FT repeat_region 8596500..8596798 FT /rpt_family="Alu" FT repeat_region 8596799..8596998 FT /rpt_family="MER1_type" FT repeat_region 8597397..8597780 FT /rpt_family="MaLR" FT repeat_region 8597781..8598076 FT /rpt_family="Alu" FT repeat_region 8598077..8598134 FT /rpt_family="MaLR" FT repeat_region 8598297..8598431 FT /rpt_family="MIR" FT repeat_region 8599537..8599678 FT /rpt_family="MIR" FT repeat_region 8600942..8601056 FT /rpt_family="MIR" FT repeat_region 8601572..8601708 FT /rpt_family="MIR" FT repeat_region 8601848..8601870 FT /rpt_family="AT_rich" FT repeat_region 8601871..8602002 FT /rpt_family="Alu" FT repeat_region 8603519..8603756 FT /rpt_family="ERVL" FT repeat_region 8604027..8604222 FT /rpt_family="MER1_type" FT repeat_region 8604402..8604505 FT /rpt_family="L2" FT repeat_region 8606209..8606469 FT /rpt_family="Alu" FT repeat_region 8606931..8607002 FT /rpt_family="MIR" FT repeat_region 8607036..8607374 FT /rpt_family="(TCCA)n" FT repeat_region 8608735..8608827 FT /rpt_family="MIR" FT repeat_region 8610413..8610562 FT /rpt_family="L2" FT repeat_region 8610710..8611171 FT /rpt_family="(CTCA)n" FT repeat_region 8612695..8612839 FT /rpt_family="(CTCA)n" FT repeat_region 8613536..8613619 FT /rpt_family="L2" FT repeat_region 8613901..8613961 FT /rpt_family="(CGGGG)n" FT repeat_region 8614186..8614392 FT /rpt_family="MER53" FT repeat_region 8614857..8615156 FT /rpt_family="Alu" FT repeat_region 8615718..8615873 FT /rpt_family="MIR" FT repeat_region 8616509..8616670 FT /rpt_family="L2" FT repeat_region 8618190..8618435 FT /rpt_family="L2" FT repeat_region 8618986..8619075 FT /rpt_family="MIR" FT repeat_region 8619138..8619344 FT /rpt_family="AcHobo" FT repeat_region 8619949..8620068 FT /rpt_family="MIR" FT repeat_region 8620752..8620875 FT /rpt_family="L2" FT repeat_region 8622158..8622482 FT /rpt_family="MaLR" FT repeat_region 8623426..8623740 FT /rpt_family="Alu" FT repeat_region 8623853..8624265 FT /rpt_family="ERV1" FT repeat_region 8624268..8624399 FT /rpt_family="L1" FT repeat_region 8624400..8624709 FT /rpt_family="Alu" FT repeat_region 8624710..8624747 FT /rpt_family="L1" FT repeat_region 8625425..8625742 FT /rpt_family="Alu" FT repeat_region 8625838..8626022 FT /rpt_family="MIR" FT repeat_region 8626023..8626335 FT /rpt_family="Alu" FT repeat_region 8626336..8626383 FT /rpt_family="MIR" FT repeat_region 8627073..8627366 FT /rpt_family="Alu" FT repeat_region 8627797..8628121 FT /rpt_family="MaLR" FT repeat_region 8629064..8629381 FT /rpt_family="Alu" FT repeat_region 8629494..8629906 FT /rpt_family="ERV1" FT repeat_region 8629909..8630040 FT /rpt_family="L1" FT repeat_region 8630041..8630350 FT /rpt_family="Alu" FT repeat_region 8630351..8630388 FT /rpt_family="L1" FT repeat_region 8631066..8631383 FT /rpt_family="Alu" FT repeat_region 8631479..8631663 FT /rpt_family="MIR" FT repeat_region 8631664..8631976 FT /rpt_family="Alu" FT repeat_region 8631977..8632019 FT /rpt_family="MIR" FT repeat_region 8632709..8633003 FT /rpt_family="Alu" FT repeat_region 8633434..8633758 FT /rpt_family="MaLR" FT repeat_region 8634702..8635015 FT /rpt_family="Alu" FT repeat_region 8635128..8635540 FT /rpt_family="ERV1" FT repeat_region 8635543..8635674 FT /rpt_family="L1" FT repeat_region 8635675..8635988 FT /rpt_family="Alu" FT repeat_region 8635989..8636026 FT /rpt_family="L1" FT repeat_region 8636704..8637025 FT /rpt_family="Alu" FT repeat_region 8637121..8637305 FT /rpt_family="MIR" FT repeat_region 8637306..8637620 FT /rpt_family="Alu" FT repeat_region 8637621..8637669 FT /rpt_family="MIR" FT repeat_region 8638359..8638660 FT /rpt_family="Alu" FT repeat_region 8638838..8639210 FT /rpt_family="L1" FT repeat_region 8639463..8639630 FT /rpt_family="MaLR" FT repeat_region 8639680..8639825 FT /rpt_family="L1" FT repeat_region 8639826..8640127 FT /rpt_family="Alu" FT repeat_region 8640128..8640505 FT /rpt_family="L1" FT repeat_region 8640519..8640728 FT /rpt_family="L1" FT repeat_region 8640933..8641034 FT /rpt_family="L2" FT repeat_region 8641064..8641089 FT /rpt_family="(TGAA)n" FT repeat_region 8642068..8642199 FT /rpt_family="CR1" FT repeat_region 8643736..8644148 FT /rpt_family="ERVL" FT repeat_region 8644696..8644719 FT /rpt_family="(CA)n" FT repeat_region 8644724..8644821 FT /rpt_family="L2" FT repeat_region 8644831..8644903 FT /rpt_family="MIR" FT repeat_region 8645308..8645655 FT /rpt_family="MaLR" FT repeat_region 8646364..8646557 FT /rpt_family="MaLR" FT repeat_region 8646992..8647123 FT /rpt_family="MIR" FT repeat_region 8647334..8647477 FT /rpt_family="MIR" FT repeat_region 8647877..8648283 FT /rpt_family="MaLR" FT repeat_region 8649029..8649289 FT /rpt_family="Alu" FT repeat_region 8649290..8649312 FT /rpt_family="AT_rich" FT repeat_region 8649713..8649854 FT /rpt_family="L1" FT repeat_region 8650052..8650165 FT /rpt_family="MIR" FT repeat_region 8651482..8651519 FT /rpt_family="GC_rich" FT repeat_region 8652843..8653142 FT /rpt_family="Alu" FT repeat_region 8653268..8653344 FT /rpt_family="MER103" FT repeat_region 8654781..8654949 FT /rpt_family="CT-rich" FT repeat_region 8654962..8655040 FT /rpt_family="L2" FT repeat_region 8655409..8655747 FT /rpt_family="MaLR" FT repeat_region 8655748..8656258 FT /rpt_family="L1" FT repeat_region 8656259..8656609 FT /rpt_family="MaLR" FT repeat_region 8656610..8656906 FT /rpt_family="L1" FT repeat_region 8656908..8657012 FT /rpt_family="MaLR" FT repeat_region 8658572..8658676 FT /rpt_family="MIR" FT repeat_region 8659580..8659635 FT /rpt_family="L2" FT repeat_region 8659741..8660287 FT /rpt_family="L1" FT repeat_region 8660318..8660726 FT /rpt_family="L1" FT repeat_region 8660727..8661025 FT /rpt_family="Alu" FT repeat_region 8661026..8661147 FT /rpt_family="L1" FT repeat_region 8661148..8661219 FT /rpt_family="(TTCCC)n" FT repeat_region 8661220..8661395 FT /rpt_family="Alu" FT repeat_region 8661396..8661688 FT /rpt_family="Alu" FT repeat_region 8661689..8661814 FT /rpt_family="Alu" FT repeat_region 8661815..8661927 FT /rpt_family="L1" FT repeat_region 8661928..8662229 FT /rpt_family="Alu" FT repeat_region 8662230..8662287 FT /rpt_family="L1" FT repeat_region 8662311..8662645 FT /rpt_family="MaLR" FT repeat_region 8662704..8662780 FT /rpt_family="MIR" FT repeat_region 8662844..8662937 FT /rpt_family="L1" FT repeat_region 8662938..8663231 FT /rpt_family="Alu" FT repeat_region 8663232..8663845 FT /rpt_family="L1" FT repeat_region 8663846..8664130 FT /rpt_family="Alu" FT repeat_region 8664209..8664565 FT /rpt_family="L1" FT repeat_region 8664720..8665008 FT /rpt_family="Alu" FT repeat_region 8665022..8665050 FT /rpt_family="AT_rich" FT repeat_region 8665359..8665675 FT /rpt_family="Alu" FT repeat_region 8665766..8665789 FT /rpt_family="AT_rich" FT repeat_region 8666050..8666159 FT /rpt_family="MIR" FT repeat_region 8666231..8666376 FT /rpt_family="L2" FT repeat_region 8667920..8668058 FT /rpt_family="L2" FT repeat_region 8668204..8668450 FT /rpt_family="L1" FT repeat_region 8668489..8668698 FT /rpt_family="L1" FT repeat_region 8668699..8668851 FT /rpt_family="Alu" FT repeat_region 8668852..8669161 FT /rpt_family="Alu" FT repeat_region 8669162..8669297 FT /rpt_family="Alu" FT repeat_region 8669298..8669532 FT /rpt_family="L1" FT repeat_region 8669598..8669882 FT /rpt_family="Alu" FT repeat_region 8669900..8670139 FT /rpt_family="L1" FT repeat_region 8670193..8671519 FT /rpt_family="L1" FT repeat_region 8671520..8671798 FT /rpt_family="Alu" FT repeat_region 8671799..8672637 FT /rpt_family="L1" FT repeat_region 8672638..8672981 FT /rpt_family="MaLR" FT repeat_region 8672982..8673104 FT /rpt_family="L1" FT repeat_region 8673169..8673246 FT /rpt_family="MER1_type" FT repeat_region 8673242..8673569 FT /rpt_family="L2" FT repeat_region 8674105..8674272 FT /rpt_family="MER1_type" FT repeat_region 8674420..8674846 FT /rpt_family="MaLR" FT repeat_region 8675042..8675367 FT /rpt_family="Alu" FT repeat_region 8675370..8675491 FT /rpt_family="MIR" FT repeat_region 8675534..8675809 FT /rpt_family="MER2_type" FT repeat_region 8676508..8676663 FT /rpt_family="MIR" FT repeat_region 8677681..8677720 FT /rpt_family="L2" FT repeat_region 8677996..8678109 FT /rpt_family="MIR" FT repeat_region 8678390..8678658 FT /rpt_family="L2" FT repeat_region 8678701..8679394 FT /rpt_family="L1" FT repeat_region 8679395..8679703 FT /rpt_family="Alu" FT repeat_region 8679704..8679755 FT /rpt_family="L1" FT repeat_region 8679772..8679829 FT /rpt_family="L1" FT repeat_region 8679959..8680319 FT /rpt_family="L1" FT repeat_region 8680351..8680639 FT /rpt_family="Alu" FT repeat_region 8680644..8680988 FT /rpt_family="L1" FT repeat_region 8681149..8681316 FT /rpt_family="MIR" FT repeat_region 8681863..8682031 FT /rpt_family="GA-rich" FT repeat_region 8682061..8682243 FT /rpt_family="ERVL" FT repeat_region 8683690..8683911 FT /rpt_family="MaLR" FT repeat_region 8684208..8684307 FT /rpt_family="MIR" FT repeat_region 8685132..8685740 FT /rpt_family="(TGGA)n" FT misc_feature 8685614..8688117 FT /note="Sequence derived from PCR product of project DNA." FT repeat_region 8686106..8686443 FT /rpt_family="MaLR" FT repeat_region 8686490..8686568 FT /rpt_family="MIR" FT repeat_region 8686648..8686767 FT /rpt_family="Alu" FT repeat_region 8687002..8687180 FT /rpt_family="MaLR" FT repeat_region 8687215..8687325 FT /rpt_family="MER1_type" FT repeat_region 8687326..8687456 FT /rpt_family="Alu" FT repeat_region 8687457..8687575 FT /rpt_family="MER1_type" FT repeat_region 8688030..8688121 FT /rpt_family="MIR" FT repeat_region 8688398..8688583 FT /rpt_family="L1" FT repeat_region 8688584..8688756 FT /rpt_family="(TG)n" FT misc_feature 8688753..8689090 FT /note="Sequence derived from PCR product of project DNA." FT repeat_region 8688757..8688775 FT /rpt_family="L1" FT repeat_region 8688776..8689120 FT /rpt_family="(TG)n" FT repeat_region 8689121..8689193 FT /rpt_family="L1" FT repeat_region 8689271..8689564 FT /rpt_family="Alu" FT repeat_region 8689629..8689757 FT /rpt_family="MIR" FT repeat_region 8690761..8691148 FT /rpt_family="L2" FT repeat_region 8691181..8691339 FT /rpt_family="MIR" FT repeat_region 8692080..8692202 FT /rpt_family="L2" FT repeat_region 8692377..8692577 FT /rpt_family="L2" FT repeat_region 8693379..8693479 FT /rpt_family="L1" FT repeat_region 8693480..8693999 FT /rpt_family="ERV1" FT repeat_region 8694000..8694038 FT /rpt_family="L1" FT repeat_region 8694039..8694346 FT /rpt_family="Alu" FT repeat_region 8694347..8694533 FT /rpt_family="L1" FT repeat_region 8694574..8694902 FT /rpt_family="L1" FT repeat_region 8694915..8695068 FT /rpt_family="L1" FT repeat_region 8695142..8695455 FT /rpt_family="Alu" FT repeat_region 8695514..8695669 FT /rpt_family="L1" FT repeat_region 8695740..8695977 FT /rpt_family="L1" FT repeat_region 8696259..8696375 FT /rpt_family="GA-rich" FT repeat_region 8697242..8697411 FT /rpt_family="(CA)n" FT repeat_region 8697812..8697895 FT /rpt_family="L2" FT repeat_region 8698052..8698136 FT /rpt_family="L2" FT repeat_region 8698360..8698457 FT /rpt_family="MIR" FT repeat_region 8698493..8698745 FT /rpt_family="MER2_type" FT repeat_region 8698745..8698822 FT /rpt_family="MER2_type" FT repeat_region 8698833..8699317 FT /rpt_family="L1" FT repeat_region 8699386..8699512 FT /rpt_family="Alu" FT repeat_region 8699759..8699839 FT /rpt_family="MIR" FT repeat_region 8700891..8701008 FT /rpt_family="L2" FT repeat_region 8701203..8701331 FT /rpt_family="L2" FT repeat_region 8701878..8701904 FT /rpt_family="AT_rich" FT repeat_region 8702748..8702778 FT /rpt_family="(TG)n" FT repeat_region 8702779..8702826 FT /rpt_family="GA-rich" FT repeat_region 8703884..8704017 FT /rpt_family="MIR" FT repeat_region 8704807..8704944 FT /rpt_family="L2" FT repeat_region 8705513..8705623 FT /rpt_family="MIR" FT repeat_region 8707262..8707381 FT /rpt_family="CR1" FT repeat_region 8707607..8707721 FT /rpt_family="MIR" FT repeat_region 8708054..8708434 FT /rpt_family="MaLR" FT repeat_region 8708435..8708583 FT /rpt_family="MIR" FT repeat_region 8709459..8709536 FT /rpt_family="MIR" FT repeat_region 8709806..8710133 FT /rpt_family="MaLR" FT repeat_region 8710699..8711069 FT /rpt_family="MaLR" FT repeat_region 8711364..8711503 FT /rpt_family="MIR" FT repeat_region 8712065..8712149 FT /rpt_family="ERVL" FT repeat_region 8713391..8713685 FT /rpt_family="Alu" FT repeat_region 8713979..8714277 FT /rpt_family="L1" FT repeat_region 8714484..8715042 FT /rpt_family="L1" FT repeat_region 8715059..8715282 FT /rpt_family="L1" FT repeat_region 8715307..8715732 FT /rpt_family="L1" FT repeat_region 8715747..8715894 FT /rpt_family="L1" FT repeat_region 8715900..8715945 FT /rpt_family="L1" FT repeat_region 8715946..8716154 FT /rpt_family="MER1_type" FT repeat_region 8716155..8717460 FT /rpt_family="L1" FT repeat_region 8717600..8717722 FT /rpt_family="L1" FT repeat_region 8717724..8718029 FT /rpt_family="Alu" FT repeat_region 8718030..8718340 FT /rpt_family="Alu" FT repeat_region 8718348..8718639 FT /rpt_family="Alu" FT repeat_region 8718640..8718666 FT /rpt_family="(TA)n" FT repeat_region 8718704..8719269 FT /rpt_family="L1" FT repeat_region 8719270..8719315 FT /rpt_family="(GAAA)n" FT repeat_region 8719316..8719491 FT /rpt_family="(GAAA)n" FT repeat_region 8719526..8719661 FT /rpt_family="L1" FT repeat_region 8719690..8719838 FT /rpt_family="L1" FT repeat_region 8719840..8720042 FT /rpt_family="MER1_type" FT repeat_region 8720044..8720296 FT /rpt_family="L1" FT repeat_region 8720297..8720609 FT /rpt_family="Alu" FT repeat_region 8720610..8720790 FT /rpt_family="L1" FT repeat_region 8720774..8721160 FT /rpt_family="L1" FT repeat_region 8721499..8721655 FT /rpt_family="L1" FT repeat_region 8721763..8721934 FT /rpt_family="MIR" FT repeat_region 8721936..8722237 FT /rpt_family="Alu" FT repeat_region 8723326..8723374 FT /rpt_family="L2" FT repeat_region 8723779..8724125 FT /rpt_family="L1" FT repeat_region 8724813..8725001 FT /rpt_family="Alu" FT repeat_region 8725938..8725999 FT /rpt_family="GA-rich" FT repeat_region 8726002..8726043 FT /rpt_family="(GA)n" FT repeat_region 8726088..8726140 FT /rpt_family="(CAGAGA)n" FT misc_feature 8726337..8726350 FT /note="Sequence derived from PCR product of project DNA." FT repeat_region 8726646..8726741 FT /rpt_family="MIR" FT repeat_region 8727620..8727642 FT /rpt_family="AT_rich" FT repeat_region 8728712..8728746 FT /rpt_family="(TGAA)n" FT repeat_region 8728837..8729286 FT /rpt_family="MaLR" FT repeat_region 8730360..8730535 FT /rpt_family="MIR" FT unsure 8760418..8761308 FT /note="Unresolved tandem repeat." FT gap 8799204..8818203 FT /estimated_length=19000 FT repeat_region 8829374..8830994 FT /rpt_family="L1" FT repeat_region 8830976..8831392 FT /rpt_family="L1" FT repeat_region 8831402..8831470 FT /rpt_family="MaLR" FT repeat_region 8832957..8833025 FT /rpt_family="L2" FT repeat_region 8834880..8834929 FT /rpt_family="MIR" FT repeat_region 8834983..8835153 FT /rpt_family="MIR" FT repeat_region 8835496..8835806 FT /rpt_family="Alu" FT repeat_region 8836001..8836024 FT /rpt_family="(TGAA)n" FT repeat_region 8836920..8837112 FT /rpt_family="CR1" FT repeat_region 8837492..8837633 FT /rpt_family="MIR" FT repeat_region 8837706..8838078 FT /rpt_family="ERVL" FT repeat_region 8839140..8839179 FT /rpt_family="L2" FT repeat_region 8840136..8840265 FT /rpt_family="MIR" FT repeat_region 8840371..8840474 FT /rpt_family="MIR" FT repeat_region 8840587..8840689 FT /rpt_family="MER1_type" FT repeat_region 8841200..8841554 FT /rpt_family="L1" FT repeat_region 8841653..8841739 FT /rpt_family="L1" FT repeat_region 8842199..8842330 FT /rpt_family="L2" FT repeat_region 8843349..8843445 FT /rpt_family="MIR" FT repeat_region 8843471..8843649 FT /rpt_family="(ATG)n" FT repeat_region 8843690..8843862 FT /rpt_family="(ATGGTG)n" FT repeat_region 8843881..8844148 FT /rpt_family="(ATG)n" FT repeat_region 8844149..8844328 FT /rpt_family="(ATG)n" FT repeat_region 8844470..8844564 FT /rpt_family="(ATG)n" FT repeat_region 8844812..8845005 FT /rpt_family="MIR" FT repeat_region 8845059..8845931 FT /rpt_family="L1" FT repeat_region 8845932..8846218 FT /rpt_family="Alu" FT repeat_region 8846219..8846536 FT /rpt_family="Alu" FT repeat_region 8846537..8846745 FT /rpt_family="L1" FT repeat_region 8847300..8847428 FT /rpt_family="L2" FT repeat_region 8847433..8847615 FT /rpt_family="Tip100" FT repeat_region 8847628..8847668 FT /rpt_family="polypurine" FT repeat_region 8847750..8847910 FT /rpt_family="MaLR" FT repeat_region 8847966..8848096 FT /rpt_family="MaLR" FT repeat_region 8848160..8848300 FT /rpt_family="MER1_type" FT repeat_region 8848883..8849009 FT /rpt_family="Alu" FT repeat_region 8849010..8849033 FT /rpt_family="AT_rich" FT repeat_region 8849754..8850117 FT /rpt_family="MER1_type" FT repeat_region 8850197..8850333 FT /rpt_family="MIR" FT repeat_region 8850724..8850852 FT /rpt_family="MIR" FT repeat_region 8850910..8851345 FT /rpt_family="MaLR" FT repeat_region 8851790..8851835 FT /rpt_family="L2" FT repeat_region 8852660..8852755 FT /rpt_family="L2" FT repeat_region 8853361..8853507 FT /rpt_family="MIR" FT repeat_region 8854081..8854255 FT /rpt_family="MIR" FT repeat_region 8854529..8854783 FT /rpt_family="MaLR" FT repeat_region 8854889..8855294 FT /rpt_family="MaLR" FT repeat_region 8855296..8855587 FT /rpt_family="Alu" FT repeat_region 8855860..8855924 FT /rpt_family="L2" FT repeat_region 8856186..8856475 FT /rpt_family="ERVL" FT repeat_region 8857984..8858184 FT /rpt_family="L1" FT repeat_region 8858310..8858412 FT /rpt_family="L1" FT repeat_region 8858533..8858815 FT /rpt_family="Alu" FT misc_feature 8858938..8863875 FT /note="CpG_island (%GC=66.8, o/e=0.80, #CpGs=395)" FT repeat_region 8860346..8860366 FT /rpt_family="GC_rich" FT repeat_region 8860773..8860872 FT /rpt_family="MIR" FT repeat_region 8860936..8861052 FT /rpt_family="Tip100" FT repeat_region 8861143..8861227 FT /rpt_family="Tip100" FT repeat_region 8862163..8862243 FT /rpt_family="MIR" FT repeat_region 8862677..8862739 FT /rpt_family="(CGGGGG)n" FT repeat_region 8864108..8864453 FT /rpt_family="L1" FT misc_feature 8869045..8870067 FT /note="CpG_island (%GC=73.8, o/e=0.80, #CpGs=118)" FT repeat_region 8869457..8869592 FT /rpt_family="(CGG)n" FT repeat_region 8869863..8869980 FT /rpt_family="(CCG)n" FT repeat_region 8872449..8872663 FT /rpt_family="CT-rich" FT misc_feature 8872821..8876433 FT /note="CpG_island (%GC=66.7, o/e=0.80, #CpGs=322)" FT repeat_region 8873026..8873125 FT /rpt_family="GC_rich" FT repeat_region 8873133..8873229 FT /rpt_family="(TCG)n" FT repeat_region 8873293..8873320 FT /rpt_family="GC_rich" FT repeat_region 8873397..8873432 FT /rpt_family="GC_rich" FT repeat_region 8873487..8873516 FT /rpt_family="(CCGGG)n" FT repeat_region 8873736..8873799 FT /rpt_family="GC_rich" FT repeat_region 8873980..8874040 FT /rpt_family="(TG)n" FT repeat_region 8874718..8874844 FT /rpt_family="MIR" FT repeat_region 8875397..8875452 FT /rpt_family="MIR" FT repeat_region 8876588..8876609 FT /rpt_family="(CA)n" FT repeat_region 8877442..8877506 FT /rpt_family="MaLR" FT repeat_region 8877525..8877561 FT /rpt_family="GA-rich" FT repeat_region 8877564..8877701 FT /rpt_family="MaLR" FT repeat_region 8877789..8878038 FT /rpt_family="L1" FT repeat_region 8878120..8878259 FT /rpt_family="L2" FT repeat_region 8878963..8879192 FT /rpt_family="GA-rich" FT repeat_region 8879206..8879297 FT /rpt_family="G-rich" FT repeat_region 8880984..8881112 FT /rpt_family="L1" FT repeat_region 8881272..8881685 FT /rpt_family="MaLR" FT repeat_region 8882168..8882299 FT /rpt_family="MIR" FT repeat_region 8882661..8882825 FT /rpt_family="(CCCA)n" FT repeat_region 8882709..8882885 FT /rpt_family="(CA)n" FT repeat_region 8883046..8883093 FT /rpt_family="(CA)n" FT repeat_region 8883418..8883914 FT /rpt_family="L1" FT repeat_region 8885219..8885629 FT /rpt_family="MaLR" FT repeat_region 8885636..8885960 FT /rpt_family="MaLR" FT repeat_region 8886157..8886286 FT /rpt_family="CR1" FT repeat_region 8887833..8888118 FT /rpt_family="Alu" FT repeat_region 8891495..8891794 FT /rpt_family="Alu" FT repeat_region 8892595..8892638 FT /rpt_family="MIR" FT repeat_region 8892645..8892808 FT /rpt_family="Alu" FT misc_feature 8893372..8896268 FT /note="CpG_island (%GC=68.5, o/e=0.80, #CpGs=266)" FT repeat_region 8893605..8893665 FT /rpt_family="L2" FT repeat_region 8894188..8894299 FT /rpt_family="C-rich" FT repeat_region 8895199..8895219 FT /rpt_family="GC_rich" FT repeat_region 8896435..8896603 FT /rpt_family="AcHobo" FT repeat_region 8897620..8897752 FT /rpt_family="MIR" FT repeat_region 8898355..8898515 FT /rpt_family="MIR" FT repeat_region 8898516..8898568 FT /rpt_family="(CA)n" FT repeat_region 8899304..8899407 FT /rpt_family="CT-rich" FT repeat_region 8899538..8899671 FT /rpt_family="MIR" FT repeat_region 8900802..8900891 FT /rpt_family="MIR" FT repeat_region 8900930..8901231 FT /rpt_family="Alu" FT repeat_region 8902157..8902394 FT /rpt_family="ERVL" FT repeat_region 8902634..8902838 FT /rpt_family="ERVL" FT repeat_region 8902852..8903187 FT /rpt_family="MaLR" FT repeat_region 8903259..8903636 FT /rpt_family="ERVL" FT repeat_region 8903688..8903788 FT /rpt_family="MaLR" FT repeat_region 8904002..8904134 FT /rpt_family="L1" FT repeat_region 8904148..8904424 FT /rpt_family="L1" FT repeat_region 8904428..8904616 FT /rpt_family="L1" FT repeat_region 8904617..8904928 FT /rpt_family="Alu" FT repeat_region 8904929..8904948 FT /rpt_family="L1" FT repeat_region 8904949..8905244 FT /rpt_family="Alu" FT repeat_region 8905245..8905693 FT /rpt_family="L1" FT repeat_region 8906211..8906452 FT /rpt_family="MaLR" FT repeat_region 8906583..8906632 FT /rpt_family="MIR" FT repeat_region 8907389..8907575 FT /rpt_family="MIR" FT repeat_region 8908598..8908648 FT /rpt_family="(TTCC)n" FT repeat_region 8908725..8908868 FT /rpt_family="L2" FT repeat_region 8908948..8909098 FT /rpt_family="MaLR" FT repeat_region 8909808..8909930 FT /rpt_family="MIR" FT repeat_region 8910624..8910936 FT /rpt_family="Tip100" FT repeat_region 8910937..8911253 FT /rpt_family="Alu" FT repeat_region 8911254..8911349 FT /rpt_family="Tip100" FT repeat_region 8911355..8911746 FT /rpt_family="Tip100" FT repeat_region 8912425..8912820 FT /rpt_family="MaLR" FT repeat_region 8912863..8913029 FT /rpt_family="L2" FT repeat_region 8914162..8914464 FT /rpt_family="CR1" FT repeat_region 8914607..8914779 FT /rpt_family="C-rich" FT repeat_region 8914908..8914944 FT /rpt_family="(TTCA)n" FT repeat_region 8915449..8915867 FT /rpt_family="MaLR" FT repeat_region 8916814..8916958 FT /rpt_family="MIR" FT repeat_region 8917980..8918110 FT /rpt_family="CR1" FT repeat_region 8918848..8918879 FT /rpt_family="(TTCA)n" FT repeat_region 8918884..8919053 FT /rpt_family="MIR" FT repeat_region 8919539..8919600 FT /rpt_family="(GA)n" FT repeat_region 8919987..8920154 FT /rpt_family="MER53" FT repeat_region 8920306..8920443 FT /rpt_family="MIR" FT repeat_region 8920492..8920754 FT /rpt_family="CT-rich" FT repeat_region 8920773..8921259 FT /rpt_family="Alu" FT repeat_region 8921269..8921591 FT /rpt_family="MaLR" FT repeat_region 8922069..8922445 FT /rpt_family="L2" FT repeat_region 8922517..8922869 FT /rpt_family="L2" FT repeat_region 8923089..8923184 FT /rpt_family="MIR" FT repeat_region 8923222..8923722 FT /rpt_family="MaLR" FT repeat_region 8923743..8923934 FT /rpt_family="L2" FT repeat_region 8923958..8925617 FT /rpt_family="L1" FT repeat_region complement(9099338..9099642) FT /rpt_family="ERV1" FT misc_feature complement(9098372..9098428) FT /note="similar to Homo sapiens EST BF512280 FT (NID:g11597459)" FT repeat_region complement(9096126..9096476) FT /rpt_family="ERV1" FT repeat_region complement(9095918..9096108) FT /rpt_family="MaLR" FT repeat_region complement(9095899..9095919) FT /rpt_family="AT_rich" FT misc_feature complement(9095908..9095917) FT /note="similar to Homo sapiens EST AA182827 (NID:g1766544) FT zp59f10.s1" FT misc_feature complement(9095902..9095917) FT /note="similar to Homo sapiens EST AW026780 (NID:g5880310) FT wv44h08.x1" FT repeat_region complement(9095618..9095917) FT /rpt_family="Alu" FT misc_feature complement(9095897..9095917) FT /note="similar to Homo sapiens EST AA658816 (NID:g2594970) FT nt78e06.s1" FT misc_feature complement(9095897..9095914) FT /note="similar to Homo sapiens EST BE965108 FT (NID:g11769137)" FT repeat_region complement(9095552..9095617) FT /rpt_family="MaLR" FT misc_feature complement(9095320..9095521) FT /note="similar to Homo sapiens EST AW903213 (NID:g8067418)" FT misc_feature complement(9095076..9095499) FT /note="similar to Homo sapiens EST BF512280 FT (NID:g11597459)" FT repeat_region complement(9095203..9095354) FT /rpt_family="MER1_type" FT repeat_region complement(9094864..9095051) FT /rpt_family="L1" FT repeat_region complement(9094567..9094852) FT /rpt_family="Alu" FT repeat_region complement(9094541..9094573) FT /rpt_family="AT_rich" FT repeat_region complement(9094262..9094566) FT /rpt_family="Alu" FT misc_feature complement(9094538..9094554) FT /note="match to EST AI680786 (NID:g4890968) tx34g11.x1" FT repeat_region complement(9093957..9094256) FT /rpt_family="Alu" FT misc_feature complement(9094192..9094204) FT /note="similar to Homo sapiens EST AA555329 (NID:g2325868) FT nk79h06.s1" FT misc_feature complement(9094009..9094072) FT /note="similar to Homo sapiens EST AW876517 (NID:g8014663)" FT misc_feature complement(9093592..9093872) FT /note="match to EST AW847578 (NID:g7943095)" FT repeat_region complement(9093335..9093556) FT /rpt_family="MER1_type" FT misc_feature complement(9092669..9093305) FT /note="similar to Homo sapiens EST BG460770 FT (NID:g13749276)" FT repeat_region complement(9093094..9093187) FT /rpt_family="MER1_type" FT misc_feature complement(9092713..9092947) FT /note="match to EST BF365618 (NID:g11327643)" FT misc_feature complement(9092573) FT /note="similar to Homo sapiens EST BF768114 FT (NID:g12116014)" FT misc_feature complement(9092139..9092489) FT /note="similar to Homo sapiens EST BF768114 FT (NID:g12116014)" FT repeat_region complement(9092123..9092290) FT /rpt_family="MaLR" FT repeat_region complement(9091881..9091931) FT /rpt_family="Alu" FT repeat_region complement(9091779..9091805) FT /rpt_family="(T)n" FT repeat_region complement(9091603..9091625) FT /rpt_family="(T)n" FT repeat_region complement(9091387..9091467) FT /rpt_family="Alu" FT repeat_region complement(9091282..9091374) FT /rpt_family="MaLR" FT repeat_region complement(9090980..9091281) FT /rpt_family="Alu" FT repeat_region complement(9090604..9090979) FT /rpt_family="MaLR" FT repeat_region complement(9090298..9090598) FT /rpt_family="Alu" FT misc_feature complement(9090372..9090373) FT /note="match to EST AW843674 (NID:g7937657)" FT misc_feature complement(9089883..9090350) FT /note="similar to Homo sapiens EST AW876517 (NID:g8014663)" FT misc_feature complement(9090148..9090304) FT /note="match to EST AW843674 (NID:g7937657)" FT repeat_region complement(9089745..9090011) FT /rpt_family="MaLR" FT repeat_region complement(9089441..9089744) FT /rpt_family="Alu" FT repeat_region complement(9089172..9089440) FT /rpt_family="MaLR" FT repeat_region complement(9089103..9089127) FT /rpt_family="(T)n" FT misc_feature complement(9088962..9088963) FT /note="similar to Homo sapiens EST AW854448 (NID:g7950050)" FT misc_feature complement(9088602..9088856) FT /note="similar to Homo sapiens EST BF878761 FT (NID:g12268891)" FT misc_feature complement(9088276..9088831) FT /note="similar to Homo sapiens EST AW854448 (NID:g7950050)" FT repeat_region complement(9088387..9088411) FT /rpt_family="AT_rich" FT misc_feature complement(9084701..9084704) FT /note="similar to Homo sapiens EST AI982519 (NID:g5809738) FT wu04b10.x1" FT misc_feature complement(9082988..9082990) FT /note="similar to Homo sapiens EST AA884258 (NID:g2993788) FT am32c10.s1" FT repeat_region complement(9081915..9082209) FT /rpt_family="L2" FT repeat_region complement(9081688..9081915) FT /rpt_family="L2" FT repeat_region complement(9081591..9081667) FT /rpt_family="AT_rich" FT repeat_region complement(9081310..9081619) FT /rpt_family="Alu" FT misc_feature complement(9081378..9081587) FT /note="similar to Homo sapiens EST AA884258 (NID:g2993788) FT am32c10.s1" FT repeat_region complement(9081004..9081283) FT /rpt_family="Alu" FT misc_feature complement(9080821..9081103) FT /note="similar to Homo sapiens EST BE839817 FT (NID:g10272195)" FT misc_feature complement(9080927..9080973) FT /note="similar to Homo sapiens EST AA884258 (NID:g2993788) FT am32c10.s1" FT misc_feature complement(9080399..9080926) FT /note="similar to Homo sapiens EST BF816183 FT (NID:g12151533)" FT misc_feature complement(9080721..9080926) FT /note="similar to Homo sapiens EST AA884258 (NID:g2993788) FT am32c10.s1" FT misc_feature complement(9080750..9080923) FT /note="similar to Homo sapiens EST AA936758 (NID:g3094792) FT oi50c03.s1" FT misc_feature complement(9080771..9080825) FT /note="match to EST AA374146 (NID:g2026486)" FT misc_feature complement(9080368..9080818) FT /note="match to EST BF476390 (NID:g11547217)" FT misc_feature complement(9080721..9080723) FT /note="similar to Homo sapiens EST BF678613 FT (NID:g11952508)" FT misc_feature complement(9080122..9080669) FT /note="similar to Homo sapiens EST BF678613 FT (NID:g11952508)" FT repeat_region complement(9080376..9080506) FT /rpt_family="L1" FT repeat_region complement(9080076..9080368) FT /rpt_family="Alu" FT misc_feature complement(9079814..9080038) FT /note="match to EST AW850175 (NID:g7945692)" FT repeat_region complement(9079805..9079878) FT /rpt_family="Alu" FT repeat_region complement(9079552..9079804) FT /rpt_family="Alu" FT repeat_region complement(9079468..9079537) FT /rpt_family="ERV1" FT repeat_region complement(9079103..9079467) FT /rpt_family="ERV1" FT repeat_region complement(9078744..9078982) FT /rpt_family="MaLR" FT misc_feature complement(9078358..9078909) FT /note="similar to Homo sapiens EST BI006132 FT (NID:g14410203)" FT misc_feature complement(9078832..9078833) FT /note="similar to Homo sapiens EST BF955485 FT (NID:g12372747)" FT misc_feature complement(9078518..9078703) FT /note="match to EST AA374146 (NID:g2026486)" FT misc_feature complement(9078230..9078585) FT /note="similar to Homo sapiens EST BF955485 FT (NID:g12372747)" FT repeat_region complement(9077822..9078121) FT /rpt_family="Alu" FT repeat_region complement(9077013..9077564) FT /rpt_family="ERV1" FT repeat_region complement(9076696..9077012) FT /rpt_family="ERV1" FT misc_feature complement(9075876..9075953) FT /note="match to EST AA374146 (NID:g2026486)" FT misc_feature complement(9075581..9075585) FT /note="similar to Homo sapiens EST AV745437 FT (NID:g10864884)" FT misc_feature complement(9074628..9074714) FT /note="similar to Homo sapiens EST AV745437 FT (NID:g10864884)" FT misc_feature complement(9071908..9071914) FT /note="similar to Homo sapiens EST AA884258 (NID:g2993788) FT am32c10.s1" FT repeat_region complement(9070224..9070673) FT /rpt_family="ERV1" FT repeat_region complement(9069882..9070225) FT /rpt_family="MaLR" FT misc_feature complement(9069962..9070004) FT /note="similar to Homo sapiens EST AA873521 (NID:g2969643) FT oh70c06.s1" FT repeat_region complement(9069762..9069878) FT /rpt_family="MER1_type" FT repeat_region complement(9069416..9069721) FT /rpt_family="Alu" FT misc_feature complement(9069706..9069719) FT /note="similar to Homo sapiens EST AW411316 (NID:g6936857) FT fh11f02.y1" FT repeat_region complement(9069697..9069718) FT /rpt_family="(T)n" FT misc_feature complement(9069651..9069682) FT /note="similar to Homo sapiens EST AL527293 FT (NID:g12790786)" FT misc_feature complement(9069438..9069514) FT /note="match to EST T89763 (NID:g718276) yd99c03.r1" FT repeat_region complement(9069289..9069415) FT /rpt_family="Alu" FT misc_feature complement(9068930..9069301) FT /note="match to EST T89763 (NID:g718276) yd99c03.r1" FT repeat_region complement(9069124..9069269) FT /rpt_family="CR1" FT misc_feature complement(9068727..9069262) FT /note="match to EST BF435080 (NID:g11447368)" FT misc_feature complement(9068749..9068968) FT /note="match to EST AW075801 (NID:g6030799) xa85f07.x1" FT misc_feature complement(9068524..9068895) FT /note="match to EST BE086763 (NID:g8477156)" FT misc_feature complement(9068781..9068871) FT /note="similar to Homo sapiens EST AA873521 (NID:g2969643) FT oh70c06.s1" FT misc_feature complement(9068441..9068865) FT /note="similar to Homo sapiens EST AA033945 (NID:g1505820) FT zi05h10.r1" FT misc_feature complement(9068624..9068629) FT /note="similar to Homo sapiens EST BF768114 FT (NID:g12116014)" FT repeat_region complement(9068229..9068459) FT /rpt_family="L2" FT repeat_region complement(9067895..9068228) FT /rpt_family="Alu" FT repeat_region complement(9068061..9068109) FT /rpt_family="(A)n" FT repeat_region complement(9067202..9067894) FT /rpt_family="L2" FT misc_feature complement(9067352..9067358) FT /note="similar to Homo sapiens EST BG460770 FT (NID:g13749276)" FT repeat_region complement(9066107..9067192) FT /rpt_family="ERVK" FT misc_feature complement(9067026..9067030) FT /note="similar to Homo sapiens EST AA487120 (NID:g2217284) FT ab19a07.s1" FT repeat_region complement(9065995..9066079) FT /rpt_family="L2" FT misc_feature complement(9065996..9066060) FT /note="similar to Homo sapiens EST AA936758 (NID:g3094792) FT oi50c03.s1" FT misc_feature complement(9065996..9066052) FT /note="similar to Homo sapiens EST AA873521 (NID:g2969643) FT oh70c06.s1" FT repeat_region complement(9064912..9065994) FT /rpt_family="ERVK" FT misc_feature complement(9065297..9065456) FT /note="match to EST BG697914 (NID:g13964655)" FT misc_feature complement(9064785..9065272) FT /note="match to EST BG697914 (NID:g13964655)" FT misc_feature complement(9064809..9065091) FT /note="similar to Homo sapiens EST BE540259 (NID:g9768904)" FT repeat_region complement(9064852..9064911) FT /rpt_family="L2" FT misc_feature complement(9064785..9064905) FT /note="similar to Homo sapiens EST AA873521 (NID:g2969643) FT oh70c06.s1" FT /note="similar to Homo sapiens EST AA936758 (NID:g3094792) FT oi50c03.s1" FT misc_feature complement(9064346..9064795) FT /note="similar to Homo sapiens EST BE540259 (NID:g9768904)" FT misc_feature complement(9064594..9064773) FT /note="match to EST BG697914 (NID:g13964655)" FT misc_feature complement(9064739..9064773) FT /note="similar to Homo sapiens EST AA936758 (NID:g3094792) FT oi50c03.s1" FT misc_feature complement(9064738..9064773) FT /note="similar to Homo sapiens EST AA873521 (NID:g2969643) FT oh70c06.s1" FT misc_feature complement(9064244..9064758) FT /note="match to EST BF841709 (NID:g12194960)" FT misc_feature complement(9064295..9064735) FT /note="match to EST BF841705 (NID:g12194953)" FT repeat_region complement(9064431..9064500) FT /rpt_family="MaLR" FT repeat_region complement(9064144..9064430) FT /rpt_family="Alu" FT repeat_region complement(9063887..9064143) FT /rpt_family="MaLR" FT misc_feature complement(9063782..9063963) FT /note="match to EST AW590241 (NID:g7277370) hg34b07.x1" FT misc_feature complement(9063838..9063842) FT /note="similar to Homo sapiens EST BF844506 FT (NID:g12200177)" FT misc_feature complement(9063714..9063752) FT /note="match to EST AW590241 (NID:g7277370) hg34b07.x1" FT repeat_region complement(9063692..9063718) FT /rpt_family="(T)n" FT misc_feature complement(9063703..9063716) FT /note="similar to Homo sapiens EST BG765782 FT (NID:g14076435)" FT misc_feature complement(9063527..9063700) FT /note="match to EST AW590241 (NID:g7277370) hg34b07.x1" FT repeat_region complement(9063197..9063358) FT /rpt_family="MIR" FT repeat_region complement(9062833..9063136) FT /rpt_family="Alu" FT misc_feature complement(9063109..9063129) FT /note="similar to Homo sapiens EST BG821677 FT (NID:g14169264)" FT misc_feature complement(9062439..9062465) FT /note="similar to Homo sapiens EST BG765782 FT (NID:g14076435)" FT repeat_region complement(9062167..9062465) FT /rpt_family="Alu" FT misc_feature complement(9062455..9062463) FT /note="similar to Homo sapiens EST BG677857 FT (NID:g13909254)" FT misc_feature complement(9062442..9062459) FT /note="similar to Homo sapiens EST AV744356 FT (NID:g10861937)" FT repeat_region complement(9061585..9062154) FT /rpt_family="MaLR" FT misc_feature complement(9061333..9061568) FT /note="similar to Homo sapiens EST AA338611 (NID:g1990939)" FT repeat_region complement(9061280..9061454) FT /rpt_family="Alu" FT repeat_region complement(9061149..9061279) FT /rpt_family="ERV1" FT repeat_region complement(9060162..9061120) FT /rpt_family="L1" FT repeat_region complement(9059717..9060161) FT /rpt_family="MaLR" FT misc_feature complement(9059976..9059979) FT /note="similar to Homo sapiens EST AW816085 (NID:g7909079)" FT misc_feature complement(9059409..9059431) FT /note="similar to Homo sapiens EST BG765782 FT (NID:g14076435)" FT /note="similar to Homo sapiens EST BG677857 FT (NID:g13909254)" FT repeat_region complement(9059404..9059429) FT /rpt_family="(T)n" FT repeat_region complement(9058857..9059039) FT /rpt_family="MER1_type" FT repeat_region complement(9058643..9058769) FT /rpt_family="MER1_type" FT misc_feature complement(9058628..9058643) FT /note="similar to Homo sapiens EST BF343849 FT (NID:g11291048)" FT repeat_region complement(9058618..9058638) FT /rpt_family="(TG)n" FT repeat_region complement(9058313..9058618) FT /rpt_family="Alu" FT repeat_region complement(9058025..9058307) FT /rpt_family="L1" FT misc_feature complement(9057679..9058088) FT /note="similar to Homo sapiens EST M78624 (NID:g272940)" FT repeat_region complement(9057879..9058029) FT /rpt_family="L1" FT misc_feature complement(9057439..9057938) FT /note="similar to Homo sapiens EST BG703374 FT (NID:g13975641)" FT repeat_region complement(9057820..9057878) FT /rpt_family="MER1_type" FT repeat_region complement(9057413..9057622) FT /rpt_family="Alu" FT repeat_region complement(9057017..9057286) FT /rpt_family="Alu" FT misc_feature complement(9056714..9057012) FT /note="similar to Homo sapiens EST AA663866 (NID:g2617857) FT ae70d06.s1" FT misc_feature complement(9056392..9056821) FT /note="match to EST BE091235 (NID:g8481687)" FT misc_feature complement(9056486..9056747) FT /note="similar to Homo sapiens EST T04942 (NID:g316100)" FT misc_feature complement(9056213..9056541) FT /note="similar to Homo sapiens EST M78436 (NID:g272752)" FT misc_feature complement(9056043..9056367) FT /note="similar to Homo sapiens EST AA829696 (NID:g2902795) FT od97h05.s1" FT repeat_region complement(9055979..9056239) FT /rpt_family="L2" FT misc_feature complement(9056076..9056080) FT /note="match to EST BF880725 (NID:g12270851)" FT repeat_region complement(9055637..9055930) FT /rpt_family="Alu" FT misc_feature complement(9055714..9055718) FT /note="similar to Homo sapiens EST M78624 (NID:g272940)" FT repeat_region complement(9055522..9055579) FT /rpt_family="MIR" FT repeat_region complement(9055379..9055480) FT /rpt_family="L2" FT repeat_region complement(9055086..9055378) FT /rpt_family="Alu" FT repeat_region complement(9054936..9055085) FT /rpt_family="L2" FT repeat_region complement(9054740..9054935) FT /rpt_family="L1" FT repeat_region complement(9054556..9054728) FT /rpt_family="Alu" FT misc_feature complement(9054561..9054702) FT /note="similar to Homo sapiens EST BF844506 FT (NID:g12200177)" FT repeat_region complement(9054180..9054555) FT /rpt_family="L1" FT misc_feature complement(9053880..9054197) FT /note="similar to Homo sapiens EST BF737475 FT (NID:g12064151)" FT repeat_region complement(9053780..9054010) FT /rpt_family="MER1_type" FT misc_feature complement(9053539..9053777) FT /note="similar to Homo sapiens EST AI168014 (NID:g3701184) FT oz92e03.x1" FT /note="similar to Homo sapiens EST AL527579 FT (NID:g12791072)" FT misc_feature complement(9053536..9053777) FT /note="similar to Homo sapiens EST AA782385 (NID:g2841716) FT ac24h09.s1" FT /note="similar to Homo sapiens EST BG389835 FT (NID:g13283271)" FT misc_feature complement(9053539..9053735) FT /note="similar to Homo sapiens EST BG826415 FT (NID:g14174002)" FT repeat_region complement(9053480..9053540) FT /rpt_family="T-rich" FT repeat_region complement(9053198..9053512) FT /rpt_family="Alu" FT misc_feature complement(9053415..9053420) FT /note="match to EST BE838721 (NID:g10271099)" FT misc_feature complement(9053314..9053336) FT /note="similar to Homo sapiens EST R70486 (NID:g844003) FT yi41d08.s1" FT misc_feature complement(9052887..9053302) FT /note="similar to Homo sapiens EST BF844506 FT (NID:g12200177)" FT misc_feature complement(9053065..9053232) FT /note="similar to Homo sapiens EST BG703374 FT (NID:g13975641)" FT misc_feature complement(9052987..9053225) FT /note="match to EST AA628209 (NID:g2540596) af96g01.s1" FT misc_feature complement(9052979..9053187) FT /note="similar to Homo sapiens EST BG826415 FT (NID:g14174002)" FT misc_feature complement(9052982..9053187) FT /note="similar to Homo sapiens EST AI168014 (NID:g3701184) FT oz92e03.x1" FT misc_feature complement(9052999..9053187) FT /note="similar to Homo sapiens EST AL527579 FT (NID:g12791072)" FT misc_feature complement(9052758..9053172) FT /note="similar to Homo sapiens EST AW851075 (NID:g7946592)" FT misc_feature complement(9052397..9053031) FT /note="match to EST AW752830 (NID:g7667762)" FT misc_feature complement(9052735) FT /note="match to EST W84503 (NID:g1395923) zh53a03.r1" FT misc_feature complement(9052250..9052685) FT /note="match to EST W84503 (NID:g1395923) zh53a03.r1" FT misc_feature complement(9052081..9052523) FT /note="match to EST BE838721 (NID:g10271099)" FT misc_feature complement(9051600..9052350) FT /note="match to EST BG546518 (NID:g13545183)" FT repeat_region complement(9051846..9052242) FT /rpt_family="MaLR" FT misc_feature complement(9051597..9051836) FT /note="similar to Homo sapiens EST BF364271 FT (NID:g11326296)" FT repeat_region complement(9051373..9051667) FT /rpt_family="Alu" FT misc_feature 9051588..9051589 FT /note="match to EST BG546518 (NID:g13545183)" FT misc_feature complement(9050827..9051305) FT /note="similar to Homo sapiens EST BF058195 FT (NID:g10812091)" FT repeat_region complement(9051041..9051254) FT /rpt_family="MER1_type" FT misc_feature complement(9050817..9051071) FT /note="similar to Homo sapiens EST BI041098 FT (NID:g14447724)" FT misc_feature complement(9050673..9051049) FT /note="similar to Homo sapiens EST H93525 (NID:g1099853) FT yv08e12.r1" FT misc_feature complement(9050525..9050795) FT /note="similar to Homo sapiens EST BI041098 FT (NID:g14447724)" FT repeat_region complement(9050119..9050412) FT /rpt_family="Alu" FT misc_feature complement(9050365..9050369) FT /note="similar to Homo sapiens EST BF058195 FT (NID:g10812091)" FT repeat_region complement(9049117..9049137) FT /rpt_family="AT_rich" FT repeat_region complement(9048912..9049062) FT /rpt_family="Alu" FT repeat_region complement(9048290..9048647) FT /rpt_family="MaLR" FT misc_feature complement(9048351..9048364) FT /note="similar to Homo sapiens EST T79422 (NID:g697931) FT yd75c02.s1" FT repeat_region complement(9046335..9046688) FT /rpt_family="MaLR" FT repeat_region complement(9045647..9045669) FT /rpt_family="AT_rich" FT misc_feature complement(9045159..9045182) FT /note="similar to Homo sapiens EST AL527579 FT (NID:g12791072)" FT repeat_region complement(9045155..9045180) FT /rpt_family="(A)n" FT repeat_region complement(9043849..9044145) FT /rpt_family="Alu" FT repeat_region complement(9043837..9043868) FT /rpt_family="AT_rich" FT repeat_region complement(9043646..9043668) FT /rpt_family="(A)n" FT repeat_region complement(9043047..9043348) FT /rpt_family="Alu" FT repeat_region complement(9043212..9043232) FT /rpt_family="AT_rich" FT repeat_region complement(9042307..9043044) FT /rpt_family="(TA)n" FT repeat_region complement(9041862..9042310) FT /rpt_family="L1" FT repeat_region complement(9041617..9041861) FT /rpt_family="L1" FT repeat_region complement(9041049..9041627) FT /rpt_family="L1" FT repeat_region complement(9040781..9040957) FT /rpt_family="L1" FT repeat_region complement(9040116..9040778) FT /rpt_family="L1" FT repeat_region complement(9040089..9040125) FT /rpt_family="(TTTTG)n" FT repeat_region complement(9039808..9040115) FT /rpt_family="Alu" FT misc_feature complement(9040090..9040107) FT /note="similar to Homo sapiens EST BG677857 FT (NID:g13909254)" FT misc_feature complement(9039957..9040037) FT /note="similar to Homo sapiens EST AL527293 FT (NID:g12790786)" FT repeat_region complement(9038657..9039807) FT /rpt_family="L1" FT repeat_region complement(9038475..9038653) FT /rpt_family="L1" FT misc_feature complement(9038044..9038605) FT /note="match to EST AI632006 (NID:g4683336) wa38f12.x1" FT misc_feature complement(9038094..9038472) FT /note="match to EST BG997292 (NID:g14401362)" FT misc_feature complement(9038083..9038385) FT /note="match to EST AA961625 (NID:g3133789) op44g07.s1" FT misc_feature complement(9038082..9038234) FT /note="match to EST AI680786 (NID:g4890968) tx34g11.x1" FT repeat_region complement(9037616..9038072) FT /rpt_family="ERVK" FT repeat_region complement(9037500..9037598) FT /rpt_family="GA-rich" FT repeat_region complement(9037180..9037363) FT /rpt_family="ERVK" FT repeat_region complement(9036143..9037177) FT /rpt_family="ERVK" FT misc_feature complement(9037085..9037090) FT /note="similar to Homo sapiens EST AI375817 (NID:g4175807) FT qz93g01.x1" FT misc_feature complement(9036148..9036444) FT /note="similar to Homo sapiens EST AV730059 FT (NID:g10839480)" FT misc_feature complement(9036364..9036366) FT /note="match to EST AA961625 (NID:g3133789) op44g07.s1" FT misc_feature complement(9035428..9036121) FT /note="match to EST BE699267 (NID:g10087009)" FT misc_feature complement(9035742..9036111) FT /note="match to EST AA373019 (NID:g2025561)" FT misc_feature complement(9035768..9036084) FT /note="match to EST AI244432 (NID:g3839829) qj87b11.x1" FT misc_feature complement(9035926..9035931) FT /note="similar to Homo sapiens EST BF887966 FT (NID:g12279212)" FT misc_feature complement(9035496..9035902) FT /note="similar to Homo sapiens EST BG951938 FT (NID:g14370109)" FT misc_feature complement(9035679..9035879) FT /note="match to EST T84729 (NID:g713081) yd54b06.r1" FT misc_feature complement(9035490..9035821) FT /note="similar to Homo sapiens EST T79508 (NID:g698017) FT yd75c02.r1" FT misc_feature complement(9035097..9035747) FT /note="match to EST AA218967 (NID:g1833050) zr01c05.s1" FT misc_feature complement(9035100..9035580) FT /note="similar to Homo sapiens EST T79422 (NID:g697931) FT yd75c02.s1" FT misc_feature complement(9035120..9035538) FT /note="match to EST T91861 (NID:g723774) yd54b06.s1" FT misc_feature complement(9034961..9035476) FT /note="similar to Homo sapiens EST AV745437 FT (NID:g10864884)" FT repeat_region complement(9035205..9035262) FT /rpt_family="L2" FT misc_feature complement(9034935) FT /note="similar to Homo sapiens EST BE500996 (NID:g9703404)" FT misc_feature complement(9034682..9034861) FT /note="similar to Homo sapiens EST AI872126 (NID:g5546175) FT wm55f02.x1" FT misc_feature complement(9034682..9034860) FT /note="similar to Homo sapiens EST BG216262 FT (NID:g13742283)" FT misc_feature complement(9034680..9034860) FT /note="match to EST BF057812 (NID:g10811708)" FT misc_feature complement(9034682..9034855) FT /note="similar to Homo sapiens EST BG198276 FT (NID:g13719963)" FT misc_feature complement(9034687..9034853) FT /note="similar to Homo sapiens EST AI982519 (NID:g5809738) FT wu04b10.x1" FT misc_feature complement(9034385..9034853) FT /note="similar to Homo sapiens EST BE500996 (NID:g9703404)" FT misc_feature complement(9034626..9034781) FT /note="similar to Homo sapiens EST D38676 (NID:g807738)" FT misc_feature complement(9034110..9034528) FT /note="similar to Homo sapiens EST AI033879 (NID:g3254832) FT ow10f10.x1" FT misc_feature complement(9033966..9034413) FT /note="match to EST AI082424 (NID:g3419216) ox73a12.x1" FT repeat_region complement(9034231..9034313) FT /rpt_family="MIR" FT repeat_region complement(9033997..9034212) FT /rpt_family="L1" FT repeat_region complement(9033555..9034001) FT /rpt_family="L1" FT misc_feature complement(9033827..9033832) FT /note="similar to Homo sapiens EST AW276753 (NID:g6663783) FT xp65d11.x1" FT misc_feature complement(9033674..9033675) FT /note="similar to Homo sapiens EST BE073040 (NID:g8419645)" FT repeat_region complement(9033423..9033554) FT /rpt_family="MIR" FT repeat_region complement(9033246..9033311) FT /rpt_family="MER1_type" FT repeat_region complement(9033192..9033255) FT /rpt_family="(TG)n" FT repeat_region complement(9033033..9033183) FT /rpt_family="Alu" FT repeat_region complement(9032862..9033031) FT /rpt_family="Alu" FT misc_feature complement(9032587..9033019) FT /note="match to EST AA157798 (NID:g1732609) zo35b08.s1" FT misc_feature complement(9032420..9032839) FT /note="similar to Homo sapiens EST BG765782 FT (NID:g14076435)" FT misc_feature complement(9032206..9032839) FT /note="similar to Homo sapiens EST BF343849 FT (NID:g11291048)" FT misc_feature complement(9032415..9032835) FT /note="similar to Homo sapiens EST AA182827 (NID:g1766544) FT zp59f10.s1" FT misc_feature complement(9032295..9032835) FT /note="similar to Homo sapiens EST AA074865 (NID:g1614752) FT zm85d08.s1" FT misc_feature complement(9032619..9032835) FT /note="similar to Homo sapiens EST BG677857 FT (NID:g13909254)" FT misc_feature complement(9032215..9032835) FT /note="similar to Homo sapiens EST AW411316 (NID:g6936857) FT fh11f02.y1" FT misc_feature complement(9032419..9032833) FT /note="similar to Homo sapiens EST T59119 (NID:g660956) FT yb49f11.r1" FT misc_feature complement(9032005..9032827) FT /note="similar to Homo sapiens EST BG821677 FT (NID:g14169264)" FT misc_feature complement(9032515..9032827) FT /note="similar to Homo sapiens EST AV744356 FT (NID:g10861937)" FT misc_feature complement(9032110..9032827) FT /note="similar to Homo sapiens EST BE965108 FT (NID:g11769137)" FT misc_feature complement(9032094..9032827) FT /note="similar to Homo sapiens EST AA658816 (NID:g2594970) FT nt78e06.s1" FT misc_feature complement(9031988..9032809) FT /note="similar to Homo sapiens EST BG758630 FT (NID:g14069283)" FT misc_feature complement(9031997..9032808) FT /note="similar to Homo sapiens EST BG774123 FT (NID:g14044422)" FT misc_feature complement(9032366..9032808) FT /note="similar to Homo sapiens EST BG394945 FT (NID:g13288393)" FT misc_feature complement(9032486..9032808) FT /note="similar to Homo sapiens EST R70486 (NID:g844003) FT yi41d08.s1" FT misc_feature complement(9032487..9032808) FT /note="similar to Homo sapiens EST T57648 (NID:g659509) FT yb59f07.s1" FT misc_feature complement(9032063..9032808) FT /note="similar to Homo sapiens EST BI087076 FT (NID:g14505406)" FT misc_feature complement(9032130..9032808) FT /note="similar to Homo sapiens EST BF183347 FT (NID:g11061583)" FT misc_feature complement(9032772..9032803) FT /note="similar to Homo sapiens EST BG337758 FT (NID:g13144196)" FT misc_feature complement(9031999..9032803) FT /note="similar to Homo sapiens EST BI114062 FT (NID:g14564963)" FT misc_feature complement(9032773..9032803) FT /note="similar to Homo sapiens EST BG478922 FT (NID:g13411201)" FT misc_feature complement(9032063..9032803) FT /note="similar to Homo sapiens EST BE617843 (NID:g9888781)" FT misc_feature complement(9032005..9032802) FT /note="similar to Homo sapiens EST BI198864 FT (NID:g14653885)" FT misc_feature complement(9032615..9032800) FT /note="similar to Homo sapiens EST BG754075 FT (NID:g14064728)" FT misc_feature complement(9032156..9032787) FT /note="similar to Homo sapiens EST BF693892 FT (NID:g11979300)" FT misc_feature complement(9032354..9032782) FT /note="similar to Homo sapiens EST AW820403 (NID:g7913397)" FT misc_feature complement(9031999..9032772) FT /note="similar to Homo sapiens EST BG774145 FT (NID:g14044444)" FT misc_feature complement(9032005..9032765) FT /note="similar to Homo sapiens EST BG470303 FT (NID:g13402578)" FT misc_feature complement(9032071..9032745) FT /note="similar to Homo sapiens EST BI085032 FT (NID:g14503362)" FT misc_feature complement(9032366..9032712) FT /note="similar to Homo sapiens EST AA468192 (NID:g2194726) FT nc73h12.r1" FT misc_feature complement(9032042..9032677) FT /note="similar to Homo sapiens EST BG829826 FT (NID:g14177413)" FT misc_feature complement(9032201..9032677) FT /note="similar to Homo sapiens EST BG898712 FT (NID:g14308961)" FT misc_feature complement(9032424..9032677) FT /note="similar to Homo sapiens EST AA354349 (NID:g2006720)" FT misc_feature complement(9032063..9032677) FT /note="similar to Homo sapiens EST BE293407 (NID:g9176584)" FT misc_feature complement(9032243..9032677) FT /note="similar to Homo sapiens EST BF089054 FT (NID:g10894764)" FT misc_feature complement(9032365..9032667) FT /note="similar to Homo sapiens EST BG823830 FT (NID:g14171417)" FT misc_feature complement(9032069..9032667) FT /note="similar to Homo sapiens EST BE393863 (NID:g9339228)" FT misc_feature complement(9032005..9032666) FT /note="similar to Homo sapiens EST BG828822 FT (NID:g14176421)" FT /note="similar to Homo sapiens EST BG337758 FT (NID:g13144196)" FT misc_feature complement(9032063..9032666) FT /note="similar to Homo sapiens EST BG471798 FT (NID:g13404073)" FT misc_feature complement(9032056..9032659) FT /note="similar to Homo sapiens EST BF315120 FT (NID:g11263330)" FT misc_feature complement(9032097..9032659) FT /note="similar to Homo sapiens EST BG756331 FT (NID:g14066984)" FT misc_feature complement(9032063..9032659) FT /note="similar to Homo sapiens EST BF027337 FT (NID:g10735049)" FT misc_feature complement(9032005..9032659) FT /note="similar to Homo sapiens EST BG775017 FT (NID:g14045334)" FT misc_feature complement(9032042..9032657) FT /note="similar to Homo sapiens EST BF976450 FT (NID:g12343575)" FT misc_feature complement(9032005..9032656) FT /note="similar to Homo sapiens EST BG395053 FT (NID:g13288501)" FT misc_feature complement(9032269..9032642) FT /note="similar to Homo sapiens EST AA079341 (NID:g1618252) FT zm95b11.r1" FT misc_feature complement(9032066..9032633) FT /note="similar to Homo sapiens EST BE019754 (NID:g8279839) FT bb58h04.y1" FT misc_feature complement(9032233..9032630) FT /note="similar to Homo sapiens EST BE409824 (NID:g9346274)" FT misc_feature complement(9032097..9032620) FT /note="similar to Homo sapiens EST BF663644 FT (NID:g11937539)" FT misc_feature complement(9032005..9032619) FT /note="similar to Homo sapiens EST BG163716 FT (NID:g12670419)" FT misc_feature complement(9032000..9032597) FT /note="similar to Homo sapiens EST AW245913 (NID:g6588906)" FT misc_feature complement(9032560..9032597) FT /note="similar to Homo sapiens EST AW276753 (NID:g6663783) FT xp65d11.x1" FT misc_feature complement(9032005..9032596) FT /note="similar to Homo sapiens EST BG481951 FT (NID:g13414230)" FT misc_feature complement(9032321..9032576) FT /note="similar to Homo sapiens EST BF155676 FT (NID:g11050859)" FT misc_feature complement(9032078..9032564) FT /note="similar to Homo sapiens EST BI252783 FT (NID:g14803580)" FT misc_feature complement(9032225..9032558) FT /note="similar to Homo sapiens EST BG478922 FT (NID:g13411201)" FT misc_feature complement(9032535..9032536) FT /note="similar to Homo sapiens EST T64534 (NID:g673579) FT yc24h09.r1" FT misc_feature complement(9032042..9032470) FT /note="similar to Homo sapiens EST BE073040 (NID:g8419645)" FT misc_feature complement(9032333..9032433) FT /note="similar to Homo sapiens EST AL527293 FT (NID:g12790786)" FT misc_feature complement(9032102..9032423) FT /note="similar to Homo sapiens EST AA533662 (NID:g2277678) FT nj96e05.s1" FT misc_feature complement(9032233..9032423) FT /note="similar to Homo sapiens EST BI050365 FT (NID:g14457895)" FT misc_feature complement(9032005..9032421) FT /note="similar to Homo sapiens EST AA176316 (NID:g1757455) FT zp08c08.r1" FT misc_feature complement(9031997..9032416) FT /note="similar to Homo sapiens EST BG686544 FT (NID:g13917941)" FT misc_feature complement(9032075..9032405) FT /note="similar to Homo sapiens EST BE741641 FT (NID:g10155633)" FT misc_feature complement(9032005..9032395) FT /note="similar to Homo sapiens EST AA306806 (NID:g1959155)" FT misc_feature complement(9032211..9032382) FT /note="similar to Homo sapiens EST T64534 (NID:g673579) FT yc24h09.r1" FT misc_feature complement(9032063..9032369) FT /note="similar to Homo sapiens EST AW276753 (NID:g6663783) FT xp65d11.x1" FT misc_feature complement(9032096..9032288) FT /note="similar to Homo sapiens EST BI114826 FT (NID:g14565727)" FT misc_feature complement(9031937..9032244) FT /note="similar to Homo sapiens EST T81522 (NID:g704529) FT yd27c08.r1" FT misc_feature complement(9032067..9032222) FT /note="similar to Homo sapiens EST BG471177 FT (NID:g13403452)" FT misc_feature complement(9032005..9032187) FT /note="similar to Homo sapiens EST AA380992 (NID:g2033311)" FT misc_feature complement(9031997..9032095) FT /note="similar to Homo sapiens EST BG754075 FT (NID:g14064728)" FT misc_feature complement(9031993..9032074) FT /note="similar to Homo sapiens EST AA468192 (NID:g2194726) FT nc73h12.r1" FT misc_feature complement(9032005..9032074) FT /note="similar to Homo sapiens EST BG394945 FT (NID:g13288393)" FT repeat_region complement(9031936..9031989) FT /rpt_family="Alu" FT misc_feature complement(9031988) FT /note="similar to Homo sapiens EST AA306806 (NID:g1959155)" FT misc_feature complement(9031951) FT /note="similar to Homo sapiens EST BG758630 FT (NID:g14069283)" FT /note="similar to Homo sapiens EST BG394945 FT (NID:g13288393)" FT repeat_region complement(9031711..9031935) FT /rpt_family="Alu" FT repeat_region complement(9031217..9031637) FT /rpt_family="L1" FT misc_feature complement(9031542..9031543) FT /note="similar to Homo sapiens EST AA533662 (NID:g2277678) FT nj96e05.s1" FT repeat_region complement(9031053..9031207) FT /rpt_family="L1" FT misc_feature complement(9031151) FT /note="similar to Homo sapiens EST BG216262 FT (NID:g13742283)" FT repeat_region complement(9030747..9031052) FT /rpt_family="Alu" FT misc_feature complement(9030373..9030882) FT /note="similar to Homo sapiens EST BG913590 FT (NID:g14294066)" FT repeat_region complement(9030586..9030746) FT /rpt_family="L1" FT misc_feature complement(9030068..9030494) FT /note="similar to Homo sapiens EST AW842794 (NID:g7936777)" FT misc_feature complement(9030029..9030266) FT /note="similar to Homo sapiens EST BF887966 FT (NID:g12279212)" FT repeat_region complement(9029654..9029940) FT /rpt_family="Alu" FT misc_feature complement(9029416..9029663) FT /note="match to EST BE165935 (NID:g8628656)" FT repeat_region complement(9029579..9029648) FT /rpt_family="L2" FT repeat_region complement(9029152..9029443) FT /rpt_family="Alu" FT misc_feature complement(9028827..9029121) FT /note="match to EST BE091782 (NID:g8482234)" FT repeat_region complement(9028713..9028800) FT /rpt_family="L1" FT repeat_region complement(9028393..9028712) FT /rpt_family="Alu" FT repeat_region complement(9028392..9028418) FT /rpt_family="(CAA)n" FT repeat_region complement(9028245..9028392) FT /rpt_family="L1" FT repeat_region complement(9028024..9028244) FT /rpt_family="MER1_type" FT misc_feature complement(9027478..9028031) FT /note="similar to Homo sapiens EST AA878324 (NID:g2987289) FT oe61h03.s1" FT repeat_region complement(9027969..9028023) FT /rpt_family="L1" FT misc_feature complement(9027615..9027891) FT /note="match to EST AI619686 (NID:g4628812) ty51g08.x1" FT misc_feature complement(9027341..9027890) FT /note="similar to Homo sapiens EST AA570406 (NID:g2344386) FT nk62h04.s1" FT misc_feature complement(9026876..9027277) FT /note="similar to Homo sapiens EST BG622650 FT (NID:g13674021)" FT misc_feature complement(9026928..9027151) FT /note="similar to Homo sapiens EST BE007076 (NID:g8267309)" FT repeat_region complement(9026533..9026831) FT /rpt_family="MaLR" FT misc_feature complement(9026222..9026604) FT /note="similar to Homo sapiens EST AA487120 (NID:g2217284) FT ab19a07.s1" FT misc_feature complement(9025814..9026344) FT /note="match to EST BF959932 (NID:g12377207)" FT misc_feature complement(9025823..9026300) FT /note="similar to Homo sapiens EST BF841280 FT (NID:g12193984)" FT misc_feature complement(9026053..9026266) FT /note="match to EST BF362051 (NID:g11324076)" FT misc_feature complement(9025826..9026128) FT /note="match to EST BF365738 (NID:g11327763)" FT misc_feature complement(9025826..9026099) FT /note="similar to Homo sapiens EST AW890858 (NID:g8055063)" FT misc_feature complement(9025801..9025968) FT /note="similar to Homo sapiens EST BG622650 FT (NID:g13674021)" FT misc_feature complement(9025616..9025935) FT /note="similar to Homo sapiens EST AA574129 (NID:g2348644) FT ng51f03.s1" FT misc_feature complement(9025607..9025887) FT /note="similar to Homo sapiens EST BF332583 FT (NID:g11303331)" FT misc_feature complement(9024998..9025333) FT /note="similar to Homo sapiens EST AW884489 (NID:g8046501)" FT repeat_region complement(9025102..9025180) FT /rpt_family="Mariner" FT misc_feature complement(9025054..9025055) FT /note="match to EST AA078502 (NID:g1837976)" FT misc_feature complement(9024752..9025043) FT /note="match to EST AA078502 (NID:g1837976)" FT misc_feature complement(9024326..9024843) FT /note="similar to Homo sapiens EST AV747066 FT (NID:g10904914)" FT misc_feature complement(9024587..9024787) FT /note="similar to Homo sapiens EST AW843892 (NID:g7937784)" FT misc_feature complement(9023904..9024709) FT /note="match to EST BG541660 (NID:g13533893)" FT misc_feature complement(9024611) FT /note="match to EST AA078502 (NID:g1837976)" FT repeat_region complement(9024073..9024531) FT /rpt_family="ERVL" FT repeat_region complement(9024460..9024512) FT /rpt_family="(CAGAGA)n" FT repeat_region complement(9023976..9024057) FT /rpt_family="L2" FT misc_feature complement(9023657..9023981) FT /note="similar to Homo sapiens EST AW905597 (NID:g8069802)" FT misc_feature complement(9023656..9023952) FT /note="similar to Homo sapiens EST AW905600 (NID:g8069805)" FT misc_feature complement(9023746..9023901) FT /note="match to EST BG460324 (NID:g13748958)" FT misc_feature complement(9023882..9023884) FT /note="similar to Homo sapiens EST BI114062 FT (NID:g14564963)" FT /note="similar to Homo sapiens EST BG774145 FT (NID:g14044444)" FT repeat_region complement(9023764..9023813) FT /rpt_family="L1" FT repeat_region complement(9023391..9023689) FT /rpt_family="Alu" FT repeat_region complement(9023390..9023416) FT /rpt_family="(GAAA)n" FT misc_feature complement(9022702..9023378) FT /note="similar to Homo sapiens EST AV745186 FT (NID:g10864596)" FT repeat_region complement(9022938..9023365) FT /rpt_family="L1" FT misc_feature complement(9022674..9023035) FT /note="match to EST AI690353 (NID:g4901645) tx14e06.x1" FT misc_feature complement(9022707..9022909) FT /note="similar to Homo sapiens EST AL527293 FT (NID:g12790786)" FT misc_feature complement(9022851..9022894) FT /note="similar to Homo sapiens EST BF155676 FT (NID:g11050859)" FT misc_feature complement(9022761..9022878) FT /note="similar to Homo sapiens EST AV691969 FT (NID:g10293832)" FT misc_feature complement(9022707..9022870) FT /note="similar to Homo sapiens EST BF857094 FT (NID:g12244838)" FT misc_feature complement(9022307..9022785) FT /note="match to EST AI859679 (NID:g5513295) wm19b05.x1" FT misc_feature complement(9022301..9022615) FT /note="similar to Homo sapiens EST AI345382 (NID:g4082588) FT tb68h08.x1" FT repeat_region complement(9022120..9022453) FT /rpt_family="L1" FT misc_feature complement(9022046..9022090) FT /note="similar to Homo sapiens EST AV691969 FT (NID:g10293832)" FT repeat_region complement(9021784..9022047) FT /rpt_family="Alu" FT misc_feature complement(9021809..9022041) FT /note="similar to Homo sapiens EST AL527293 FT (NID:g12790786)" FT misc_feature complement(9021881..9022041) FT /note="similar to Homo sapiens EST BF857094 FT (NID:g12244838)" FT misc_feature complement(9021475..9021691) FT /note="similar to Homo sapiens EST D38702 (NID:g807809)" FT /note="match to EST BG460324 (NID:g13748958)" FT /note="similar to Homo sapiens EST AI872126 (NID:g5546175) FT wm55f02.x1" FT misc_feature complement(9021474..9021691) FT /note="similar to Homo sapiens EST BG198276 FT (NID:g13719963)" FT misc_feature complement(9021516..9021612) FT /note="similar to Homo sapiens EST BF213358 FT (NID:g11106944)" FT misc_feature complement(9021529..9021576) FT /note="similar to Homo sapiens EST BG911930 FT (NID:g14292406)" FT misc_feature complement(9021245..9021415) FT /note="similar to Homo sapiens EST AV730059 FT (NID:g10839480)" FT misc_feature complement(9021180..9021196) FT /note="match to EST AL042377 (NID:g5421715)" FT repeat_region complement(9020896..9021195) FT /rpt_family="Alu" FT misc_feature complement(9021138..9021187) FT /note="similar to Homo sapiens EST AV730059 FT (NID:g10839480)" FT misc_feature complement(9021152) FT /note="similar to Homo sapiens EST BG430981 FT (NID:g13337487)" FT misc_feature complement(9021070..9021097) FT /note="similar to Homo sapiens EST BG430981 FT (NID:g13337487)" FT misc_feature complement(9020471..9020924) FT /note="similar to Homo sapiens EST AW962166 (NID:g8151931)" FT repeat_region complement(9020442..9020756) FT /rpt_family="L1" FT repeat_region complement(9020444..9020474) FT /rpt_family="AT_rich" FT repeat_region complement(9020140..9020439) FT /rpt_family="Alu" FT misc_feature complement(9019636..9020306) FT /note="similar to Homo sapiens EST BG430981 FT (NID:g13337487)" FT misc_feature complement(9020200..9020202) FT /note="similar to Homo sapiens EST BF857094 FT (NID:g12244838)" FT misc_feature complement(9019470..9020128) FT /note="similar to Homo sapiens EST BF951176 FT (NID:g12368451)" FT misc_feature complement(9019671..9019909) FT /note="similar to Rattus sp. EST AA856200 (NID:g2944513)" FT misc_feature complement(9019376..9019891) FT /note="similar to Homo sapiens EST BG005340 FT (NID:g12447404)" FT misc_feature complement(9019278..9019833) FT /note="similar to Homo sapiens EST BF958393 FT (NID:g12375668)" FT repeat_region complement(9019584..9019697) FT /rpt_family="MIR" FT misc_feature complement(9019239..9019563) FT /note="similar to Homo sapiens EST AA320696 (NID:g1973075)" FT misc_feature complement(9019246..9019551) FT /note="similar to Homo sapiens EST AW752565 (NID:g7667497)" FT misc_feature complement(9019235..9019337) FT /note="similar to Homo sapiens EST AA309262 (NID:g1961834)" FT repeat_region complement(9019200..9019233) FT /rpt_family="(T)n" FT repeat_region complement(9018920..9019229) FT /rpt_family="Alu" FT misc_feature complement(9018874..9019218) FT /note="similar to Homo sapiens EST AA309262 (NID:g1961834)" FT misc_feature complement(9019186..9019190) FT /note="match to EST BF959932 (NID:g12377207)" FT misc_feature complement(9018699..9019155) FT /note="similar to Homo sapiens EST AA555329 (NID:g2325868) FT nk79h06.s1" FT misc_feature complement(9018474..9018900) FT /note="match to EST W57901 (NID:g1364615) zd17e11.s1" FT misc_feature complement(9018398..9018844) FT /note="similar to Homo sapiens EST W57900 (NID:g1364614) FT zd17e11.r1" FT misc_feature complement(9018789..9018790) FT /note="similar to Homo sapiens EST AW104947 (NID:g6075682) FT xd73b08.x1" FT misc_feature complement(9018705..9018790) FT /note="similar to Homo sapiens EST BG198276 FT (NID:g13719963)" FT misc_feature complement(9018699..9018788) FT /note="match to EST BG460324 (NID:g13748958)" FT misc_feature complement(9018698..9018775) FT /note="similar to Homo sapiens EST BF213358 FT (NID:g11106944)" FT misc_feature complement(9018277..9018707) FT /note="similar to Homo sapiens EST AW104947 (NID:g6075682) FT xd73b08.x1" FT misc_feature complement(9018278..9018623) FT /note="similar to Homo sapiens EST AI028427 (NID:g3245736) FT ow43h01.x1" FT misc_feature complement(9018275..9018579) FT /note="similar to Homo sapiens EST AI375817 (NID:g4175807) FT qz93g01.x1" FT repeat_region complement(9018385..9018502) FT /rpt_family="L2" FT misc_feature complement(9018392) FT /note="similar to Homo sapiens EST W57900 (NID:g1364614) FT zd17e11.r1" FT misc_feature complement(9018363..9018366) FT /note="similar to Homo sapiens EST AA176316 (NID:g1757455) FT zp08c08.r1" FT repeat_region complement(9018073..9018287) FT /rpt_family="MIR" FT misc_feature complement(9018118..9018119) FT /note="similar to Homo sapiens EST AA309262 (NID:g1961834)" FT repeat_region complement(9018014..9018090) FT /rpt_family="L2" FT repeat_region complement(9017763..9017999) FT /rpt_family="(TGGA)n" FT misc_feature complement(9017699..9017731) FT /note="similar to Homo sapiens EST BI000941 FT (NID:g14405015)" FT repeat_region complement(9017554..9017713) FT /rpt_family="(TGGA)n" FT misc_feature complement(9017087..9017662) FT /note="similar to Homo sapiens EST BI000941 FT (NID:g14405015)" FT misc_feature complement(9017021..9017290) FT /note="match to EST BF849881 (NID:g12237031)" FT misc_feature complement(9017189..9017192) FT /note="similar to Homo sapiens EST BI038453 FT (NID:g14445079)" FT repeat_region complement(9016401..9016526) FT /rpt_family="MIR" FT misc_feature complement(9016468..9016472) FT /note="similar to Homo sapiens EST BI006132 FT (NID:g14410203)" FT repeat_region complement(9015995..9016395) FT /rpt_family="L2" FT misc_feature complement(9015575..9015905) FT /note="similar to Homo sapiens EST AW816085 (NID:g7909079)" FT repeat_region complement(9015394..9015705) FT /rpt_family="Alu" FT misc_feature complement(9015536..9015539) FT /note="similar to Homo sapiens EST BF347630 FT (NID:g11295225)" FT repeat_region complement(9015278..9015351) FT /rpt_family="CR1" FT misc_feature complement(9014536..9015039) FT /note="match to EST AA601245 (NID:g2434870) no14g08.s1" FT repeat_region complement(9014532..9014712) FT /rpt_family="MER53" FT misc_feature complement(9014336..9014337) FT /note="match to EST BF927627 (NID:g12325755)" FT misc_feature complement(9013960..9014192) FT /note="match to EST BF927627 (NID:g12325755)" FT misc_feature complement(9013716..9014170) FT /note="similar to Homo sapiens EST BG959746 FT (NID:g14377917)" FT misc_feature complement(9013428..9014135) FT /note="similar to Homo sapiens EST AW753558 (NID:g7668490)" FT repeat_region complement(9013835..9013931) FT /rpt_family="MIR" FT misc_feature complement(9013464..9013816) FT /note="match to EST BG959979 (NID:g14378150)" FT misc_feature complement(9013240..9013794) FT /note="similar to Homo sapiens EST AA668922 (NID:g2630421) FT ab88c10.s1" FT repeat_region complement(9013160..9013522) FT /rpt_family="L1" FT repeat_region complement(9012869..9013152) FT /rpt_family="L1" FT repeat_region complement(9012718..9012754) FT /rpt_family="(T)n" FT repeat_region complement(9012645..9012747) FT /rpt_family="Alu" FT misc_feature complement(9012196..9012669) FT /note="similar to Homo sapiens EST BF905948 FT (NID:g12297407)" FT misc_feature complement(9012552..9012554) FT /note="match to EST AA632713 (NID:g2556127) np83c08.s1" FT misc_feature complement(9012128..9012534) FT /note="match to EST AA632713 (NID:g2556127) np83c08.s1" FT repeat_region complement(9012278..9012494) FT /rpt_family="Alu" FT repeat_region complement(9011353..9011654) FT /rpt_family="Alu" FT repeat_region complement(9011630..9011653) FT /rpt_family="(TTTTA)n" FT misc_feature complement(9010816..9011290) FT /note="similar to Homo sapiens EST AA581919 (NID:g2360597) FT nn32c10.s1" FT misc_feature complement(9011199..9011202) FT /note="match to EST AA013478 (NID:g1474524) ze29c04.s1" FT misc_feature complement(9010803..9011105) FT /note="similar to Homo sapiens EST H81613 (NID:g1059702) FT ys66c10.r1" FT misc_feature complement(9010398..9010588) FT /note="match to EST BF057812 (NID:g10811708)" FT repeat_region complement(9010262..9010459) FT /rpt_family="MER1_type" FT misc_feature complement(9009974..9010447) FT /note="match to EST AA013478 (NID:g1474524) ze29c04.s1" FT misc_feature complement(9010115) FT /note="match to EST AL138120 (NID:g6854800)" FT misc_feature complement(9009664..9010027) FT /note="match to EST AL138120 (NID:g6854800)" FT repeat_region complement(9009679..9009854) FT /rpt_family="L1" FT misc_feature complement(9009642..9009686) FT /note="similar to Homo sapiens EST BF749088 FT (NID:g12075764)" FT repeat_region complement(9009368..9009678) FT /rpt_family="Alu" FT repeat_region complement(9009366..9009397) FT /rpt_family="(A)n" FT repeat_region complement(9009044..9009367) FT /rpt_family="L1" FT repeat_region complement(9008952..9009008) FT /rpt_family="AT_rich" FT misc_feature complement(9008674..9008980) FT /note="match to EST AL042377 (NID:g5421715)" FT repeat_region complement(9008671..9008973) FT /rpt_family="Alu" FT misc_feature complement(9008823..9008911) FT /note="similar to Homo sapiens EST BE735308 FT (NID:g10149300)" FT misc_feature complement(9008829..9008870) FT /note="similar to Homo sapiens EST BF347630 FT (NID:g11295225)" FT misc_feature complement(9008517..9008678) FT /note="similar to Homo sapiens EST BF749088 FT (NID:g12075764)" FT repeat_region complement(9008439..9008470) FT /rpt_family="AT_rich" FT repeat_region complement(9008229..9008423) FT /rpt_family="Alu" FT misc_feature complement(9007642..9008275) FT /note="similar to Homo sapiens EST BE735308 FT (NID:g10149300)" FT repeat_region complement(9008068..9008228) FT /rpt_family="L2" FT misc_feature complement(9007673..9008201) FT /note="similar to Homo sapiens EST AI939345 (NID:g5678215) FT qb61g05.x5" FT misc_feature complement(9007438..9007834) FT /note="similar to Homo sapiens EST BF958187 FT (NID:g12375462)" FT misc_feature complement(9007296..9007552) FT /note="similar to Homo sapiens EST AW409306 FT (NID:g11999641)" FT misc_feature complement(9006928..9007435) FT /note="similar to Homo sapiens EST BI038453 FT (NID:g14445079)" FT misc_feature complement(9007248..9007359) FT /note="similar to Homo sapiens EST AV659174 (NID:g9880188)" FT misc_feature complement(9007315..9007319) FT /note="similar to Homo sapiens EST BG163716 FT (NID:g12670419)" FT repeat_region complement(9006585..9006888) FT /rpt_family="Alu" FT repeat_region complement(9006583..9006608) FT /rpt_family="AT_rich" FT repeat_region complement(9006398..9006581) FT /rpt_family="MIR" FT misc_feature complement(9006558..9006562) FT /note="similar to Homo sapiens EST BI041098 FT (NID:g14447724)" FT repeat_region complement(9006138..9006368) FT /rpt_family="MER1_type" FT misc_feature complement(9005698..9006356) FT /note="similar to Homo sapiens EST BG699676 FT (NID:g13968229)" FT misc_feature complement(9006080..9006332) FT /note="similar to Homo sapiens EST AV659174 (NID:g9880188)" FT misc_feature complement(9005851..9006031) FT /note="similar to Homo sapiens EST BF527725 FT (NID:g11615088)" FT misc_feature complement(9005691..9006027) FT /note="similar to Homo sapiens EST AV659174 (NID:g9880188)" FT misc_feature complement(9005713..9005981) FT /note="match to EST AA593266 (NID:g2409028) nn08c07.s1" FT misc_feature complement(9005476..9005559) FT /note="similar to Homo sapiens EST BF527725 FT (NID:g11615088)" FT misc_feature complement(9004903..9005490) FT /note="similar to Homo sapiens EST BI030475 FT (NID:g14437105)" FT misc_feature complement(9005226..9005356) FT /note="similar to Homo sapiens EST BF527725 FT (NID:g11615088)" FT repeat_region complement(9004814..9004837) FT /rpt_family="(TCTG)n" FT repeat_region complement(9004523..9004814) FT /rpt_family="Alu" FT misc_feature complement(9003951..9004666) FT /note="similar to Homo sapiens EST AL045661 (NID:g5433779)" FT repeat_region complement(9004642..9004661) FT /rpt_family="(T)n" FT misc_feature complement(9004102..9004563) FT /note="match to EST BF880725 (NID:g12270851)" FT misc_feature complement(9004516..9004519) FT /note="similar to Homo sapiens EST BF882665 FT (NID:g12272791)" FT repeat_region complement(9004191..9004438) FT /rpt_family="MIR" FT misc_feature complement(9003654..9004352) FT /note="similar to Homo sapiens EST AW964144 (NID:g8153980)" FT misc_feature complement(9003821..9004261) FT /note="similar to Homo sapiens EST BF901302 FT (NID:g12292761)" FT misc_feature complement(9003559..9004087) FT /note="similar to Homo sapiens EST AL045660 (NID:g5433778)" FT misc_feature complement(9003630..9004046) FT /note="similar to Homo sapiens EST BF899860 FT (NID:g12291319)" FT misc_feature complement(9003202..9003989) FT /note="similar to Homo sapiens EST BI227093 FT (NID:g14680537)" FT misc_feature complement(9003222..9003897) FT /note="similar to Homo sapiens EST BE397013 (NID:g9342378)" FT misc_feature complement(9003620..9003870) FT /note="similar to Homo sapiens EST AA378448 (NID:g2030767)" FT misc_feature complement(9003111..9003700) FT /note="similar to Homo sapiens EST BF683128 FT (NID:g11968587)" FT misc_feature complement(9003392..9003684) FT /note="similar to Homo sapiens EST AA381124 (NID:g2033494)" FT misc_feature complement(9002832..9003663) FT /note="similar to Homo sapiens EST BG910985 FT (NID:g14291461)" FT misc_feature complement(9002927..9003213) FT /note="similar to Homo sapiens EST Z44520 (NID:g573657)" FT misc_feature complement(9002786..9002813) FT /note="similar to Homo sapiens EST BG910985 FT (NID:g14291461)" FT misc_feature complement(9002544..9002788) FT /note="similar to Homo sapiens EST AI982519 (NID:g5809738) FT wu04b10.x1" FT misc_feature complement(9002549..9002786) FT /note="similar to Homo sapiens EST BF347630 FT (NID:g11295225)" FT misc_feature complement(9002595..9002784) FT /note="match to EST AL042377 (NID:g5421715)" FT misc_feature complement(9002635..9002784) FT /note="similar to Homo sapiens EST BG911930 FT (NID:g14292406)" FT misc_feature complement(9002455..9002784) FT /note="similar to Homo sapiens EST BF213358 FT (NID:g11106944)" FT misc_feature complement(9002723..9002767) FT /note="similar to Homo sapiens EST AI872126 (NID:g5546175) FT wm55f02.x1" FT misc_feature complement(9002031..9002712) FT /note="similar to Homo sapiens EST AL042376 (NID:g5421714)" FT misc_feature complement(9002550..9002610) FT /note="similar to Homo sapiens EST AA057708 (NID:g1550374) FT zl76a10.r1" FT misc_feature complement(9002398) FT /note="similar to Homo sapiens EST BF213358 FT (NID:g11106944)" FT misc_feature complement(9002086..9002153) FT /note="similar to Homo sapiens EST AA057708 (NID:g1550374) FT zl76a10.r1" FT repeat_region complement(9001606..9002048) FT /rpt_family="L2" FT misc_feature complement(9001308..9001777) FT /note="similar to Homo sapiens EST BF955387 FT (NID:g12372662)" FT misc_feature complement(9001355..9001727) FT /note="similar to Homo sapiens EST BF882665 FT (NID:g12272791)" FT repeat_region complement(9001025..9001129) FT /rpt_family="L2" FT repeat_region complement(9000806..9000929) FT /rpt_family="MIR" FT repeat_region complement(9000187..9000789) FT /rpt_family="ERVL" FT repeat_region complement(9000122..9000181) FT /rpt_family="MIR" FT misc_feature complement(8999630..9000001) FT /note="similar to Homo sapiens EST N22819 (NID:g1136969) FT yw41h05.s1" FT repeat_region complement(8999560..8999869) FT /rpt_family="Alu" FT repeat_region complement(8999549..8999588) FT /rpt_family="(CAAA)n" FT repeat_region complement(8999284..8999318) FT /rpt_family="(T)n" FT repeat_region complement(8999004..8999310) FT /rpt_family="Alu" FT misc_feature complement(8999286..8999296) FT /note="similar to Homo sapiens EST BG911468 FT (NID:g14291944)" FT repeat_region complement(8998298..8998356) FT /rpt_family="(CAGAGA)n" FT repeat_region complement(8997990..8998207) FT /rpt_family="Alu" FT misc_feature complement(8997990..8998034) FT /note="similar to Homo sapiens EST N22819 (NID:g1136969) FT yw41h05.s1" FT repeat_region complement(8997970..8997996) FT /rpt_family="AT_rich" FT repeat_region complement(8997818..8997980) FT /rpt_family="L2" FT repeat_region complement(8997724..8997825) FT /rpt_family="MER1_type" FT repeat_region complement(8997411..8997593) FT /rpt_family="L2" FT repeat_region complement(8997118..8997410) FT /rpt_family="Alu" FT repeat_region complement(8996431..8997117) FT /rpt_family="L2" FT misc_feature complement(8995906..8996372) FT /note="similar to Homo sapiens EST BF807609 FT (NID:g12136598)" FT repeat_region complement(8994256..8995138) FT /rpt_family="ERV1" FT misc_feature complement(8994838..8994842) FT /note="similar to Homo sapiens EST AA380992 (NID:g2033311)" FT repeat_region complement(8994182..8994255) FT /rpt_family="ERV1" FT repeat_region complement(8993827..8994181) FT /rpt_family="ERV1" FT misc_feature complement(8993801..8993890) FT /note="similar to Homo sapiens EST AA057708 (NID:g1550374) FT zl76a10.r1" FT repeat_region complement(8993630..8993718) FT /rpt_family="MIR" FT repeat_region complement(8993452..8993548) FT /rpt_family="L1" FT repeat_region complement(8993141..8993415) FT /rpt_family="MaLR" FT repeat_region complement(8992654..8992955) FT /rpt_family="L1" FT repeat_region complement(8992632..8992653) FT /rpt_family="AT_rich" FT repeat_region complement(8992534..8992635) FT /rpt_family="L1" FT misc_feature complement(8992148..8992539) FT /note="similar to Homo sapiens EST BI115247 FT (NID:g14566148)" FT misc_feature complement(8992198..8992539) FT /note="similar to Homo sapiens EST BE300303 (NID:g9184051)" FT misc_feature complement(8992187..8992539) FT /note="match to EST BI046930 (NID:g14453552)" FT misc_feature complement(8992366..8992534) FT /note="similar to Homo sapiens EST BG331104 FT (NID:g13137542)" FT misc_feature complement(8991283..8991857) FT /note="similar to Homo sapiens EST BG911468 FT (NID:g14291944)" FT misc_feature complement(8991670..8991813) FT /note="match to EST BF992946 (NID:g12399269)" FT misc_feature complement(8991273..8991650) FT /note="match to EST BF914971 (NID:g12306429)" FT repeat_region complement(8991376..8991398) FT /rpt_family="AT_rich" FT repeat_region complement(8991203..8991231) FT /rpt_family="AT_rich" FT misc_feature complement(8990539..8991059) FT /note="similar to Homo sapiens EST BG029979 FT (NID:g12419076)" FT misc_feature complement(8990549..8990855) FT /note="similar to Homo sapiens EST AW451324 (NID:g6992100)" FT repeat_region complement(8990479..8990692) FT /rpt_family="MIR" FT misc_feature complement(8990333..8990664) FT /note="similar to Homo sapiens EST AV730543 FT (NID:g10839964)" FT misc_feature complement(8990093..8990503) FT /note="similar to Homo sapiens EST BE165573 (NID:g8628294)" FT repeat_region complement(8989128..8990152) FT /rpt_family="ERVK" FT repeat_region complement(8989949..8989978) FT /rpt_family="AT_rich" FT misc_feature complement(8989011..8989639) FT /note="similar to Homo sapiens EST BF105997 FT (NID:g10888523)" FT repeat_region complement(8988635..8988665) FT /rpt_family="AT_rich" FT repeat_region complement(8988363..8988614) FT /rpt_family="L1" FT repeat_region complement(8988084..8988362) FT /rpt_family="Alu" FT repeat_region complement(8987984..8988083) FT /rpt_family="L1" FT repeat_region complement(8987919..8987985) FT /rpt_family="(TTTG)n" FT repeat_region complement(8987630..8987925) FT /rpt_family="Alu" FT repeat_region complement(8986637..8987628) FT /rpt_family="L1" FT repeat_region complement(8986290..8986588) FT /rpt_family="Alu" FT repeat_region complement(8986002..8986225) FT /rpt_family="L1" FT repeat_region complement(8985723..8986001) FT /rpt_family="Alu" FT repeat_region complement(8985541..8985722) FT /rpt_family="L1" FT repeat_region complement(8985354..8985496) FT /rpt_family="Tc2" FT repeat_region complement(8985023..8985348) FT /rpt_family="Alu" FT repeat_region complement(8985013..8985051) FT /rpt_family="A-rich" FT misc_feature complement(8985030..8985045) FT /note="similar to Homo sapiens EST AW451324 (NID:g6992100)" FT repeat_region complement(8984718..8984870) FT /rpt_family="MER1_type" FT repeat_region complement(8984827..8984849) FT /rpt_family="AT_rich" FT misc_feature complement(8984826..8984845) FT /note="similar to Homo sapiens EST BI114826 FT (NID:g14565727)" FT misc_feature complement(8984831..8984844) FT /note="similar to Homo sapiens EST AI345382 (NID:g4082588) FT tb68h08.x1" FT misc_feature complement(8984830..8984844) FT /note="similar to Homo sapiens EST BF512280 FT (NID:g11597459)" FT repeat_region complement(8984417..8984614) FT /rpt_family="MER2_type" FT misc_feature complement(8983905..8984356) FT /note="similar to Homo sapiens EST H49406 (NID:g989247) FT yq19f08.s1" FT misc_feature complement(8984246..8984336) FT /note="match to EST AA093222 (NID:g1638619)" FT misc_feature complement(8983884..8984098) FT /note="similar to Homo sapiens EST BF062364 FT (NID:g10821274)" FT misc_feature complement(8983999..8984066) FT /note="similar to Homo sapiens EST AI123431 (NID:g3539197) FT qa49d06.x1" FT misc_feature complement(8983789..8983945) FT /note="similar to Homo sapiens EST AI123431 (NID:g3539197) FT qa49d06.x1" FT misc_feature complement(8983372..8983889) FT /note="similar to Homo sapiens EST BG117417 FT (NID:g12610923)" FT misc_feature complement(8983670..8983707) FT /note="match to EST AA093222 (NID:g1638619)" FT misc_feature complement(8983164..8983606) FT /note="similar to Homo sapiens EST BF028005 FT (NID:g10735820)" FT misc_feature complement(8983543..8983571) FT /note="similar to Homo sapiens EST BG193651 FT (NID:g13715338)" FT misc_feature complement(8983265..8983565) FT /note="similar to Homo sapiens EST AI949299 (NID:g5741609) FT wq21a11.x1" FT misc_feature complement(8983209..8983475) FT /note="similar to Homo sapiens EST BG218617 FT (NID:g13744638)" FT repeat_region complement(8982297..8982515) FT /rpt_family="Alu" FT misc_feature complement(8982487..8982493) FT /note="similar to Homo sapiens EST AW854448 (NID:g7950050)" FT repeat_region complement(8979867..8982295) FT /rpt_family="SATR2" FT repeat_region complement(8978813..8980206) FT /rpt_family="SATR1" FT misc_feature complement(8978646..8978734) FT /note="similar to Homo sapiens EST BF028005 FT (NID:g10735820)" FT misc_feature complement(8978434..8978539) FT /note="similar to Homo sapiens EST BF028005 FT (NID:g10735820)" FT misc_feature complement(8978403) FT /note="similar to Homo sapiens EST BF028005 FT (NID:g10735820)" FT repeat_region complement(8972290..8974387) FT /rpt_family="SATR1" FT repeat_region complement(8971981..8972161) FT /rpt_family="(TAA)n" FT repeat_region complement(8970860..8971889) FT /rpt_family="SATR1" FT repeat_region complement(8970641..8970855) FT /rpt_family="MaLR" FT repeat_region complement(8970550..8970625) FT /rpt_family="MaLR" FT repeat_region complement(8970253..8970541) FT /rpt_family="Alu" FT misc_feature complement(8970251..8970267) FT /note="similar to Homo sapiens EST N22819 (NID:g1136969) FT yw41h05.s1" FT repeat_region complement(8970109..8970242) FT /rpt_family="Alu" FT repeat_region complement(8970057..8970126) FT /rpt_family="(TAAAA)n" FT repeat_region complement(8969932..8970054) FT /rpt_family="MaLR" FT repeat_region complement(8969678..8969884) FT /rpt_family="L1" FT repeat_region complement(8969389..8969677) FT /rpt_family="Alu" FT repeat_region complement(8968968..8969388) FT /rpt_family="L1" FT repeat_region complement(8968950..8968976) FT /rpt_family="(TTTTA)n" FT repeat_region complement(8968660..8968967) FT /rpt_family="Alu" FT repeat_region complement(8968569..8968659) FT /rpt_family="L1" FT repeat_region complement(8968188..8968501) FT /rpt_family="Alu" FT repeat_region complement(8968176..8968216) FT /rpt_family="(A)n" FT misc_feature complement(8968202..8968214) FT /note="similar to Homo sapiens EST BG029979 FT (NID:g12419076)" FT misc_feature complement(8967426..8967594) FT /note="similar to Mus musculus EST W65006 (NID:g1372648) FT me04a10.r1" FT misc_feature complement(8967098..8967594) FT /note="similar to Mus musculus EST AI430580 (NID:g4276416) FT me04a10.y1" FT misc_feature complement(8967454..8967459) FT /note="similar to Homo sapiens EST H81613 (NID:g1059702) FT ys66c10.r1" FT misc_feature complement(8967161..8967163) FT /note="similar to Homo sapiens EST AA906079 (NID:g3041202) FT oj90f09.s1" FT misc_feature complement(8965223..8966316) FT /note="CpG_island (%GC=70.6, o/e=0.80, #CpGs=98)" FT misc_feature complement(8965588..8966155) FT /note="similar to Homo sapiens EST BF057285 FT (NID:g10811181)" FT misc_feature complement(8965794..8966154) FT /note="similar to Homo sapiens EST AI825565 (NID:g5446236) FT wb73h11.x1" FT misc_feature complement(8965708..8966117) FT /note="similar to Homo sapiens EST W56227 (NID:g1358116) FT zc01c10.r1" FT misc_feature complement(8965396..8966110) FT /note="similar to Homo sapiens EST BG746035 FT (NID:g14056688)" FT misc_feature complement(8965522..8966027) FT /note="similar to Homo sapiens EST AI935256 (NID:g5674126) FT wp16a07.x1" FT misc_feature complement(8965429..8966012) FT /note="match to EST AI074005 (NID:g3400649) oy66e08.x1" FT misc_feature complement(8965433..8965856) FT /note="similar to Homo sapiens EST AA906079 (NID:g3041202) FT oj90f09.s1" FT misc_feature complement(8965430..8965805) FT /note="match to EST AW204337 (NID:g6503809)" FT misc_feature complement(8965396..8965693) FT /note="similar to Homo sapiens EST BG469659 FT (NID:g13401934)" FT misc_feature complement(8965358..8965598) FT /note="match to EST AW298596 (NID:g6705232)" FT misc_feature complement(8965396..8965588) FT /note="similar to Homo sapiens EST BG754342 FT (NID:g14064995)" FT misc_feature complement(8965396..8965475) FT /note="similar to Homo sapiens EST BG341847 FT (NID:g13148285)" FT misc_feature complement(8965396..8965436) FT /note="match to EST AA250815 (NID:g1885777) zs06a08.s1" FT misc_feature complement(8965396..8965435) FT /note="similar to Homo sapiens EST BF514082 FT (NID:g11599261)" FT misc_feature complement(8964951..8965356) FT /note="match to EST M78232 (NID:g272549)" FT repeat_region complement(8964617..8964862) FT /rpt_family="Alu" FT repeat_region complement(8964576..8964605) FT /rpt_family="(T)n" FT repeat_region complement(8964232..8964279) FT /rpt_family="(TTTTTA)n" FT repeat_region complement(8963947..8964259) FT /rpt_family="Alu" FT misc_feature complement(8963611..8963973) FT /note="match to EST T49747 (NID:g651607) ya80e02.s1" FT misc_feature complement(8963440..8963573) FT /note="match to EST BG764193 (NID:g14074846)" FT misc_feature complement(8963440..8963568) FT /note="match to EST AI936590 (NID:g5675460) wd29g07.x1" FT misc_feature complement(8963430..8963558) FT /note="similar to Homo sapiens EST BG469659 FT (NID:g13401934)" FT misc_feature complement(8963440..8963558) FT /note="similar to Homo sapiens EST BG341847 FT (NID:g13148285)" FT /note="similar to Homo sapiens EST BG754342 FT (NID:g14064995)" FT /note="match to EST AA250815 (NID:g1885777) zs06a08.s1" FT /note="similar to Homo sapiens EST BF514082 FT (NID:g11599261)" FT /note="similar to Homo sapiens EST BG746035 FT (NID:g14056688)" FT misc_feature complement(8963031..8963539) FT /note="match to EST AA586884 (NID:g2397698) nn68b06.s1" FT misc_feature complement(8963440..8963511) FT /note="match to EST AA730281 (NID:g2753493) nz94c04.s1" FT misc_feature complement(8963440..8963510) FT /note="similar to Homo sapiens EST AA835989 (NID:g2910308) FT oc81g09.s1" FT misc_feature complement(8963115..8963496) FT /note="match to EST M78233 (NID:g272550)" FT misc_feature complement(8961233..8961627) FT /note="similar to Homo sapiens EST BG341847 FT (NID:g13148285)" FT misc_feature complement(8961349..8961627) FT /note="similar to Homo sapiens EST BG754342 FT (NID:g14064995)" FT /note="match to EST BG764193 (NID:g14074846)" FT /note="similar to Homo sapiens EST AW371793 (NID:g6876447)" FT misc_feature complement(8961475..8961627) FT /note="similar to Homo sapiens EST AA835989 (NID:g2910308) FT oc81g09.s1" FT misc_feature complement(8961484..8961627) FT /note="match to EST AA730281 (NID:g2753493) nz94c04.s1" FT misc_feature complement(8961280..8961627) FT /note="match to EST AI936590 (NID:g5675460) wd29g07.x1" FT misc_feature complement(8961517..8961627) FT /note="match to EST AA250815 (NID:g1885777) zs06a08.s1" FT misc_feature complement(8961257..8961627) FT /note="similar to Homo sapiens EST BF514082 FT (NID:g11599261)" FT misc_feature complement(8961590..8961627) FT /note="similar to Homo sapiens EST BG746035 FT (NID:g14056688)" FT repeat_region complement(8960079..8961293) FT /rpt_family="SATR1" FT repeat_region complement(8960026..8960059) FT /rpt_family="AT_rich" FT repeat_region complement(8959793..8959964) FT /rpt_family="(TAA)n" FT repeat_region complement(8958593..8959670) FT /rpt_family="SATR1" FT misc_feature complement(8958524..8958676) FT /note="similar to Homo sapiens EST BG341847 FT (NID:g13148285)" FT misc_feature complement(8958464) FT /note="similar to Homo sapiens EST BG341847 FT (NID:g13148285)" FT repeat_region complement(8957306..8958320) FT /rpt_family="ERVK" FT misc_feature complement(8957712..8957714) FT /note="similar to Homo sapiens EST BF057285 FT (NID:g10811181)" FT misc_feature complement(8956797..8957223) FT /note="similar to Homo sapiens EST AW194462 (NID:g6473281) FT xm09a10.x1" FT misc_feature complement(8956830..8957205) FT /note="similar to Homo sapiens EST AI830758 (NID:g5451514) FT wj10h10.x1" FT repeat_region complement(8956813..8956843) FT /rpt_family="AT_rich" FT repeat_region complement(8956541..8956792) FT /rpt_family="L1" FT repeat_region complement(8956258..8956540) FT /rpt_family="Alu" FT repeat_region complement(8956163..8956257) FT /rpt_family="L1" FT repeat_region complement(8956112..8956164) FT /rpt_family="(TTTG)n" FT repeat_region complement(8955823..8956118) FT /rpt_family="Alu" FT repeat_region complement(8954825..8955821) FT /rpt_family="L1" FT repeat_region complement(8954476..8954781) FT /rpt_family="Alu" FT repeat_region complement(8954190..8954396) FT /rpt_family="L1" FT repeat_region complement(8953910..8954189) FT /rpt_family="Alu" FT misc_feature complement(8953946..8954016) FT /note="similar to Homo sapiens EST BG182279 FT (NID:g13703966)" FT repeat_region complement(8953726..8953909) FT /rpt_family="L1" FT repeat_region complement(8953545..8953687) FT /rpt_family="Tc2" FT repeat_region complement(8953218..8953539) FT /rpt_family="Alu" FT misc_feature complement(8952995..8953285) FT /note="similar to Homo sapiens EST AA091411 (NID:g1636874)" FT misc_feature complement(8953231..8953249) FT /note="similar to Homo sapiens EST AI375817 (NID:g4175807) FT qz93g01.x1" FT /note="similar to Homo sapiens EST T79422 (NID:g697931) FT yd75c02.s1" FT repeat_region complement(8953210..8953247) FT /rpt_family="A-rich" FT misc_feature complement(8952491..8953066) FT /note="similar to Homo sapiens EST N99107 (NID:g1270673) FT yy67h07.r1" FT repeat_region complement(8952920..8953066) FT /rpt_family="MER1_type" FT misc_feature complement(8952461..8952846) FT /note="similar to Homo sapiens EST AA219163 (NID:g1833237) FT zq16c11.r1" FT repeat_region complement(8952618..8952814) FT /rpt_family="MER2_type" FT misc_feature complement(8952628..8952630) FT /note="similar to Homo sapiens EST BG995764 FT (NID:g14399834)" FT misc_feature complement(8951698..8952383) FT /note="similar to Homo sapiens EST AW009208 (NID:g5857986) FT ws79a10.x1" FT misc_feature complement(8952017..8952381) FT /note="similar to Homo sapiens EST BG189896 FT (NID:g13711583)" FT misc_feature complement(8952204..8952287) FT /note="similar to Homo sapiens EST AA502892 (NID:g2237859) FT nh57g07.s1" FT misc_feature complement(8951413..8952156) FT /note="similar to Homo sapiens EST BG204873 FT (NID:g13726560)" FT misc_feature complement(8951456..8952147) FT /note="similar to Homo sapiens EST BG184622 FT (NID:g13706437)" FT misc_feature complement(8951789..8952140) FT /note="similar to Homo sapiens EST AW514861 (NID:g7152943) FT xu99f03.x1" FT misc_feature complement(8952019..8952137) FT /note="similar to Homo sapiens EST AA502892 (NID:g2237859) FT nh57g07.s1" FT misc_feature complement(8951406..8952101) FT /note="similar to Homo sapiens EST BF345274 FT (NID:g11292799)" FT misc_feature complement(8951795..8951935) FT /note="similar to Homo sapiens EST BG182279 FT (NID:g13703966)" FT misc_feature complement(8951741..8951910) FT /note="similar to Homo sapiens EST BG995764 FT (NID:g14399834)" FT misc_feature complement(8951552..8951771) FT /note="similar to Homo sapiens EST AA931563 (NID:g3085949) FT oo56d01.s1" FT misc_feature complement(8951414..8951770) FT /note="similar to Homo sapiens EST BG202850 FT (NID:g13724537)" FT misc_feature complement(8951404..8951770) FT /note="similar to Homo sapiens EST AA042813 (NID:g1522468) FT zk53c07.s1" FT misc_feature complement(8951297..8951679) FT /note="similar to Homo sapiens EST BG988908 FT (NID:g14392978)" FT misc_feature complement(8951359..8951668) FT /note="similar to Homo sapiens EST BF676494 FT (NID:g11950389)" FT misc_feature complement(8951404..8951646) FT /note="similar to Homo sapiens EST BG193651 FT (NID:g13715338)" FT misc_feature complement(8951368..8951556) FT /note="similar to Homo sapiens EST BG117417 FT (NID:g12610923)" FT misc_feature complement(8950771..8951310) FT /note="similar to Homo sapiens EST BE504987 (NID:g9707395) FT hz38h11.x1" FT misc_feature complement(8950771..8951027) FT /note="similar to Homo sapiens EST BG182279 FT (NID:g13703966)" FT misc_feature complement(8950776..8950991) FT /note="similar to Homo sapiens EST AW026780 (NID:g5880310) FT wv44h08.x1" FT misc_feature complement(8950521..8950986) FT /note="similar to Homo sapiens EST AI821660 (NID:g5440739) FT zv46d07.x5" FT misc_feature complement(8950714) FT /note="similar to Homo sapiens EST BE504987 (NID:g9707395) FT hz38h11.x1" FT repeat_region complement(8950506..8950712) FT /rpt_family="Alu" FT repeat_region complement(8949886..8950504) FT /rpt_family="SATR2" FT repeat_region complement(8948156..8950145) FT /rpt_family="SATR1" FT misc_feature complement(8947990..8948135) FT /note="similar to Homo sapiens EST BF676494 FT (NID:g11950389)" FT misc_feature complement(8947779..8947884) FT /note="similar to Homo sapiens EST BF676494 FT (NID:g11950389)" FT misc_feature complement(8947636..8947638) FT /note="similar to Homo sapiens EST BF676494 FT (NID:g11950389)" FT misc_feature complement(8947615..8947622) FT /note="match to EST BF849881 (NID:g12237031)" FT misc_feature complement(8943767..8944035) FT /note="similar to Homo sapiens EST T16582 (NID:g518744)" FT repeat_region complement(8943835..8944027) FT /rpt_family="(TAA)n" FT repeat_region complement(8943616..8943759) FT /rpt_family="SATR2" FT repeat_region complement(8943171..8943741) FT /rpt_family="SATR1" FT repeat_region complement(8942952..8943057) FT /rpt_family="GA-rich" FT repeat_region complement(8942789..8942862) FT /rpt_family="MIR" FT misc_feature complement(8942779..8942787) FT /note="match to EST BF849881 (NID:g12237031)" FT repeat_region complement(8940122..8940197) FT /rpt_family="MIR" FT misc_feature complement(8940114..8940118) FT /note="similar to Homo sapiens EST BG395053 FT (NID:g13288501)" FT repeat_region complement(8939683..8939949) FT /rpt_family="ERVL" FT repeat_region complement(8939319..8939443) FT /rpt_family="L2" FT repeat_region complement(8939278..8939315) FT /rpt_family="T-rich" FT repeat_region complement(8938280..8939291) FT /rpt_family="L1" FT repeat_region complement(8936818..8938287) FT /rpt_family="L1" FT repeat_region complement(8936497..8936816) FT /rpt_family="ERV1" FT repeat_region complement(8936346..8936447) FT /rpt_family="ERV1" FT repeat_region complement(8936298..8936337) FT /rpt_family="(T)n" FT repeat_region complement(8936016..8936323) FT /rpt_family="Alu" FT misc_feature complement(8936106..8936111) FT /note="similar to Homo sapiens EST BI198864 FT (NID:g14653885)" FT /note="similar to Homo sapiens EST BG828822 FT (NID:g14176421)" FT /note="similar to Homo sapiens EST BG775017 FT (NID:g14045334)" FT /note="similar to Homo sapiens EST BG470303 FT (NID:g13402578)" FT /note="similar to Homo sapiens EST BG337758 FT (NID:g13144196)" FT /note="similar to Homo sapiens EST BG481951 FT (NID:g13414230)" FT /note="similar to Homo sapiens EST BG821677 FT (NID:g14169264)" FT repeat_region complement(8934269..8934573) FT /rpt_family="Alu" FT repeat_region complement(8933311..8933330) FT /rpt_family="(T)n" FT repeat_region complement(8932863..8932887) FT /rpt_family="AT_rich" FT repeat_region complement(8931844..8932749) FT /rpt_family="ERV1" FT repeat_region complement(8932502..8932545) FT /rpt_family="AT_rich" FT repeat_region complement(8931610..8931843) FT /rpt_family="ERV1" FT repeat_region complement(8930922..8931599) FT /rpt_family="ERV1" FT repeat_region complement(8930675..8930948) FT /rpt_family="ERV1" FT repeat_region complement(8930879..8930903) FT /rpt_family="(CA)n" FT repeat_region complement(8930602..8930653) FT /rpt_family="ERV1" FT repeat_region complement(8930318..8930601) FT /rpt_family="Alu" FT repeat_region complement(8929712..8930317) FT /rpt_family="ERV1" FT repeat_region complement(8929722..8929744) FT /rpt_family="AT_rich" FT repeat_region complement(8929360..8929716) FT /rpt_family="ERV1" FT repeat_region complement(8929321..8929363) FT /rpt_family="(TG)n" FT repeat_region complement(8929034..8929247) FT /rpt_family="ERV1" FT repeat_region complement(8928739..8929033) FT /rpt_family="Alu" FT misc_feature complement(8928897..8928911) FT /note="similar to Homo sapiens EST BG182279 FT (NID:g13703966)" FT repeat_region complement(8928274..8928738) FT /rpt_family="ERV1" FT repeat_region complement(8928600..8928621) FT /rpt_family="AT_rich" FT repeat_region complement(8927951..8928270) FT /rpt_family="ERV1" FT repeat_region complement(8927800..8927898) FT /rpt_family="ERV1" FT repeat_region complement(8927473..8927799) FT /rpt_family="L1" FT repeat_region complement(8927188..8927472) FT /rpt_family="Alu" FT repeat_region complement(8924595..8927187) FT /rpt_family="L1" FT repeat_region complement(8926176..8926213) FT /rpt_family="CT-rich" FT repeat_region 9107482..9107978 FT /rpt_family="ERV1" FT repeat_region 9107979..9108532 FT /rpt_family="ERV1" FT repeat_region 9108535..9109196 FT /rpt_family="ERV1" FT repeat_region 9109198..9109408 FT /rpt_family="ERV1" FT repeat_region 9109409..9109786 FT /rpt_family="ERV1" FT repeat_region 9109788..9110185 FT /rpt_family="ERV1" FT repeat_region 9110198..9110499 FT /rpt_family="Alu" FT repeat_region 9110510..9110695 FT /rpt_family="MaLR" FT repeat_region 9111876..9112008 FT /rpt_family="L2" FT repeat_region 9112031..9112342 FT /rpt_family="Alu" FT repeat_region 9112626..9112667 FT /rpt_family="(CAT)n" FT repeat_region 9112778..9112902 FT /rpt_family="MaLR" FT repeat_region 9113177..9113226 FT /rpt_family="L2" FT repeat_region 9113452..9113748 FT /rpt_family="Alu" FT repeat_region 9113895..9113949 FT /rpt_family="(GGGA)n" FT repeat_region 9114256..9114551 FT /rpt_family="Alu" FT repeat_region 9114629..9114844 FT /rpt_family="ERVL" FT repeat_region 9115331..9115387 FT /rpt_family="MER1_type" FT repeat_region 9115388..9115520 FT /rpt_family="Alu" FT repeat_region 9115521..9115564 FT /rpt_family="MER1_type" FT repeat_region 9115579..9115646 FT /rpt_family="MaLR" FT repeat_region 9115644..9115717 FT /rpt_family="ERV1" FT repeat_region 9116079..9116208 FT /rpt_family="Alu" FT repeat_region 9116394..9116572 FT /rpt_family="Alu" FT repeat_region 9116573..9116872 FT /rpt_family="Alu" FT repeat_region 9116873..9117018 FT /rpt_family="Alu" FT repeat_region 9117761..9117880 FT /rpt_family="MER1_type" FT repeat_region 9117881..9118178 FT /rpt_family="Alu" FT repeat_region 9118179..9118204 FT /rpt_family="MER1_type" FT repeat_region 9118283..9118378 FT /rpt_family="MER1_type" FT repeat_region 9118795..9118865 FT /rpt_family="MaLR" FT repeat_region 9118866..9119163 FT /rpt_family="Alu" FT repeat_region 9119164..9119500 FT /rpt_family="MaLR" FT repeat_region 9119555..9119851 FT /rpt_family="Alu" FT repeat_region 9120059..9120416 FT /rpt_family="Alu" FT repeat_region 9120600..9120643 FT /rpt_family="Alu" FT repeat_region 9120689..9121133 FT /rpt_family="ERV1" FT repeat_region 9121134..9121362 FT /rpt_family="Alu" FT repeat_region 9121363..9121660 FT /rpt_family="ERV1" FT repeat_region 9121663..9121951 FT /rpt_family="Alu" FT repeat_region 9122493..9122799 FT /rpt_family="Alu" FT repeat_region 9122809..9122840 FT /rpt_family="(CAAA)n" FT repeat_region 9122986..9123297 FT /rpt_family="Alu" FT repeat_region 9123512..9124535 FT /rpt_family="ERVK" FT repeat_region 9132071..9133093 FT /rpt_family="ERVK" FT repeat_region 9133408..9133563 FT /rpt_family="MIR" FT repeat_region 9133568..9133684 FT /rpt_family="L2" FT repeat_region 9134035..9134251 FT /rpt_family="MIR" FT repeat_region 9134269..9134564 FT /rpt_family="Alu" FT repeat_region 9134652..9135158 FT /rpt_family="MER1_type" FT repeat_region 9135176..9135324 FT /rpt_family="MER1_type" FT repeat_region 9135325..9135613 FT /rpt_family="Alu" FT repeat_region 9135614..9135684 FT /rpt_family="MER1_type" FT repeat_region 9135834..9136023 FT /rpt_family="MIR" FT repeat_region 9136890..9136975 FT /rpt_family="(TC)n" FT repeat_region 9138174..9138209 FT /rpt_family="(TG)n" FT repeat_region 9138778..9139085 FT /rpt_family="Alu" FT repeat_region 9139141..9139299 FT /rpt_family="L2" FT repeat_region 9139459..9139675 FT /rpt_family="ERVL" FT repeat_region 9140315..9140461 FT /rpt_family="MIR" FT repeat_region 9140472..9140738 FT /rpt_family="Alu" FT repeat_region 9140749..9140821 FT /rpt_family="Alu" FT repeat_region 9141019..9141257 FT /rpt_family="MaLR" FT repeat_region 9141388..9141544 FT /rpt_family="Alu" FT repeat_region 9141648..9141789 FT /rpt_family="Alu" FT repeat_region 9141790..9142054 FT /rpt_family="Alu" FT repeat_region 9142055..9142165 FT /rpt_family="Alu" FT repeat_region 9142178..9142253 FT /rpt_family="L1" FT repeat_region 9142257..9142334 FT /rpt_family="(TA)n" FT repeat_region 9142388..9142547 FT /rpt_family="Tc2" FT repeat_region 9143427..9143715 FT /rpt_family="Alu" FT repeat_region 9143716..9143809 FT /rpt_family="(TATAA)n" FT repeat_region 9143948..9144265 FT /rpt_family="Alu" FT repeat_region 9144335..9144421 FT /rpt_family="MIR" FT repeat_region 9144442..9144691 FT /rpt_family="Alu" FT repeat_region 9144692..9145129 FT /rpt_family="ERV1" FT repeat_region 9145130..9146517 FT /rpt_family="ERV1" FT repeat_region 9146518..9146553 FT /rpt_family="ERV1" FT repeat_region 9146554..9146611 FT /rpt_family="Alu" FT repeat_region 9146745..9147211 FT /rpt_family="L1" FT repeat_region 9147212..9147498 FT /rpt_family="Alu" FT repeat_region 9147499..9147568 FT /rpt_family="L1" FT repeat_region 9147580..9147714 FT /rpt_family="Alu" FT repeat_region 9147715..9148017 FT /rpt_family="Alu" FT repeat_region 9148018..9148193 FT /rpt_family="Alu" FT repeat_region 9148308..9148616 FT /rpt_family="Alu" FT repeat_region 9149234..9149543 FT /rpt_family="Alu" FT repeat_region 9149742..9150051 FT /rpt_family="Alu" FT repeat_region 9150213..9150431 FT /rpt_family="MIR" FT repeat_region 9150657..9150757 FT /rpt_family="Alu" FT repeat_region 9150762..9150911 FT /rpt_family="MaLR" FT repeat_region 9150931..9151221 FT /rpt_family="Alu" FT repeat_region 9151433..9151460 FT /rpt_family="AT_rich" FT repeat_region 9151896..9152184 FT /rpt_family="Alu" FT repeat_region 9152279..9152580 FT /rpt_family="Alu" FT repeat_region 9153685..9153800 FT /rpt_family="L2" FT misc_feature 9153958..9155504 FT /note="CpG_island (%GC=70.3, o/e=0.80, #CpGs=135)" FT repeat_region 9155999..9156046 FT /rpt_family="MIR" FT repeat_region 9156068..9156281 FT /rpt_family="MIR" FT repeat_region 9156328..9156773 FT /rpt_family="L2" FT repeat_region 9158209..9158505 FT /rpt_family="Alu" FT repeat_region 9159409..9159766 FT /rpt_family="ERVL" FT repeat_region 9159780..9160088 FT /rpt_family="Alu" FT repeat_region 9160615..9160740 FT /rpt_family="Alu" FT repeat_region 9161031..9161184 FT /rpt_family="MIR" FT repeat_region 9161262..9161394 FT /rpt_family="Alu" FT repeat_region 9161395..9161694 FT /rpt_family="Alu" FT repeat_region 9161695..9161851 FT /rpt_family="Alu" FT repeat_region 9161923..9162137 FT /rpt_family="L1" FT repeat_region 9163911..9163984 FT /rpt_family="MIR" FT repeat_region 9164136..9164266 FT /rpt_family="MIR" FT repeat_region 9164544..9164859 FT /rpt_family="Alu" FT repeat_region 9164974..9165284 FT /rpt_family="Alu" FT repeat_region 9165334..9165440 FT /rpt_family="Alu" FT repeat_region 9165519..9165691 FT /rpt_family="MER1_type" FT repeat_region 9165825..9166132 FT /rpt_family="Alu" FT repeat_region 9166133..9166368 FT /rpt_family="Alu" FT repeat_region 9166435..9166461 FT /rpt_family="(TG)n" FT repeat_region 9166462..9166745 FT /rpt_family="Alu" FT repeat_region 9168523..9168722 FT /rpt_family="MER1_type" FT repeat_region 9169954..9170021 FT /rpt_family="Mariner" FT repeat_region 9170556..9170667 FT /rpt_family="Alu" FT repeat_region 9170669..9170989 FT /rpt_family="Alu" FT repeat_region 9171070..9171350 FT /rpt_family="Alu" FT repeat_region 9172628..9172931 FT /rpt_family="Alu" FT repeat_region 9173041..9173137 FT /rpt_family="MIR" FT repeat_region 9173347..9173484 FT /rpt_family="L1" FT repeat_region 9178509..9179540 FT /rpt_family="ERVK" FT repeat_region 9180950..9181121 FT /rpt_family="L1" FT repeat_region 9182028..9182127 FT /rpt_family="(TAA)n" FT repeat_region 9182691..9183033 FT /rpt_family="ERVL" FT repeat_region 9183575..9183874 FT /rpt_family="Alu" FT repeat_region 9184274..9184472 FT /rpt_family="Alu" FT repeat_region 9184664..9184707 FT /rpt_family="L2" FT repeat_region 9184780..9185073 FT /rpt_family="Alu" FT repeat_region 9185569..9185836 FT /rpt_family="L1" FT repeat_region 9185838..9185978 FT /rpt_family="Alu" FT repeat_region 9185983..9186275 FT /rpt_family="L1" FT repeat_region 9186276..9186595 FT /rpt_family="L1" FT repeat_region 9186596..9186649 FT /rpt_family="(TA)n" FT repeat_region 9186650..9187331 FT /rpt_family="L1" FT repeat_region 9187387..9187608 FT /rpt_family="MaLR" FT repeat_region 9187879..9187907 FT /rpt_family="AT_rich" FT repeat_region 9190082..9190157 FT /rpt_family="L2" FT repeat_region 9190484..9190515 FT /rpt_family="(TG)n" FT repeat_region 9190856..9190971 FT /rpt_family="MIR" FT repeat_region 9191166..9191204 FT /rpt_family="AT_rich" FT repeat_region 9191509..9191700 FT /rpt_family="MIR" FT repeat_region 9192080..9192395 FT /rpt_family="L1" FT repeat_region 9193537..9193803 FT /rpt_family="L1" FT repeat_region 9193830..9194619 FT /rpt_family="L2" FT repeat_region 9195095..9195371 FT /rpt_family="Alu" FT repeat_region 9195373..9195532 FT /rpt_family="(GAAA)n" FT repeat_region 9195566..9195897 FT /rpt_family="L1" FT repeat_region 9196007..9196598 FT /rpt_family="L1" FT repeat_region 9196599..9196918 FT /rpt_family="Alu" FT repeat_region 9196919..9197201 FT /rpt_family="L1" FT repeat_region 9198520..9198547 FT /rpt_family="AT_rich" FT repeat_region 9199208..9199265 FT /rpt_family="GA-rich" FT repeat_region 9200171..9201817 FT /rpt_family="L1" FT repeat_region 9201802..9202007 FT /rpt_family="L1" FT repeat_region 9202011..9202264 FT /rpt_family="L1" FT repeat_region 9202258..9202460 FT /rpt_family="MaLR" FT repeat_region 9202461..9202829 FT /rpt_family="MaLR" FT repeat_region 9203886..9204016 FT /rpt_family="(TTA)n" FT repeat_region 9205674..9205723 FT /rpt_family="(CA)n" FT repeat_region 9208217..9208266 FT /rpt_family="(CATA)n" FT repeat_region 9208487..9208583 FT /rpt_family="L1" FT repeat_region 9208584..9208923 FT /rpt_family="L1" FT repeat_region 9209168..9209303 FT /rpt_family="L1" FT repeat_region 9209384..9209431 FT /rpt_family="(CA)n" FT repeat_region 9211909..9211977 FT /rpt_family="(CA)n" FT repeat_region 9214010..9214092 FT /rpt_family="(CA)n" FT repeat_region 9216655..9216726 FT /rpt_family="(CA)n" FT repeat_region 9218758..9218840 FT /rpt_family="(CA)n" FT repeat_region 9221402..9221473 FT /rpt_family="(CA)n" FT repeat_region 9223505..9223587 FT /rpt_family="(CA)n" FT repeat_region 9226149..9226216 FT /rpt_family="(CA)n" FT repeat_region 9228249..9228331 FT /rpt_family="(CA)n" FT repeat_region 9230894..9230961 FT /rpt_family="(CA)n" FT repeat_region 9232994..9233076 FT /rpt_family="(CA)n" FT repeat_region 9235637..9235705 FT /rpt_family="(CA)n" FT repeat_region 9237738..9237818 FT /rpt_family="(CA)n" FT repeat_region 9240381..9240450 FT /rpt_family="(CA)n" FT repeat_region 9242483..9242565 FT /rpt_family="(CA)n" FT repeat_region 9245128..9245199 FT /rpt_family="(CA)n" FT repeat_region 9247232..9247314 FT /rpt_family="(CA)n" FT repeat_region 9249882..9249950 FT /rpt_family="(CA)n" FT repeat_region 9251983..9252065 FT /rpt_family="(CA)n" FT repeat_region 9254627..9254699 FT /rpt_family="(CA)n" FT repeat_region 9256731..9256813 FT /rpt_family="(CA)n" FT repeat_region 9259376..9259444 FT /rpt_family="(CA)n" FT repeat_region 9261477..9261559 FT /rpt_family="(CA)n" FT repeat_region 9264122..9264193 FT /rpt_family="(CA)n" FT repeat_region 9266225..9266307 FT /rpt_family="(CA)n" FT repeat_region 9268871..9268939 FT /rpt_family="(CA)n" FT repeat_region 9270972..9271054 FT /rpt_family="(CA)n" FT repeat_region 9273616..9273684 FT /rpt_family="(CA)n" FT gap 9274643..9324642 FT /estimated_length=50000 FT repeat_region complement(9570393..9570848) FT /rpt_family="ERVK" FT repeat_region complement(9570229..9570382) FT /rpt_family="GA-rich" FT repeat_region complement(9569966..9570143) FT /rpt_family="ERVK" FT repeat_region complement(9568938..9569963) FT /rpt_family="ERVK" FT repeat_region complement(9567958..9568063) FT /rpt_family="L2" FT repeat_region complement(9567032..9567120) FT /rpt_family="MIR" FT repeat_region complement(9566798..9567013) FT /rpt_family="L1" FT repeat_region complement(9566355..9566802) FT /rpt_family="L1" FT repeat_region complement(9566223..9566354) FT /rpt_family="MIR" FT repeat_region complement(9566046..9566111) FT /rpt_family="MER1_type" FT repeat_region complement(9565996..9566045) FT /rpt_family="ERV1" FT repeat_region complement(9565828..9565973) FT /rpt_family="Alu" FT repeat_region complement(9565638..9565821) FT /rpt_family="Alu" FT repeat_region complement(9564489..9564761) FT /rpt_family="Alu" FT repeat_region complement(9563997..9564416) FT /rpt_family="L1" FT repeat_region complement(9563833..9563996) FT /rpt_family="L1" FT repeat_region complement(9563531..9563832) FT /rpt_family="Alu" FT repeat_region complement(9563368..9563530) FT /rpt_family="L1" FT repeat_region complement(9562714..9562733) FT /rpt_family="L2" FT repeat_region complement(9562425..9562713) FT /rpt_family="Alu" FT repeat_region complement(9562350..9562424) FT /rpt_family="L2" FT repeat_region complement(9561923..9562217) FT /rpt_family="Alu" FT repeat_region complement(9561487..9561563) FT /rpt_family="L1" FT repeat_region complement(9561155..9561486) FT /rpt_family="Alu" FT repeat_region complement(9561009..9561154) FT /rpt_family="L1" FT repeat_region complement(9560787..9561008) FT /rpt_family="MER1_type" FT repeat_region complement(9560732..9560786) FT /rpt_family="L1" FT repeat_region complement(9560641..9560662) FT /rpt_family="AT_rich" FT repeat_region complement(9559694..9559714) FT /rpt_family="AT_rich" FT repeat_region complement(9559576..9559624) FT /rpt_family="(CA)n" FT repeat_region complement(9559259..9559561) FT /rpt_family="MaLR" FT repeat_region complement(9557833..9557911) FT /rpt_family="Mariner" FT repeat_region complement(9556799..9557255) FT /rpt_family="ERVL" FT repeat_region complement(9556700..9556781) FT /rpt_family="L2" FT repeat_region complement(9556111..9556413) FT /rpt_family="Alu" FT repeat_region complement(9555650..9556099) FT /rpt_family="L1" FT repeat_region complement(9554813..9555146) FT /rpt_family="L1" FT repeat_region complement(9554477..9554740) FT /rpt_family="Alu" FT repeat_region complement(9553588..9553885) FT /rpt_family="Alu" FT repeat_region complement(9553129..9553199) FT /rpt_family="L2" FT repeat_region complement(9552883..9553040) FT /rpt_family="MER1_type" FT repeat_region complement(9552296..9552587) FT /rpt_family="Alu" FT repeat_region complement(9551852..9552226) FT /rpt_family="L1" FT repeat_region complement(9551548..9551849) FT /rpt_family="Alu" FT repeat_region complement(9551223..9551257) FT /rpt_family="MER1_type" FT repeat_region complement(9551203..9551253) FT /rpt_family="MER1_type" FT repeat_region complement(9550989..9551099) FT /rpt_family="MIR" FT repeat_region complement(9550341..9550631) FT /rpt_family="Alu" FT repeat_region complement(9549797..9549913) FT /rpt_family="L2" FT repeat_region complement(9549488..9549671) FT /rpt_family="MIR" FT repeat_region complement(9549429..9549505) FT /rpt_family="L2" FT repeat_region complement(9549209..9549388) FT /rpt_family="(TGGA)n" FT repeat_region complement(9549014..9549192) FT /rpt_family="(TGGA)n" FT repeat_region complement(9547833..9547957) FT /rpt_family="MIR" FT repeat_region complement(9547482..9547602) FT /rpt_family="L2" FT repeat_region complement(9546832..9547138) FT /rpt_family="Alu" FT repeat_region complement(9545929..9546126) FT /rpt_family="MER53" FT repeat_region complement(9545242..9545395) FT /rpt_family="MIR" FT repeat_region complement(9544628..9544927) FT /rpt_family="L1" FT repeat_region complement(9544280..9544562) FT /rpt_family="L1" FT repeat_region complement(9544090..9544191) FT /rpt_family="Alu" FT repeat_region complement(9543792..9544010) FT /rpt_family="Alu" FT repeat_region complement(9542858..9543164) FT /rpt_family="Alu" FT repeat_region complement(9541698..9541915) FT /rpt_family="MER1_type" FT repeat_region complement(9541133..9541308) FT /rpt_family="L1" FT repeat_region complement(9540823..9541132) FT /rpt_family="Alu" FT repeat_region complement(9540481..9540822) FT /rpt_family="L1" FT repeat_region complement(9540421..9540445) FT /rpt_family="AT_rich" FT repeat_region complement(9540108..9540410) FT /rpt_family="Alu" FT repeat_region complement(9539876..9539907) FT /rpt_family="AT_rich" FT repeat_region complement(9539664..9539860) FT /rpt_family="Alu" FT repeat_region complement(9539433..9539663) FT /rpt_family="L2" FT repeat_region complement(9538022..9538327) FT /rpt_family="Alu" FT repeat_region complement(9537835..9538018) FT /rpt_family="MIR" FT repeat_region complement(9537575..9537805) FT /rpt_family="MER1_type" FT repeat_region complement(9535976..9536267) FT /rpt_family="Alu" FT repeat_region complement(9535645..9535892) FT /rpt_family="MIR" FT misc_feature complement(9533767..9534520) FT /note="CpG_island (%GC=73.5, o/e=0.80, #CpGs=84)" FT repeat_region complement(9533087..9533529) FT /rpt_family="L2" FT repeat_region complement(9532498..9532610) FT /rpt_family="L2" FT repeat_region complement(9532285..9532407) FT /rpt_family="MIR" FT repeat_region complement(9531653..9532268) FT /rpt_family="ERVL" FT repeat_region complement(9531573..9531647) FT /rpt_family="MIR" FT repeat_region complement(9531017..9531325) FT /rpt_family="Alu" FT repeat_region complement(9530490..9530792) FT /rpt_family="Alu" FT repeat_region complement(9529777..9529843) FT /rpt_family="(GA)n" FT repeat_region complement(9529459..9529707) FT /rpt_family="Alu" FT repeat_region complement(9529298..9529457) FT /rpt_family="L2" FT repeat_region complement(9529204..9529285) FT /rpt_family="MER1_type" FT repeat_region complement(9528889..9529071) FT /rpt_family="L2" FT repeat_region complement(9528582..9528888) FT /rpt_family="Alu" FT repeat_region complement(9527895..9528581) FT /rpt_family="L2" FT repeat_region complement(9525210..9526604) FT /rpt_family="ERV1" FT repeat_region complement(9525013..9525101) FT /rpt_family="MIR" FT repeat_region complement(9524799..9524927) FT /rpt_family="L1" FT repeat_region complement(9524417..9524798) FT /rpt_family="MaLR" FT repeat_region complement(9524039..9524416) FT /rpt_family="L1" FT repeat_region complement(9524016..9524038) FT /rpt_family="AT_rich" FT repeat_region complement(9523912..9524010) FT /rpt_family="L1" FT repeat_region complement(9522465..9522776) FT /rpt_family="Alu" FT repeat_region complement(9521857..9522070) FT /rpt_family="MIR" FT repeat_region complement(9520502..9521531) FT /rpt_family="ERVK" FT repeat_region complement(9520011..9520039) FT /rpt_family="AT_rich" FT repeat_region complement(9519739..9519990) FT /rpt_family="L1" FT repeat_region complement(9519454..9519738) FT /rpt_family="Alu" FT repeat_region complement(9519313..9519453) FT /rpt_family="L1" FT repeat_region complement(9519013..9519312) FT /rpt_family="Alu" FT repeat_region complement(9518019..9519012) FT /rpt_family="L1" FT repeat_region complement(9517670..9517973) FT /rpt_family="Alu" FT repeat_region complement(9517384..9517590) FT /rpt_family="L1" FT repeat_region complement(9517103..9517383) FT /rpt_family="Alu" FT repeat_region complement(9516920..9517102) FT /rpt_family="L1" FT repeat_region complement(9516739..9516881) FT /rpt_family="Tc2" FT repeat_region complement(9516411..9516733) FT /rpt_family="Alu" FT repeat_region complement(9516119..9516267) FT /rpt_family="MER1_type" FT repeat_region complement(9515819..9516015) FT /rpt_family="MER2_type" FT repeat_region complement(9513709..9513927) FT /rpt_family="Alu" FT repeat_region complement(9513316..9513707) FT /rpt_family="SATR2" FT repeat_region complement(9512573..9513345) FT /rpt_family="SATR1" FT repeat_region complement(9506257..9508369) FT /rpt_family="SATR1" FT repeat_region complement(9506234..9506254) FT /rpt_family="AT_rich" FT repeat_region complement(9505981..9506164) FT /rpt_family="(TAA)n" FT repeat_region complement(9504865..9505892) FT /rpt_family="SATR1" FT repeat_region complement(9504768..9504860) FT /rpt_family="MaLR" FT repeat_region complement(9504556..9504714) FT /rpt_family="MaLR" FT repeat_region complement(9504259..9504547) FT /rpt_family="Alu" FT repeat_region complement(9504053..9504248) FT /rpt_family="Alu" FT repeat_region complement(9503928..9504050) FT /rpt_family="MaLR" FT repeat_region complement(9503674..9503880) FT /rpt_family="L1" FT repeat_region complement(9503385..9503673) FT /rpt_family="Alu" FT repeat_region complement(9503148..9503384) FT /rpt_family="L1" FT repeat_region complement(9502974..9503086) FT /rpt_family="L1" FT repeat_region complement(9502947..9502973) FT /rpt_family="(TTTTA)n" FT repeat_region complement(9502656..9502941) FT /rpt_family="Alu" FT repeat_region complement(9502566..9502655) FT /rpt_family="L1" FT repeat_region complement(9502184..9502498) FT /rpt_family="Alu" FT misc_feature complement(9499226..9500317) FT /note="CpG_island (%GC=70.5, o/e=0.80, #CpGs=102)" FT repeat_region complement(9498945..9499016) FT /rpt_family="MER1_type" FT repeat_region complement(9498619..9498865) FT /rpt_family="Alu" FT repeat_region complement(9498293..9498608) FT /rpt_family="Alu" FT repeat_region complement(9497970..9498268) FT /rpt_family="Alu" FT repeat_region complement(9496879..9497007) FT /rpt_family="MIR" FT repeat_region complement(9494167..9495242) FT /rpt_family="SATR1" FT repeat_region complement(9494125..9494166) FT /rpt_family="AT_rich" FT repeat_region complement(9493901..9494072) FT /rpt_family="(TAA)n" FT repeat_region complement(9493676..9493792) FT /rpt_family="SATR2" FT repeat_region complement(9492627..9493778) FT /rpt_family="SATR1" FT repeat_region complement(9491332..9492346) FT /rpt_family="ERVK" FT repeat_region complement(9490845..9490875) FT /rpt_family="AT_rich" FT repeat_region complement(9490573..9490824) FT /rpt_family="L1" FT repeat_region complement(9490298..9490572) FT /rpt_family="Alu" FT repeat_region complement(9490152..9490297) FT /rpt_family="L1" FT repeat_region complement(9489852..9490151) FT /rpt_family="Alu" FT repeat_region complement(9488856..9489851) FT /rpt_family="L1" FT repeat_region complement(9488509..9488812) FT /rpt_family="Alu" FT repeat_region complement(9488222..9488428) FT /rpt_family="L1" FT repeat_region complement(9487941..9488221) FT /rpt_family="Alu" FT repeat_region complement(9487758..9487940) FT /rpt_family="L1" FT repeat_region complement(9487577..9487719) FT /rpt_family="Tc2" FT repeat_region complement(9487243..9487571) FT /rpt_family="Alu" FT repeat_region complement(9486952..9487099) FT /rpt_family="MER1_type" FT repeat_region complement(9486652..9486848) FT /rpt_family="MER2_type" FT repeat_region complement(9484540..9484759) FT /rpt_family="Alu" FT repeat_region complement(9484150..9484538) FT /rpt_family="SATR2" FT repeat_region complement(9483364..9484179) FT /rpt_family="SATR1" FT repeat_region complement(9482016..9483337) FT /rpt_family="SATR1" FT repeat_region complement(9477792..9477931) FT /rpt_family="(TAA)n" FT repeat_region complement(9477701..9477726) FT /rpt_family="AT_rich" FT repeat_region complement(9477655..9477682) FT /rpt_family="AT_rich" FT repeat_region complement(9476828..9477608) FT /rpt_family="SATR1" FT repeat_region complement(9476694..9476716) FT /rpt_family="GC_rich" FT unsure complement(9476110..9476181) FT /note="Sequence derived from one plasmid subclone." FT unsure complement(9475978..9475982) FT /note="Sequence derived from one plasmid subclone." FT repeat_region complement(9475593..9475615) FT /rpt_family="GC_rich" FT repeat_region complement(9474875..9475174) FT /rpt_family="SATR1" FT repeat_region complement(9473462..9474922) FT /rpt_family="SATR2" FT repeat_region complement(9472239..9473450) FT /rpt_family="SATR2" FT repeat_region complement(9471779..9472219) FT /rpt_family="SATR2" FT repeat_region complement(9471205..9471232) FT /rpt_family="(A)n" FT repeat_region complement(9469750..9470054) FT /rpt_family="Alu" FT repeat_region complement(9469557..9469691) FT /rpt_family="L2" FT repeat_region complement(9468879..9469191) FT /rpt_family="Alu" FT repeat_region complement(9468271..9468484) FT /rpt_family="MIR" FT repeat_region complement(9466933..9467944) FT /rpt_family="ERVK" FT repeat_region complement(9466444..9466474) FT /rpt_family="AT_rich" FT repeat_region complement(9466174..9466423) FT /rpt_family="L1" FT repeat_region complement(9465891..9466173) FT /rpt_family="Alu" FT repeat_region complement(9465777..9465890) FT /rpt_family="L1" FT repeat_region complement(9465462..9465776) FT /rpt_family="Alu" FT repeat_region complement(9464461..9465461) FT /rpt_family="L1" FT repeat_region complement(9464105..9464417) FT /rpt_family="Alu" FT repeat_region complement(9463818..9464018) FT /rpt_family="L1" FT repeat_region complement(9463537..9463817) FT /rpt_family="Alu" FT repeat_region complement(9463354..9463536) FT /rpt_family="L1" FT repeat_region complement(9462841..9463167) FT /rpt_family="Alu" FT repeat_region complement(9462549..9462630) FT /rpt_family="MER1_type" FT repeat_region complement(9462247..9462443) FT /rpt_family="MER2_type" FT repeat_region complement(9460132..9460354) FT /rpt_family="Alu" FT repeat_region complement(9459739..9460130) FT /rpt_family="SATR2" FT repeat_region complement(9457686..9459768) FT /rpt_family="SATR1" FT repeat_region complement(9453461..9453578) FT /rpt_family="(TAA)n" FT repeat_region complement(9452485..9453282) FT /rpt_family="SATR1" FT repeat_region complement(9451537..9451961) FT /rpt_family="L2" FT repeat_region complement(9450456..9451372) FT /rpt_family="L1" FT repeat_region complement(9450350..9450453) FT /rpt_family="L1" FT repeat_region complement(9450088..9450349) FT /rpt_family="Alu" FT repeat_region complement(9449548..9450087) FT /rpt_family="L1" FT repeat_region complement(9449134..9449547) FT /rpt_family="MaLR" FT repeat_region complement(9448101..9449132) FT /rpt_family="L1" FT repeat_region complement(9447759..9447845) FT /rpt_family="L1" FT repeat_region complement(9447415..9447769) FT /rpt_family="L1" FT repeat_region complement(9447354..9447379) FT /rpt_family="AT_rich" FT repeat_region complement(9446520..9446831) FT /rpt_family="Alu" FT repeat_region complement(9445151..9445459) FT /rpt_family="Alu" FT repeat_region complement(9444350..9444428) FT /rpt_family="Mariner" FT repeat_region complement(9443540..9443848) FT /rpt_family="Alu" FT repeat_region complement(9442859..9443043) FT /rpt_family="L1" FT repeat_region complement(9442134..9442428) FT /rpt_family="L2" FT repeat_region complement(9441820..9442133) FT /rpt_family="Alu" FT repeat_region complement(9441279..9441819) FT /rpt_family="L2" FT repeat_region complement(9440732..9441278) FT /rpt_family="L1" FT repeat_region complement(9440256..9440526) FT /rpt_family="Alu" FT repeat_region complement(9439931..9440145) FT /rpt_family="MaLR" FT repeat_region complement(9439467..9439930) FT /rpt_family="L1" FT repeat_region complement(9438279..9439452) FT /rpt_family="L1" FT repeat_region complement(9438012..9438234) FT /rpt_family="L1" FT repeat_region complement(9437679..9438011) FT /rpt_family="MaLR" FT repeat_region complement(9437304..9437678) FT /rpt_family="L1" FT repeat_region complement(9436834..9437303) FT /rpt_family="L1" FT repeat_region complement(9435330..9436833) FT /rpt_family="L1" FT repeat_region complement(9435027..9435291) FT /rpt_family="L1" FT repeat_region complement(9434834..9434942) FT /rpt_family="L1" FT repeat_region complement(9434566..9434825) FT /rpt_family="ERV1" FT repeat_region complement(9434279..9434565) FT /rpt_family="Alu" FT repeat_region complement(9433853..9434278) FT /rpt_family="ERV1" FT repeat_region complement(9433508..9433732) FT /rpt_family="MER1_type" FT repeat_region complement(9433319..9433383) FT /rpt_family="ERV1" FT repeat_region complement(9432912..9433208) FT /rpt_family="Alu" FT repeat_region complement(9430589..9430669) FT /rpt_family="(TAGA)n" FT repeat_region complement(9427431..9427752) FT /rpt_family="L1" FT repeat_region complement(9427206..9427332) FT /rpt_family="MIR" FT repeat_region complement(9424920..9426967) FT /rpt_family="L1" FT repeat_region complement(9423643..9423670) FT /rpt_family="(T)n" FT repeat_region complement(9423286..9423595) FT /rpt_family="Alu" FT repeat_region complement(9422550..9422735) FT /rpt_family="L1" FT repeat_region complement(9422240..9422488) FT /rpt_family="L1" FT repeat_region complement(9421981..9422239) FT /rpt_family="Alu" FT repeat_region complement(9420164..9421980) FT /rpt_family="L1" FT repeat_region complement(9419887..9420152) FT /rpt_family="MaLR" FT repeat_region complement(9417935..9419691) FT /rpt_family="L1" FT repeat_region complement(9417443..9417934) FT /rpt_family="MER2_type" FT repeat_region complement(9417288..9417380) FT /rpt_family="L1" FT repeat_region complement(9416655..9417231) FT /rpt_family="L1" FT repeat_region complement(9416406..9416571) FT /rpt_family="Alu" FT repeat_region complement(9415170..9416405) FT /rpt_family="L1" FT repeat_region complement(9415020..9415168) FT /rpt_family="L1" FT repeat_region complement(9413744..9415016) FT /rpt_family="L1" FT repeat_region complement(9413507..9413701) FT /rpt_family="L1" FT repeat_region complement(9412986..9413505) FT /rpt_family="L1" FT repeat_region complement(9412929..9412979) FT /rpt_family="5S" FT repeat_region complement(9411973..9412573) FT /rpt_family="L1" FT repeat_region complement(9411883..9411975) FT /rpt_family="L1" FT repeat_region complement(9410893..9411881) FT /rpt_family="ERV1" FT repeat_region complement(9409893..9410881) FT /rpt_family="L1" FT repeat_region complement(9409490..9409899) FT /rpt_family="L1" FT repeat_region complement(9409367..9409473) FT /rpt_family="L1" FT repeat_region complement(9408867..9409363) FT /rpt_family="L1" FT repeat_region complement(9408559..9408866) FT /rpt_family="Alu" FT repeat_region complement(9407250..9408558) FT /rpt_family="L1" FT repeat_region complement(9406236..9406748) FT /rpt_family="MaLR" FT repeat_region complement(9405464..9405765) FT /rpt_family="Alu" FT repeat_region complement(9405329..9405372) FT /rpt_family="GA-rich" FT repeat_region complement(9404984..9405021) FT /rpt_family="(TG)n" FT repeat_region complement(9404695..9404970) FT /rpt_family="MER1_type" FT repeat_region complement(9404673..9404694) FT /rpt_family="(CA)n" FT repeat_region complement(9404521..9404672) FT /rpt_family="MER1_type" FT repeat_region complement(9403521..9403642) FT /rpt_family="L2" FT repeat_region complement(9402830..9403389) FT /rpt_family="L1" FT repeat_region complement(9402468..9402643) FT /rpt_family="MIR" FT repeat_region complement(9402102..9402136) FT /rpt_family="AT_rich" FT repeat_region complement(9401783..9401865) FT /rpt_family="MIR" FT repeat_region complement(9400125..9400280) FT /rpt_family="MIR" FT repeat_region complement(9400032..9400119) FT /rpt_family="MER1_type" FT repeat_region complement(9399467..9399715) FT /rpt_family="MaLR" FT repeat_region complement(9398866..9399440) FT /rpt_family="L1" FT repeat_region complement(9398365..9398888) FT /rpt_family="L1" FT repeat_region complement(9398075..9398364) FT /rpt_family="L1" FT repeat_region complement(9397896..9398074) FT /rpt_family="Alu" FT repeat_region complement(9397864..9397895) FT /rpt_family="(T)n" FT repeat_region complement(9397819..9397863) FT /rpt_family="Alu" FT repeat_region complement(9397296..9397794) FT /rpt_family="L1" FT repeat_region complement(9397005..9397295) FT /rpt_family="MaLR" FT repeat_region complement(9396671..9397004) FT /rpt_family="MaLR" FT repeat_region complement(9396329..9396670) FT /rpt_family="MaLR" FT repeat_region complement(9396052..9396256) FT /rpt_family="L2" FT repeat_region complement(9394960..9395639) FT /rpt_family="ERV1" FT repeat_region complement(9394572..9394780) FT /rpt_family="MER1_type" FT repeat_region complement(9394214..9394238) FT /rpt_family="AT_rich" FT repeat_region complement(9393168..9393468) FT /rpt_family="Alu" FT repeat_region complement(9392191..9392246) FT /rpt_family="MIR" FT repeat_region complement(9392062..9392093) FT /rpt_family="AT_rich" FT repeat_region complement(9391954..9392023) FT /rpt_family="(CATATA)n" FT repeat_region complement(9391302..9391594) FT /rpt_family="Alu" FT repeat_region complement(9388685..9388719) FT /rpt_family="AT_rich" FT repeat_region complement(9386455..9387051) FT /rpt_family="ERV1" FT repeat_region complement(9384027..9384093) FT /rpt_family="CR1" FT repeat_region complement(9383399..9383493) FT /rpt_family="L1" FT repeat_region complement(9382401..9382482) FT /rpt_family="(TTA)n" FT repeat_region complement(9381241..9381305) FT /rpt_family="L2" FT repeat_region complement(9380152..9380493) FT /rpt_family="Alu" FT repeat_region complement(9378124..9378200) FT /rpt_family="L2" FT repeat_region complement(9374304..9375472) FT /rpt_family="Mariner" FT repeat_region complement(9374258..9374303) FT /rpt_family="Alu" FT repeat_region complement(9373390..9374231) FT /rpt_family="L1" FT repeat_region complement(9373086..9373374) FT /rpt_family="Alu" FT repeat_region complement(9371731..9373058) FT /rpt_family="L1" FT repeat_region complement(9370857..9370919) FT /rpt_family="MER1_type" FT unsure complement(9324643..9370784) FT /note="Unresolved tandem repeat." FT repeat_region complement(9369127..9369194) FT /rpt_family="(TG)n" FT repeat_region complement(9366482..9366564) FT /rpt_family="(TG)n" FT repeat_region complement(9364381..9364449) FT /rpt_family="(TG)n" FT repeat_region complement(9361736..9361818) FT /rpt_family="(TG)n" FT repeat_region complement(9359636..9359703) FT /rpt_family="(TG)n" FT repeat_region complement(9356991..9357073) FT /rpt_family="(TG)n" FT repeat_region complement(9354891..9354958) FT /rpt_family="(TG)n" FT repeat_region complement(9352246..9352328) FT /rpt_family="(TG)n" FT repeat_region complement(9350146..9350213) FT /rpt_family="(TG)n" FT repeat_region complement(9347501..9347583) FT /rpt_family="(TG)n" FT repeat_region complement(9345401..9345468) FT /rpt_family="(TG)n" FT repeat_region complement(9342756..9342838) FT /rpt_family="(TG)n" FT repeat_region complement(9340656..9340723) FT /rpt_family="(TG)n" FT repeat_region complement(9338011..9338093) FT /rpt_family="(TG)n" FT repeat_region complement(9335909..9335978) FT /rpt_family="(TG)n" FT repeat_region complement(9333264..9333346) FT /rpt_family="(TG)n" FT repeat_region complement(9331163..9331231) FT /rpt_family="(TG)n" FT repeat_region complement(9328518..9328600) FT /rpt_family="(TG)n" FT repeat_region complement(9326418..9326485) FT /rpt_family="(TG)n" FT misc_feature 9570816..9571345 FT /note="match to EST BF112014 (NID:g10941627)" FT misc_feature 9570858..9571010 FT /note="similar to Homo sapiens EST AI680786 (NID:g4890968) FT tx34g11.x1" FT misc_feature 9570871..9571248 FT /note="match to EST BG997292 (NID:g14401362)" FT repeat_region 9571248..9571424 FT /rpt_family="L1" FT repeat_region 9571433..9572583 FT /rpt_family="L1" FT misc_feature 9571859..9571864 FT /note="similar to Homo sapiens EST AA985625 (NID:g3167014) FT oq84e04.s1" FT /note="similar to Homo sapiens EST AA099839 (NID:g1646002) FT zl79g06.s1" FT repeat_region 9572584..9572893 FT /rpt_family="Alu" FT misc_feature 9572861..9572881 FT /note="similar to Homo sapiens EST AI680786 (NID:g4890968) FT tx34g11.x1" FT repeat_region 9572864..9572894 FT /rpt_family="(A)n" FT misc_feature 9572866..9572894 FT /note="similar to Homo sapiens EST BG765782 FT (NID:g14076435)" FT repeat_region 9572894..9573544 FT /rpt_family="L1" FT misc_feature 9573337..9573341 FT /note="similar to Homo sapiens EST T04942 (NID:g316100)" FT misc_feature 9573450..9573455 FT /note="similar to Homo sapiens EST BI006132 FT (NID:g14410203)" FT repeat_region 9573548..9573724 FT /rpt_family="L1" FT misc_feature 9573772..9573777 FT /note="similar to Homo sapiens EST AA995769 (NID:g3182258) FT os25f08.s1" FT repeat_region 9573816..9574400 FT /rpt_family="L1" FT repeat_region 9574390..9574628 FT /rpt_family="L1" FT repeat_region 9574636..9575108 FT /rpt_family="L1" FT misc_feature 9575082..9575100 FT /note="similar to Homo sapiens EST BG117417 FT (NID:g12610923)" FT repeat_region 9575083..9575109 FT /rpt_family="(TA)n" FT repeat_region 9575109..9575423 FT /rpt_family="Alu" FT repeat_region 9575278..9575306 FT /rpt_family="(T)n" FT repeat_region 9575424..9575899 FT /rpt_family="L1" FT repeat_region 9575909..9575982 FT /rpt_family="Alu" FT repeat_region 9575984..9576147 FT /rpt_family="Alu" FT repeat_region 9576152..9578340 FT /rpt_family="L1" FT misc_feature 9576189..9576194 FT /note="match to EST BF887966 (NID:g12279212)" FT repeat_region 9577164..9577188 FT /rpt_family="(T)n" FT repeat_region 9577655..9577677 FT /rpt_family="AT_rich" FT repeat_region 9578341..9578693 FT /rpt_family="MaLR" FT repeat_region 9580266..9580623 FT /rpt_family="MaLR" FT repeat_region 9580624..9580878 FT /rpt_family="L1" FT repeat_region 9580875..9580898 FT /rpt_family="(TTTA)n" FT repeat_region 9580879..9581044 FT /rpt_family="Alu" FT repeat_region 9581045..9582096 FT /rpt_family="L1" FT repeat_region 9581091..9581120 FT /rpt_family="(T)n" FT repeat_region 9582096..9582126 FT /rpt_family="(TTG)n" FT repeat_region 9582097..9582403 FT /rpt_family="Alu" FT misc_feature 9582357..9582361 FT /note="match to EST BF058195 (NID:g10812091)" FT repeat_region 9582404..9582816 FT /rpt_family="L1" FT misc_feature 9582517..9582788 FT /note="similar to Homo sapiens EST BI041098 FT (NID:g14447724)" FT misc_feature 9582665..9583042 FT /note="similar to Homo sapiens EST H93525 (NID:g1099853) FT yv08e12.r1" FT misc_feature 9582810..9583064 FT /note="similar to Homo sapiens EST BI041098 FT (NID:g14447724)" FT misc_feature 9582820..9583302 FT /note="match to EST BF058195 (NID:g10812091)" FT repeat_region 9583034..9583251 FT /rpt_family="MER1_type" FT repeat_region 9583366..9583640 FT /rpt_family="Alu" FT misc_feature 9583375..9583792 FT /note="similar to Homo sapiens EST AL040273 (NID:g5409230)" FT misc_feature 9583586..9583833 FT /note="similar to Homo sapiens EST BF364271 FT (NID:g11326296)" FT misc_feature 9583593..9584347 FT /note="similar to Homo sapiens EST BG546518 FT (NID:g13545183)" FT repeat_region 9583843..9583944 FT /rpt_family="MaLR" FT repeat_region 9583943..9584239 FT /rpt_family="MaLR" FT misc_feature 9584078..9584520 FT /note="similar to Homo sapiens EST BE838721 FT (NID:g10271099)" FT misc_feature 9584247..9584683 FT /note="similar to Homo sapiens EST W84503 (NID:g1395923) FT zh53a03.r1" FT misc_feature 9584394..9584993 FT /note="similar to Homo sapiens EST AW752830 (NID:g7667762)" FT misc_feature 9584431..9584435 FT /note="similar to Homo sapiens EST M78624 (NID:g272940)" FT misc_feature 9584757..9584974 FT /note="similar to Homo sapiens EST AW851075 (NID:g7946592)" FT misc_feature 9584876..9584969 FT /note="similar to Homo sapiens EST BF844506 FT (NID:g12200177)" FT repeat_region 9584971..9585006 FT /rpt_family="(T)n" FT misc_feature 9584983..9585208 FT /note="similar to Homo sapiens EST BF844506 FT (NID:g12200177)" FT misc_feature 9584984..9585199 FT /note="similar to Homo sapiens EST AL527579 FT (NID:g12791072)" FT /note="similar to Homo sapiens EST AA719608 (NID:g2732707) FT zh37a06.s1" FT misc_feature 9584989..9585183 FT /note="similar to Homo sapiens EST AW851075 (NID:g7946592)" FT misc_feature 9585003..9585410 FT /note="similar to Homo sapiens EST AI690704 (NID:g4902006) FT tx88c09.x1" FT misc_feature 9585007..9585199 FT /note="similar to Homo sapiens EST R63843 (NID:g835722) FT yi36h04.s1" FT misc_feature 9585007..9585200 FT /note="similar to Homo sapiens EST AA187992 (NID:g1774183) FT zp67h05.s1" FT misc_feature 9585010..9585042 FT /note="similar to Homo sapiens EST AW752830 (NID:g7667762)" FT misc_feature 9585072..9585118 FT /note="similar to Homo sapiens EST BG703374 FT (NID:g13975641)" FT repeat_region 9585208..9585508 FT /rpt_family="Alu" FT misc_feature 9585422..9585427 FT /note="similar to Homo sapiens EST BE838721 FT (NID:g10271099)" FT repeat_region 9585487..9585538 FT /rpt_family="(CAAAA)n" FT misc_feature 9585534..9585778 FT /note="match to EST BG389835 (NID:g13283271)" FT /note="similar to Homo sapiens EST AA782385 (NID:g2841716) FT ac24h09.s1" FT misc_feature 9585537..9585725 FT /note="similar to Homo sapiens EST R63843 (NID:g835722) FT yi36h04.s1" FT misc_feature 9585537..9585778 FT /note="similar to Homo sapiens EST AL527579 FT (NID:g12791072)" FT /note="similar to Homo sapiens EST AA719608 (NID:g2732707) FT zh37a06.s1" FT misc_feature 9585560..9585564 FT /note="similar to Homo sapiens EST AI982519 (NID:g5809738) FT wu04b10.x1" FT repeat_region 9585778..9586007 FT /rpt_family="MER1_type" FT misc_feature 9585865..9586194 FT /note="similar to Homo sapiens EST BF737475 FT (NID:g12064151)" FT repeat_region 9586177..9586545 FT /rpt_family="L1" FT repeat_region 9586546..9586718 FT /rpt_family="Alu" FT misc_feature 9586547..9586551 FT /note="match to EST M78436 (NID:g272752)" FT repeat_region 9586722..9586925 FT /rpt_family="L1" FT repeat_region 9586926..9587077 FT /rpt_family="L2" FT repeat_region 9587078..9587374 FT /rpt_family="Alu" FT repeat_region 9587375..9587477 FT /rpt_family="L2" FT repeat_region 9587519..9587578 FT /rpt_family="MIR" FT repeat_region 9587634..9587935 FT /rpt_family="Alu" FT repeat_region 9587977..9588250 FT /rpt_family="L2" FT misc_feature 9588190..9588555 FT /note="match to EST M78436 (NID:g272752)" FT misc_feature 9588402..9588836 FT /note="match to EST BE091235 (NID:g8481687)" FT misc_feature 9588505..9588762 FT /note="similar to Homo sapiens EST T04942 (NID:g316100)" FT misc_feature 9588729..9589059 FT /note="match to EST AA663866 (NID:g2617857) ae70d06.s1" FT repeat_region 9589008..9589307 FT /rpt_family="Alu" FT repeat_region 9589427..9589642 FT /rpt_family="Alu" FT misc_feature 9589483..9589958 FT /note="similar to Homo sapiens EST BG703374 FT (NID:g13975641)" FT misc_feature 9589699..9590108 FT /note="similar to Homo sapiens EST M78624 (NID:g272940)" FT repeat_region 9589840..9589898 FT /rpt_family="MER1_type" FT repeat_region 9589900..9590069 FT /rpt_family="L1" FT repeat_region 9590045..9590327 FT /rpt_family="L1" FT repeat_region 9590332..9590631 FT /rpt_family="Alu" FT misc_feature 9590603..9590612 FT /note="similar to Homo sapiens EST AI939345 (NID:g5678215) FT qb61g05.x5" FT misc_feature 9590637..9590650 FT /note="similar to Homo sapiens EST BF343849 FT (NID:g11291048)" FT repeat_region 9590647..9590772 FT /rpt_family="MER1_type" FT repeat_region 9590860..9591041 FT /rpt_family="MER1_type" FT repeat_region 9591135..9591438 FT /rpt_family="Alu" FT misc_feature 9591136..9591185 FT /note="similar to Homo sapiens EST BF844506 FT (NID:g12200177)" FT repeat_region 9591412..9591438 FT /rpt_family="(A)n" FT repeat_region 9591726..9592176 FT /rpt_family="MaLR" FT repeat_region 9592177..9593149 FT /rpt_family="L1" FT repeat_region 9593178..9593305 FT /rpt_family="ERV1" FT repeat_region 9593306..9593465 FT /rpt_family="Alu" FT repeat_region 9593612..9594177 FT /rpt_family="MaLR" FT repeat_region 9594189..9594499 FT /rpt_family="Alu" FT misc_feature 9594240..9594322 FT /note="similar to Homo sapiens EST BF844506 FT (NID:g12200177)" FT misc_feature 9594289..9594343 FT /note="similar to Homo sapiens EST BF841709 FT (NID:g12194960)" FT misc_feature 9594386..9594398 FT /note="similar to Homo sapiens EST AL527293 FT (NID:g12790786)" FT repeat_region 9594473..9594496 FT /rpt_family="AT_rich" FT repeat_region 9594550..9594696 FT /rpt_family="MIR" FT repeat_region 9594870..9595153 FT /rpt_family="Alu" FT misc_feature 9595026..9595115 FT /note="similar to Homo sapiens EST BF841709 FT (NID:g12194960)" FT misc_feature 9595080..9595148 FT /note="similar to Homo sapiens EST AL527293 FT (NID:g12790786)" FT repeat_region 9595221..9595382 FT /rpt_family="MIR" FT repeat_region 9595434..9595735 FT /rpt_family="Alu" FT misc_feature 9595716..9595737 FT /note="similar to Homo sapiens EST BI909919 FT (NID:g16173217)" FT repeat_region 9595716..9595737 FT /rpt_family="AT_rich" FT repeat_region 9595891..9596146 FT /rpt_family="MaLR" FT repeat_region 9596147..9596439 FT /rpt_family="Alu" FT misc_feature 9596300..9596744 FT /note="similar to Homo sapiens EST BF841705 FT (NID:g12194953)" FT misc_feature 9596351..9596763 FT /note="similar to Homo sapiens EST BE540259 (NID:g9768904)" FT misc_feature 9596390..9596758 FT /note="similar to Homo sapiens EST BF841709 FT (NID:g12194960)" FT repeat_region 9596440..9596509 FT /rpt_family="MaLR" FT misc_feature 9596603..9596925 FT /note="similar to Homo sapiens EST BG697914 FT (NID:g13964655)" FT misc_feature 9596770..9596928 FT /note="similar to Homo sapiens EST BE540259 (NID:g9768904)" FT misc_feature 9596773..9596973 FT /note="similar to Homo sapiens EST AA873521 (NID:g2969643) FT oh70c06.s1" FT misc_feature 9596773..9596978 FT /note="similar to Homo sapiens EST AA936758 (NID:g3094792) FT oi50c03.s1" FT repeat_region 9596858..9596996 FT /rpt_family="L2" FT repeat_region 9597024..9598104 FT /rpt_family="ERVK" FT repeat_region 9598114..9598805 FT /rpt_family="L2" FT repeat_region 9598806..9599109 FT /rpt_family="Alu" FT repeat_region 9598975..9598995 FT /rpt_family="(T)n" FT misc_feature 9598984..9599323 FT /note="match to EST AA524609 (NID:g2265537) nh34c11.s1" FT repeat_region 9599110..9599348 FT /rpt_family="L2" FT misc_feature 9599177..9599297 FT /note="similar to Homo sapiens EST AW938567 (NID:g8114011)" FT misc_feature 9599316..9599500 FT /note="similar to Homo sapiens EST AW938567 (NID:g8114011)" FT misc_feature 9599327..9599751 FT /note="similar to Homo sapiens EST AA033945 (NID:g1505820) FT zi05h10.r1" FT misc_feature 9599339..9599544 FT /note="match to EST AA524609 (NID:g2265537) nh34c11.s1" FT misc_feature 9599410..9599786 FT /note="similar to Homo sapiens EST BE086763 (NID:g8477156)" FT misc_feature 9599635..9599853 FT /note="similar to Homo sapiens EST AW075801 (NID:g6030799) FT xa85f07.x1" FT misc_feature 9599637..9599638 FT /note="similar to Homo sapiens EST AW938567 (NID:g8114011)" FT misc_feature 9599667..9599754 FT /note="similar to Homo sapiens EST AA873521 (NID:g2969643) FT oh70c06.s1" FT misc_feature 9599695..9600149 FT /note="match to EST AI655064 (NID:g4739043) wb53f10.x1" FT repeat_region 9599983..9600156 FT /rpt_family="CR1" FT misc_feature 9600152..9600164 FT /note="similar to Homo sapiens EST AW026780 (NID:g5880310) FT wv44h08.x1" FT repeat_region 9600179..9600305 FT /rpt_family="Alu" FT repeat_region 9600306..9600608 FT /rpt_family="Alu" FT misc_feature 9600444..9600568 FT /note="similar to Homo sapiens EST BF844506 FT (NID:g12200177)" FT repeat_region 9600587..9600608 FT /rpt_family="(A)n" FT repeat_region 9600649..9600766 FT /rpt_family="MER1_type" FT repeat_region 9600767..9601142 FT /rpt_family="MaLR" FT misc_feature 9600827..9600871 FT /note="similar to Homo sapiens EST AA873521 (NID:g2969643) FT oh70c06.s1" FT repeat_region 9601143..9601255 FT /rpt_family="MER1_type" FT repeat_region 9601263..9601314 FT /rpt_family="polypurine" FT repeat_region 9601310..9601445 FT /rpt_family="CR1" FT repeat_region 9601453..9602010 FT /rpt_family="ERV1" FT repeat_region 9602836..9602857 FT /rpt_family="(A)n" FT misc_feature 9605951..9606042 FT /note="similar to Homo sapiens EST AV745437 FT (NID:g10864884)" FT misc_feature 9607187..9607264 FT /note="match to EST AA374146 (NID:g2026486)" FT repeat_region 9608006..9608318 FT /rpt_family="ERV1" FT repeat_region 9608319..9608867 FT /rpt_family="ERV1" FT repeat_region 9609123..9609414 FT /rpt_family="Alu" FT misc_feature 9609527..9609875 FT /note="similar to Homo sapiens EST BF955485 FT (NID:g12372747)" FT misc_feature 9609650..9610205 FT /note="similar to Homo sapiens EST BI006132 FT (NID:g14410203)" FT misc_feature 9609808..9609993 FT /note="match to EST AA374146 (NID:g2026486)" FT misc_feature 9610122..9610123 FT /note="similar to Homo sapiens EST BF955485 FT (NID:g12372747)" FT repeat_region 9610161..9610273 FT /rpt_family="MaLR" FT repeat_region 9610401..9610760 FT /rpt_family="ERV1" FT repeat_region 9610761..9610826 FT /rpt_family="ERV1" FT repeat_region 9610828..9611098 FT /rpt_family="Alu" FT repeat_region 9611099..9611175 FT /rpt_family="Alu" FT repeat_region 9611177..9611219 FT /rpt_family="ERV1" FT repeat_region 9611220..9611383 FT /rpt_family="MaLR" FT repeat_region 9611388..9611418 FT /rpt_family="(CA)n" FT misc_feature 9611410..9611678 FT /note="similar to Homo sapiens EST AW854309 (NID:g7950002)" FT repeat_region 9611700..9611953 FT /rpt_family="Alu" FT misc_feature 9611744..9611784 FT /note="similar to Homo sapiens EST BF678613 FT (NID:g11952508)" FT misc_feature 9611991..9612416 FT /note="similar to Homo sapiens EST N67632 (NID:g1219757) FT yz94f10.s1" FT misc_feature 9612076..9612108 FT /note="similar to Homo sapiens EST W01109 (NID:g1273311) FT yz94f10.r1" FT repeat_region 9612148..9612405 FT /rpt_family="MaLR" FT misc_feature 9612182..9612416 FT /note="similar to Homo sapiens EST W01109 (NID:g1273311) FT yz94f10.r1" FT misc_feature 9612417..9612543 FT /note="similar to Homo sapiens EST W01109 (NID:g1273311) FT yz94f10.r1" FT repeat_region 9612529..9612829 FT /rpt_family="Alu" FT misc_feature 9612675..9612676 FT /note="similar to Homo sapiens EST W01109 (NID:g1273311) FT yz94f10.r1" FT misc_feature 9612757..9612968 FT /note="similar to Homo sapiens EST AW854309 (NID:g7950002)" FT misc_feature 9612798..9612817 FT /note="similar to Homo sapiens EST AI367730 (NID:g4137475) FT qv75h11.x1" FT repeat_region 9612800..9612831 FT /rpt_family="(A)n" FT repeat_region 9612832..9613131 FT /rpt_family="ERVL" FT misc_feature 9613357..9613555 FT /note="similar to Homo sapiens EST BF853902 FT (NID:g12241646)" FT misc_feature 9613410..9613569 FT /note="similar to Homo sapiens EST R08961 (NID:g760884) FT yf21c05.r1" FT misc_feature 9613595..9613690 FT /note="similar to Homo sapiens EST R08961 (NID:g760884) FT yf21c05.r1" FT repeat_region 9613647..9613836 FT /rpt_family="Alu" FT misc_feature 9613936..9614158 FT /note="similar to Homo sapiens EST R08854 (NID:g760777) FT yf21c05.s1" FT misc_feature 9614030..9614382 FT /note="similar to Homo sapiens EST AA083558 (NID:g1625618) FT zn09f09.s1" FT misc_feature 9614163..9614726 FT /note="similar to Homo sapiens EST BE813146 FT (NID:g10245380)" FT misc_feature 9614317..9614318 FT /note="similar to Homo sapiens EST R08854 (NID:g760777) FT yf21c05.s1" FT misc_feature 9614398..9614748 FT /note="match to EST Z39772 (NID:g565567)" FT misc_feature 9614399..9614714 FT /note="similar to Homo sapiens EST AA707673 (NID:g2717591) FT zj29g07.s1" FT misc_feature 9614451..9614829 FT /note="match to EST BF477315 (NID:g11548142)" FT misc_feature 9614611..9614921 FT /note="similar to Homo sapiens EST AA083557 (NID:g1625617) FT zn09f09.r1" FT repeat_region 9614619..9614774 FT /rpt_family="MaLR" FT repeat_region 9614989..9615138 FT /rpt_family="MIR" FT misc_feature 9615258..9615582 FT /note="match to EST AW611794 (NID:g7316980) hg81a03.x1" FT repeat_region 9615523..9615637 FT /rpt_family="MER1_type" FT repeat_region 9615654..9616003 FT /rpt_family="L1" FT repeat_region 9616004..9616298 FT /rpt_family="Alu" FT misc_feature 9616092..9616094 FT /note="match to EST AW611794 (NID:g7316980) hg81a03.x1" FT repeat_region 9616468..9616776 FT /rpt_family="Alu" FT misc_feature 9616695..9616936 FT /note="match to EST AW850175 (NID:g7945692)" FT repeat_region 9616936..9616985 FT /rpt_family="(TTTA)n" FT repeat_region 9616958..9617268 FT /rpt_family="Alu" FT misc_feature 9617055..9617570 FT /note="similar to Homo sapiens EST BF678613 FT (NID:g11952508)" FT misc_feature 9617263..9617677 FT /note="match to EST AW118957 (NID:g6087541) xd98h09.x1" FT misc_feature 9617264..9617607 FT /note="similar to Homo sapiens EST BF816183 FT (NID:g12151533)" FT misc_feature 9617269..9617726 FT /note="similar to Homo sapiens EST BF476390 FT (NID:g11547217)" FT repeat_region 9617277..9617407 FT /rpt_family="L1" FT repeat_region 9617585..9617607 FT /rpt_family="(CTG)n" FT misc_feature 9617609..9617924 FT /note="similar to Homo sapiens EST BM150907 FT (NID:g17173840)" FT misc_feature 9617628..9617834 FT /note="similar to Homo sapiens EST BF816183 FT (NID:g12151533)" FT misc_feature 9617657..9617840 FT /note="similar to Homo sapiens EST AA936758 (NID:g3094792) FT oi50c03.s1" FT misc_feature 9617668..9617670 FT /note="similar to Homo sapiens EST BF678613 FT (NID:g11952508)" FT misc_feature 9617678..9617702 FT /note="match to EST AA374146 (NID:g2026486)" FT misc_feature 9617737..9618039 FT /note="similar to Homo sapiens EST BE839817 FT (NID:g10272195)" FT repeat_region 9617926..9618203 FT /rpt_family="Alu" FT repeat_region 9618230..9618543 FT /rpt_family="Alu" FT repeat_region 9618612..9618843 FT /rpt_family="L2" FT repeat_region 9618843..9619126 FT /rpt_family="L2" FT repeat_region 9619233..9619458 FT /rpt_family="L1" FT repeat_region 9620947..9621256 FT /rpt_family="Alu" FT repeat_region 9625811..9625854 FT /rpt_family="MIR" FT repeat_region 9625855..9626160 FT /rpt_family="Alu" FT repeat_region 9626161..9626232 FT /rpt_family="MIR" FT repeat_region 9626493..9626821 FT /rpt_family="Alu" FT repeat_region 9627165..9627476 FT /rpt_family="Alu" FT repeat_region 9627544..9627820 FT /rpt_family="Alu" FT repeat_region 9628080..9628362 FT /rpt_family="Alu" FT repeat_region 9628387..9628604 FT /rpt_family="MER1_type" FT repeat_region 9629966..9630151 FT /rpt_family="Alu" FT repeat_region 9630152..9630191 FT /rpt_family="(TA)n" FT repeat_region 9630192..9630307 FT /rpt_family="Alu" FT repeat_region 9633242..9633542 FT /rpt_family="Alu" FT repeat_region 9633586..9633857 FT /rpt_family="MaLR" FT repeat_region 9633858..9634175 FT /rpt_family="Alu" FT repeat_region 9634176..9634442 FT /rpt_family="MaLR" FT repeat_region 9634732..9635034 FT /rpt_family="Alu" FT repeat_region 9635040..9635424 FT /rpt_family="MaLR" FT repeat_region 9635425..9635736 FT /rpt_family="Alu" FT repeat_region 9635737..9635829 FT /rpt_family="MaLR" FT repeat_region 9635842..9635930 FT /rpt_family="Alu" FT repeat_region 9635961..9636249 FT /rpt_family="Alu" FT repeat_region 9636430..9636475 FT /rpt_family="MaLR" FT repeat_region 9636574..9636654 FT /rpt_family="MaLR" FT repeat_region 9637543..9637645 FT /rpt_family="Tip100" FT repeat_region 9637793..9638013 FT /rpt_family="MER1_type" FT repeat_region 9638405..9638709 FT /rpt_family="Alu" FT repeat_region 9638724..9639026 FT /rpt_family="Alu" FT repeat_region 9639027..9639315 FT /rpt_family="Alu" FT repeat_region 9639327..9639592 FT /rpt_family="L1" FT repeat_region 9639673..9639820 FT /rpt_family="MER1_type" FT repeat_region 9640018..9640082 FT /rpt_family="MaLR" FT repeat_region 9640083..9640384 FT /rpt_family="Alu" FT repeat_region 9640385..9640557 FT /rpt_family="MaLR" FT repeat_region 9640597..9640943 FT /rpt_family="ERV1" FT repeat_region 9643876..9644727 FT /rpt_family="ERV1" FT repeat_region 9644730..9645392 FT /rpt_family="ERV1" FT repeat_region 9645394..9645604 FT /rpt_family="ERV1" FT repeat_region 9645605..9645981 FT /rpt_family="ERV1" FT repeat_region 9645983..9646377 FT /rpt_family="ERV1" FT repeat_region 9646388..9646683 FT /rpt_family="Alu" FT repeat_region 9646696..9646881 FT /rpt_family="MaLR" FT repeat_region 9648062..9648195 FT /rpt_family="L2" FT repeat_region 9648218..9648535 FT /rpt_family="Alu" FT repeat_region 9648819..9648851 FT /rpt_family="(CAT)n" FT repeat_region 9648964..9649086 FT /rpt_family="MaLR" FT repeat_region 9649361..9649394 FT /rpt_family="L2" FT repeat_region 9649636..9649940 FT /rpt_family="Alu" FT repeat_region 9650086..9650139 FT /rpt_family="(GA)n" FT repeat_region 9650447..9650742 FT /rpt_family="Alu" FT repeat_region 9650808..9651022 FT /rpt_family="ERVL" FT repeat_region 9651512..9651568 FT /rpt_family="MER1_type" FT repeat_region 9651569..9651701 FT /rpt_family="Alu" FT repeat_region 9651702..9651746 FT /rpt_family="MER1_type" FT repeat_region 9651826..9651899 FT /rpt_family="ERV1" FT repeat_region 9652261..9652390 FT /rpt_family="Alu" FT repeat_region 9652563..9652615 FT /rpt_family="(TTTA)n" FT repeat_region 9652616..9652761 FT /rpt_family="Alu" FT repeat_region 9652762..9653070 FT /rpt_family="Alu" FT repeat_region 9653071..9653216 FT /rpt_family="Alu" FT repeat_region 9653953..9654072 FT /rpt_family="MER1_type" FT repeat_region 9654073..9654374 FT /rpt_family="Alu" FT repeat_region 9654375..9654408 FT /rpt_family="MER1_type" FT repeat_region 9654479..9654574 FT /rpt_family="MER1_type" FT repeat_region 9654994..9655060 FT /rpt_family="MaLR" FT repeat_region 9655061..9655361 FT /rpt_family="Alu" FT repeat_region 9655362..9655697 FT /rpt_family="MaLR" FT repeat_region 9655762..9656049 FT /rpt_family="Alu" FT repeat_region 9656264..9656586 FT /rpt_family="Alu" FT repeat_region 9656773..9656816 FT /rpt_family="Alu" FT repeat_region 9656862..9657307 FT /rpt_family="ERV1" FT repeat_region 9657308..9657537 FT /rpt_family="Alu" FT repeat_region 9657538..9657774 FT /rpt_family="ERV1" FT repeat_region 9657828..9657990 FT /rpt_family="Alu" FT repeat_region 9658542..9658862 FT /rpt_family="Alu" FT repeat_region 9658888..9658931 FT /rpt_family="(CA)n" FT repeat_region 9659052..9659363 FT /rpt_family="Alu" FT repeat_region 9659580..9660597 FT /rpt_family="ERVK" FT repeat_region 9668149..9669174 FT /rpt_family="ERVK" FT repeat_region 9669489..9669646 FT /rpt_family="MIR" FT repeat_region 9669676..9669767 FT /rpt_family="L2" FT repeat_region 9670118..9670324 FT /rpt_family="MIR" FT repeat_region 9670350..9670650 FT /rpt_family="Alu" FT repeat_region 9670738..9671246 FT /rpt_family="MER1_type" FT repeat_region 9671263..9671411 FT /rpt_family="MER1_type" FT repeat_region 9671412..9671710 FT /rpt_family="Alu" FT repeat_region 9671711..9671778 FT /rpt_family="MER1_type" FT repeat_region 9671928..9672117 FT /rpt_family="MIR" FT repeat_region 9672984..9673015 FT /rpt_family="(TC)n" FT repeat_region 9674056..9674175 FT /rpt_family="(TA)n" FT repeat_region 9674299..9674330 FT /rpt_family="(TG)n" FT repeat_region 9674904..9675260 FT /rpt_family="Alu" FT repeat_region 9675315..9675507 FT /rpt_family="L2" FT repeat_region 9675633..9675848 FT /rpt_family="ERVL" FT repeat_region 9676489..9676635 FT /rpt_family="MIR" FT repeat_region 9676646..9676912 FT /rpt_family="Alu" FT repeat_region 9676925..9677005 FT /rpt_family="Alu" FT repeat_region 9677188..9677442 FT /rpt_family="MaLR" FT repeat_region 9677573..9677727 FT /rpt_family="Alu" FT repeat_region 9677833..9677975 FT /rpt_family="Alu" FT repeat_region 9677976..9678272 FT /rpt_family="Alu" FT repeat_region 9678273..9678383 FT /rpt_family="Alu" FT repeat_region 9678390..9678463 FT /rpt_family="L1" FT repeat_region 9678475..9678536 FT /rpt_family="L1" FT repeat_region 9678614..9678773 FT /rpt_family="Tc2" FT repeat_region 9679651..9679939 FT /rpt_family="Alu" FT repeat_region 9679943..9679992 FT /rpt_family="(TAAAA)n" FT repeat_region 9680131..9680447 FT /rpt_family="Alu" FT repeat_region 9680517..9680603 FT /rpt_family="MIR" FT repeat_region 9680624..9680872 FT /rpt_family="Alu" FT repeat_region 9680873..9681310 FT /rpt_family="ERV1" FT repeat_region 9681311..9682596 FT /rpt_family="ERV1" FT repeat_region 9682597..9682632 FT /rpt_family="ERV1" FT repeat_region 9682633..9682690 FT /rpt_family="Alu" FT repeat_region 9682824..9683059 FT /rpt_family="L1" FT repeat_region 9683060..9683082 FT /rpt_family="(TC)n" FT repeat_region 9683083..9683295 FT /rpt_family="L1" FT repeat_region 9683296..9683595 FT /rpt_family="Alu" FT repeat_region 9683596..9683665 FT /rpt_family="L1" FT repeat_region 9683693..9683811 FT /rpt_family="Alu" FT repeat_region 9683812..9684108 FT /rpt_family="Alu" FT repeat_region 9684109..9684296 FT /rpt_family="Alu" FT repeat_region 9684399..9684709 FT /rpt_family="Alu" FT repeat_region 9685281..9685584 FT /rpt_family="Alu" FT repeat_region 9685784..9686073 FT /rpt_family="Alu" FT repeat_region 9686236..9686408 FT /rpt_family="MIR" FT repeat_region 9687495..9687778 FT /rpt_family="Alu" FT repeat_region 9688562..9688678 FT /rpt_family="Tip100" FT repeat_region 9688680..9688956 FT /rpt_family="Alu" FT repeat_region 9688963..9689266 FT /rpt_family="Alu" FT repeat_region 9689293..9689536 FT /rpt_family="MaLR" FT repeat_region 9689537..9689834 FT /rpt_family="Alu" FT repeat_region 9689835..9689988 FT /rpt_family="MaLR" FT repeat_region 9690009..9690278 FT /rpt_family="Alu" FT repeat_region 9690952..9691239 FT /rpt_family="Alu" FT repeat_region 9691334..9691637 FT /rpt_family="Alu" FT repeat_region 9692682..9692863 FT /rpt_family="L2" FT repeat_region 9693265..9693363 FT /rpt_family="(CCCCG)n" FT repeat_region 9693615..9693757 FT /rpt_family="MIR" FT repeat_region 9693758..9694240 FT /rpt_family="L2" FT repeat_region 9695682..9695978 FT /rpt_family="Alu" FT repeat_region 9696912..9697192 FT /rpt_family="ERVL" FT repeat_region 9697243..9697553 FT /rpt_family="Alu" FT repeat_region 9698052..9698174 FT /rpt_family="Alu" FT repeat_region 9698465..9698618 FT /rpt_family="MIR" FT repeat_region 9698696..9698828 FT /rpt_family="Alu" FT repeat_region 9698829..9699127 FT /rpt_family="Alu" FT repeat_region 9699128..9699282 FT /rpt_family="Alu" FT repeat_region 9699343..9699535 FT /rpt_family="L1" FT repeat_region 9701351..9701417 FT /rpt_family="MIR" FT repeat_region 9701576..9701707 FT /rpt_family="MIR" FT repeat_region 9701984..9702297 FT /rpt_family="Alu" FT repeat_region 9702412..9702711 FT /rpt_family="Alu" FT repeat_region 9702763..9702869 FT /rpt_family="Alu" FT repeat_region 9702948..9703119 FT /rpt_family="MER1_type" FT repeat_region 9703248..9703553 FT /rpt_family="Alu" FT repeat_region 9703554..9703778 FT /rpt_family="Alu" FT repeat_region 9703842..9703866 FT /rpt_family="(TG)n" FT repeat_region 9703873..9704180 FT /rpt_family="Alu" FT repeat_region 9705884..9706083 FT /rpt_family="MER1_type" FT repeat_region 9707323..9707390 FT /rpt_family="Mariner" FT repeat_region 9707937..9708046 FT /rpt_family="Alu" FT repeat_region 9708048..9708366 FT /rpt_family="Alu" FT repeat_region 9708446..9708728 FT /rpt_family="Alu" FT repeat_region 9709955..9710250 FT /rpt_family="Alu" FT repeat_region 9710358..9710454 FT /rpt_family="MIR" FT repeat_region 9710634..9710927 FT /rpt_family="Alu" FT repeat_region 9711759..9711826 FT /rpt_family="L2" FT repeat_region 9712024..9712232 FT /rpt_family="MER1_type" FT repeat_region 9713550..9713858 FT /rpt_family="Alu" FT repeat_region 9713869..9714180 FT /rpt_family="Alu" FT repeat_region 9714185..9714206 FT /rpt_family="AT_rich" FT repeat_region 9714249..9714568 FT /rpt_family="MER1_type" FT repeat_region 9715008..9715216 FT /rpt_family="MaLR" FT repeat_region 9715217..9715516 FT /rpt_family="Alu" FT repeat_region 9715517..9715670 FT /rpt_family="MaLR" FT repeat_region 9715706..9715856 FT /rpt_family="MIR" FT repeat_region 9715970..9716125 FT /rpt_family="MER1_type" FT repeat_region 9716194..9716792 FT /rpt_family="L1" FT repeat_region 9717234..9717540 FT /rpt_family="Alu" FT repeat_region 9718215..9718391 FT /rpt_family="MaLR" FT repeat_region 9718392..9718663 FT /rpt_family="Alu" FT repeat_region 9718666..9718972 FT /rpt_family="Alu" FT repeat_region 9718973..9718990 FT /rpt_family="MaLR" FT repeat_region 9718992..9719057 FT /rpt_family="(TA)n" FT repeat_region 9719060..9719314 FT /rpt_family="MaLR" FT repeat_region 9719347..9719479 FT /rpt_family="MIR" FT repeat_region 9719624..9719756 FT /rpt_family="Alu" FT repeat_region 9720090..9720465 FT /rpt_family="Tip100" FT repeat_region 9720466..9720780 FT /rpt_family="Alu" FT repeat_region 9720781..9721307 FT /rpt_family="Tip100" FT repeat_region 9721308..9721603 FT /rpt_family="Alu" FT repeat_region 9721604..9721724 FT /rpt_family="Tip100" FT misc_feature 9721722..9721875 FT /note="match to EST BE062468 (NID:g8407118)" FT misc_feature 9721882..9722148 FT /note="similar to Homo sapiens EST BF878566 FT (NID:g12268696)" FT repeat_region 9721894..9722011 FT /rpt_family="L2" FT repeat_region 9722636..9722922 FT /rpt_family="Alu" FT repeat_region 9722924..9723146 FT /rpt_family="MER2_type" FT repeat_region 9723359..9723673 FT /rpt_family="Alu" FT repeat_region 9723644..9723675 FT /rpt_family="(A)n" FT repeat_region 9725197..9725493 FT /rpt_family="Alu" FT repeat_region 9725494..9725630 FT /rpt_family="ERV1" FT misc_feature 9725509..9725514 FT /note="similar to Homo sapiens EST BF171573 FT (NID:g13437787)" FT repeat_region 9725631..9725914 FT /rpt_family="MaLR" FT repeat_region 9725915..9726228 FT /rpt_family="Alu" FT misc_feature 9725915..9725929 FT /note="similar to Homo sapiens EST AW451324 (NID:g6992100)" FT misc_feature 9725915..9725927 FT /note="similar to Homo sapiens EST AI740932 (NID:g5109220) FT wg18e02.x1" FT /note="similar to Homo sapiens EST AI371376 (NID:g4150129) FT qo83f11.x1" FT repeat_region 9726229..9726425 FT /rpt_family="MaLR" FT repeat_region 9726426..9726619 FT /rpt_family="ERV1" FT repeat_region 9726620..9726645 FT /rpt_family="AT_rich" FT misc_feature 9726620..9726634 FT /note="match to EST AW016261 (NID:g5865018)" FT repeat_region 9726906..9727126 FT /rpt_family="ERV1" FT repeat_region 9727127..9727410 FT /rpt_family="Alu" FT misc_feature 9727276..9727360 FT /note="similar to Homo sapiens EST AI301661 (NID:g3961007) FT qn46c09.x1" FT repeat_region 9727411..9727781 FT /rpt_family="ERV1" FT repeat_region 9727894..9728196 FT /rpt_family="ERV1" FT repeat_region 9728201..9728510 FT /rpt_family="Alu" FT repeat_region 9728513..9728707 FT /rpt_family="MaLR" FT repeat_region 9728736..9728753 FT /rpt_family="L2" FT repeat_region 9728742..9728781 FT /rpt_family="(T)n" FT repeat_region 9728754..9729062 FT /rpt_family="Alu" FT repeat_region 9729063..9729200 FT /rpt_family="L2" FT repeat_region 9729461..9729614 FT /rpt_family="L1" FT repeat_region 9729639..9729695 FT /rpt_family="L1" FT repeat_region 9729696..9729991 FT /rpt_family="Alu" FT repeat_region 9729962..9730011 FT /rpt_family="(GGAA)n" FT repeat_region 9729992..9730003 FT /rpt_family="L1" FT repeat_region 9730012..9730132 FT /rpt_family="(GGAA)n" FT repeat_region 9730149..9730676 FT /rpt_family="L1" FT repeat_region 9730202..9730231 FT /rpt_family="(CA)n" FT repeat_region 9730694..9731007 FT /rpt_family="Alu" FT repeat_region 9730698..9730723 FT /rpt_family="(TTG)n" FT misc_feature 9731014..9731386 FT /note="similar to Homo sapiens EST BF869346 FT (NID:g12259476)" FT repeat_region 9731337..9731464 FT /rpt_family="MaLR" FT misc_feature 9731636..9731828 FT /note="similar to Homo sapiens EST BF171573 FT (NID:g13437787)" FT misc_feature 9731696..9732158 FT /note="similar to Homo sapiens EST BG000915 FT (NID:g12438717)" FT repeat_region 9732154..9732562 FT /rpt_family="ERV1" FT misc_feature 9732790..9733457 FT /note="similar to Homo sapiens EST BF525815 FT (NID:g11613176)" FT repeat_region 9733016..9733390 FT /rpt_family="MaLR" FT repeat_region 9733401..9734315 FT /rpt_family="ERVK" FT repeat_region 9734316..9734797 FT /rpt_family="ERV1" FT misc_feature 9734498..9734978 FT /note="similar to Homo sapiens EST W22601 (NID:g1299434)" FT misc_feature 9734995..9735204 FT /note="match to EST AI359560 (NID:g4111181) qy32b03.x1" FT /note="match to EST AL557347 (NID:g12900864)" FT misc_feature 9734995..9735198 FT /note="match to EST BI548376 (NID:g15435688)" FT misc_feature 9734996..9735197 FT /note="match to EST AI632503 (NID:g4683833) wb09g12.x1" FT misc_feature 9735001..9735198 FT /note="similar to Homo sapiens EST BI818520 FT (NID:g15929552)" FT repeat_region 9735637..9735947 FT /rpt_family="Alu" FT repeat_region 9735918..9735973 FT /rpt_family="(A)n" FT repeat_region 9736356..9736494 FT /rpt_family="Alu" FT repeat_region 9736525..9736689 FT /rpt_family="Alu" FT repeat_region 9736700..9737003 FT /rpt_family="Alu" FT repeat_region 9736979..9737003 FT /rpt_family="(A)n" FT misc_feature 9737540..9737703 FT /note="match to EST AL543462 (NID:g12875940)" FT misc_feature 9737540..9737951 FT /note="similar to Homo sapiens EST N57483 (NID:g1201373) FT yy54b04.s1" FT misc_feature 9737540..9737679 FT /note="similar to Homo sapiens EST BI818520 FT (NID:g15929552)" FT misc_feature 9737548..9737644 FT /note="match to EST BI548376 (NID:g15435688)" FT misc_feature 9737645..9737690 FT /note="match to EST AL579401 (NID:g12944410)" FT repeat_region 9737711..9737773 FT /rpt_family="ERVL" FT repeat_region 9737763..9737794 FT /rpt_family="(TA)n" FT repeat_region 9737830..9737867 FT /rpt_family="ERVL" FT repeat_region 9737871..9737897 FT /rpt_family="(TG)n" FT repeat_region 9737943..9737953 FT /rpt_family="L2" FT repeat_region 9737954..9738251 FT /rpt_family="Alu" FT repeat_region 9738252..9738366 FT /rpt_family="L2" FT repeat_region 9738549..9738601 FT /rpt_family="MIR" FT misc_feature 9738704..9738999 FT /note="similar to Homo sapiens EST T05580 (NID:g316730)" FT misc_feature 9738788..9739116 FT /note="similar to Homo sapiens EST AA663293 (NID:g2617284) FT ab81b10.s1" FT repeat_region 9739970..9740023 FT /rpt_family="(TA)n" FT misc_feature 9740023..9740038 FT /note="match to EST AW016260 (NID:g5865017)" FT repeat_region 9740023..9740268 FT /rpt_family="Alu" FT misc_feature 9740023..9740043 FT /note="similar to Homo sapiens EST BG029979 FT (NID:g12419076)" FT repeat_region 9740276..9740636 FT /rpt_family="L1" FT repeat_region 9740637..9740927 FT /rpt_family="Alu" FT repeat_region 9740928..9740991 FT /rpt_family="L1" FT misc_feature 9741232..9741313 FT /note="match to EST AL579401 (NID:g12944410)" FT misc_feature 9741241..9741316 FT /note="similar to Homo sapiens EST BI818520 FT (NID:g15929552)" FT misc_feature 9741245..9741356 FT /note="similar to Homo sapiens EST BG183450 FT (NID:g13705137)" FT misc_feature 9741779..9741785 FT /note="match to EST BG202850 (NID:g13724537)" FT repeat_region 9741816..9742036 FT /rpt_family="CT-rich" FT repeat_region 9742032..9742336 FT /rpt_family="Alu" FT misc_feature 9742056..9742556 FT /note="similar to Homo sapiens EST BG059874 FT (NID:g12527791)" FT repeat_region 9742717..9742763 FT /rpt_family="AT_rich" FT repeat_region 9742759..9742881 FT /rpt_family="Alu" FT repeat_region 9743228..9743539 FT /rpt_family="Alu" FT repeat_region 9743512..9743538 FT /rpt_family="(TAAA)n" FT misc_feature 9743901..9744068 FT /note="match to EST AI632503 (NID:g4683833) wb09g12.x1" FT misc_feature 9743901..9744070 FT /note="similar to Homo sapiens EST BG183450 FT (NID:g13705137)" FT misc_feature 9743901..9743990 FT /note="match to EST AL579401 (NID:g12944410)" FT repeat_region 9744788..9745150 FT /rpt_family="MaLR" FT misc_feature 9744871..9744943 FT /note="similar to Homo sapiens EST BF525815 FT (NID:g11613176)" FT misc_feature 9745134..9745544 FT /note="similar to Homo sapiens EST BF750963 FT (NID:g12077639)" FT repeat_region 9745556..9745834 FT /rpt_family="MaLR" FT repeat_region 9745857..9745990 FT /rpt_family="MIR" FT repeat_region 9746139..9746286 FT /rpt_family="L2" FT repeat_region 9747331..9747678 FT /rpt_family="(TG)n" FT repeat_region 9747562..9747628 FT /rpt_family="ERV1" FT repeat_region 9747742..9747809 FT /rpt_family="ERV1" FT repeat_region 9747748..9748016 FT /rpt_family="(TG)n" FT repeat_region 9747951..9747998 FT /rpt_family="ERV1" FT repeat_region 9749126..9749185 FT /rpt_family="MIR" FT misc_feature 9749337..9749715 FT /note="match to EST BF740918 (NID:g12067503)" FT repeat_region 9749495..9749665 FT /rpt_family="L2" FT repeat_region 9749757..9749959 FT /rpt_family="L2" FT repeat_region 9749960..9749998 FT /rpt_family="Mariner" FT repeat_region 9749999..9750299 FT /rpt_family="Alu" FT repeat_region 9750159..9750181 FT /rpt_family="AT_rich" FT repeat_region 9750300..9750353 FT /rpt_family="Mariner" FT repeat_region 9750354..9750433 FT /rpt_family="L2" FT repeat_region 9750456..9750574 FT /rpt_family="MER1_type" FT repeat_region 9750762..9751046 FT /rpt_family="Alu" FT repeat_region 9751038..9751092 FT /rpt_family="(TC)n" FT repeat_region 9751094..9751135 FT /rpt_family="(TA)n" FT repeat_region 9751177..9751198 FT /rpt_family="L1" FT repeat_region 9751199..9751520 FT /rpt_family="Alu" FT repeat_region 9751483..9751527 FT /rpt_family="(CAAAA)n" FT repeat_region 9751521..9751621 FT /rpt_family="L1" FT repeat_region 9751622..9751912 FT /rpt_family="Alu" FT repeat_region 9751913..9752164 FT /rpt_family="L1" FT misc_feature 9752169..9752593 FT /note="similar to Homo sapiens EST AW194462 (NID:g6473281) FT xm09a10.x1" FT repeat_region 9752185..9752214 FT /rpt_family="AT_rich" FT misc_feature 9752201..9752576 FT /note="similar to Homo sapiens EST AI830758 (NID:g5451514) FT wj10h10.x1" FT misc_feature 9752607 FT /note="similar to Homo sapiens EST AW194462 (NID:g6473281) FT xm09a10.x1" FT repeat_region 9752677..9753689 FT /rpt_family="ERVK" FT repeat_region 9753488..9753517 FT /rpt_family="AT_rich" FT misc_feature 9753630..9754041 FT /note="similar to Homo sapiens EST BE165573 (NID:g8628294)" FT repeat_region 9753959..9753996 FT /rpt_family="(ATG)n" FT repeat_region 9754016..9754230 FT /rpt_family="MIR" FT misc_feature 9754087..9754393 FT /note="similar to Homo sapiens EST AW451324 (NID:g6992100)" FT misc_feature 9754092..9754597 FT /note="similar to Homo sapiens EST BG029979 FT (NID:g12419076)" FT misc_feature 9754140..9754144 FT /note="similar to Homo sapiens EST AV713699 FT (NID:g10795216)" FT repeat_region 9754625..9754934 FT /rpt_family="Alu" FT misc_feature 9754634..9754903 FT /note="similar to Homo sapiens EST BI462381 FT (NID:g15253037)" FT misc_feature 9754762..9754767 FT /note="similar to Homo sapiens EST BG204873 FT (NID:g13726560)" FT misc_feature 9754917..9755251 FT /note="similar to Homo sapiens EST BI462381 FT (NID:g15253037)" FT misc_feature 9755054..9755563 FT /note="similar to Homo sapiens EST BF899781 FT (NID:g12291240)" FT repeat_region 9755322..9755432 FT /rpt_family="L2" FT repeat_region 9755498..9755801 FT /rpt_family="Alu" FT misc_feature 9755736..9755737 FT /note="similar to Homo sapiens EST BI462381 FT (NID:g15253037)" FT misc_feature 9755753..9756070 FT /note="similar to Homo sapiens EST AI301661 (NID:g3961007) FT qn46c09.x1" FT misc_feature 9755788..9756270 FT /note="similar to Homo sapiens EST BG203046 FT (NID:g13724733)" FT misc_feature 9755872..9756345 FT /note="similar to Homo sapiens EST AW391026 (NID:g6895685)" FT misc_feature 9756185..9756409 FT /note="similar to Homo sapiens EST AV713699 FT (NID:g10795216)" FT misc_feature 9756187..9756189 FT /note="similar to Homo sapiens EST BG219116 FT (NID:g13745137)" FT misc_feature 9756203..9756475 FT /note="similar to Homo sapiens EST AI371376 (NID:g4150129) FT qo83f11.x1" FT misc_feature 9756290..9756654 FT /note="similar to Homo sapiens EST BE709727 FT (NID:g10097992)" FT misc_feature 9756325..9756710 FT /note="similar to Homo sapiens EST H78008 (NID:g1056097) FT yu82h12.r1" FT misc_feature 9756466..9756862 FT /note="similar to Homo sapiens EST AV713699 FT (NID:g10795216)" FT misc_feature 9756473..9757236 FT /note="similar to Homo sapiens EST BG218617 FT (NID:g13744638)" FT misc_feature 9756500..9756504 FT /note="similar to Homo sapiens EST BF062963 FT (NID:g10821873)" FT misc_feature 9756530..9756577 FT /note="similar to Homo sapiens EST BG117417 FT (NID:g12610923)" FT misc_feature 9756542..9756883 FT /note="similar to Homo sapiens EST BF799078 FT (NID:g12128067)" FT misc_feature 9756543..9756915 FT /note="similar to Homo sapiens EST AA938905 (NID:g3098818) FT op74e11.s1" FT misc_feature 9756544..9757307 FT /note="similar to Homo sapiens EST BG204873 FT (NID:g13726560)" FT misc_feature 9756547..9757113 FT /note="similar to Homo sapiens EST BG219116 FT (NID:g13745137)" FT misc_feature 9756550..9757109 FT /note="match to EST BG202850 (NID:g13724537)" FT misc_feature 9756585..9757115 FT /note="similar to Homo sapiens EST AA719797 (NID:g2732896) FT zg54c07.s1" FT misc_feature 9756723..9756892 FT /note="similar to Homo sapiens EST BG117417 FT (NID:g12610923)" FT misc_feature 9756809..9757088 FT /note="similar to Homo sapiens EST BE674166 FT (NID:g10034707)" FT misc_feature 9756832..9756889 FT /note="similar to Homo sapiens EST AW009208 (NID:g5857986) FT ws79a10.x1" FT misc_feature 9756876..9757221 FT /note="similar to Homo sapiens EST AI367730 (NID:g4137475) FT qv75h11.x1" FT misc_feature 9756938..9757502 FT /note="similar to Homo sapiens EST BI495655 FT (NID:g15334999)" FT misc_feature 9756955..9757055 FT /note="similar to Homo sapiens EST AU144503 FT (NID:g11006024)" FT misc_feature 9756971..9757502 FT /note="similar to Homo sapiens EST BI495654 FT (NID:g15334998)" FT misc_feature 9756973..9757266 FT /note="similar to Homo sapiens EST AW009208 (NID:g5857986) FT ws79a10.x1" FT misc_feature 9756974..9757055 FT /note="similar to Homo sapiens EST BF062963 FT (NID:g10821873)" FT misc_feature 9756993..9757055 FT /note="similar to Homo sapiens EST BE067731 (NID:g8412381)" FT misc_feature 9757007..9757012 FT /note="similar to Homo sapiens EST AW391026 (NID:g6895685)" FT misc_feature 9757073 FT /note="similar to Homo sapiens EST H78008 (NID:g1056097) FT yu82h12.r1" FT misc_feature 9757080..9757424 FT /note="similar to Homo sapiens EST AU144503 FT (NID:g11006024)" FT misc_feature 9757080..9757392 FT /note="similar to Homo sapiens EST BF062963 FT (NID:g10821873)" FT misc_feature 9757080..9757266 FT /note="similar to Homo sapiens EST BE067731 (NID:g8412381)" FT misc_feature 9757205..9757414 FT /note="similar to Homo sapiens EST BG188134 FT (NID:g13709821)" FT misc_feature 9757329..9757412 FT /note="similar to Homo sapiens EST AW009208 (NID:g5857986) FT ws79a10.x1" FT misc_feature 9757408..9757924 FT /note="similar to Homo sapiens EST AI809176 (NID:g5395742) FT wh75c03.x1" FT repeat_region 9757521..9760007 FT /rpt_family="SATR2" FT misc_feature 9758172..9758174 FT /note="similar to Homo sapiens EST BG218617 FT (NID:g13744638)" FT repeat_region 9759921..9761556 FT /rpt_family="SATR1" FT repeat_region 9761669..9761742 FT /rpt_family="AT_rich" FT repeat_region 9761793..9761982 FT /rpt_family="(TTA)n" FT misc_feature 9765086..9765256 FT /note="similar to Homo sapiens EST BG991565 FT (NID:g14395635)" FT repeat_region 9765320..9765345 FT /rpt_family="(TC)n" FT repeat_region 9765345..9765388 FT /rpt_family="(CA)n" FT repeat_region 9765398..9765480 FT /rpt_family="MER1_type" FT repeat_region 9765482..9765795 FT /rpt_family="MaLR" FT misc_feature 9765725..9766152 FT /note="similar to Homo sapiens EST AA490028 (NID:g2220903) FT ab02c01.s1" FT repeat_region 9765796..9766000 FT /rpt_family="MER1_type" FT misc_feature 9766303..9766628 FT /note="similar to Homo sapiens EST BG008561 FT (NID:g12453881)" FT repeat_region 9767040..9767488 FT /rpt_family="MaLR" FT repeat_region 9767551..9767870 FT /rpt_family="L1" FT repeat_region 9767871..9768139 FT /rpt_family="Alu" FT repeat_region 9768140..9768261 FT /rpt_family="L1" FT repeat_region 9768255..9768311 FT /rpt_family="A-rich" FT repeat_region 9768442..9768810 FT /rpt_family="L2" FT repeat_region 9768846..9769475 FT /rpt_family="ERV1" FT repeat_region 9769477..9770186 FT /rpt_family="L2" FT repeat_region 9770247..9770533 FT /rpt_family="Alu" FT misc_feature 9770296..9770301 FT /note="similar to Homo sapiens EST AI809176 (NID:g5395742) FT wh75c03.x1" FT repeat_region 9770605..9770625 FT /rpt_family="(A)n" FT misc_feature 9770684..9771098 FT /note="similar to Homo sapiens EST AI018561 (NID:g3233080) FT ou30g09.x1" FT misc_feature 9770741..9771144 FT /note="similar to Homo sapiens EST AW805223 (NID:g7857093)" FT misc_feature 9770785..9771355 FT /note="similar to Homo sapiens EST AW363266 (NID:g6867916)" FT repeat_region 9770960..9771541 FT /rpt_family="MaLR" FT repeat_region 9771547..9772737 FT /rpt_family="L1" FT repeat_region 9772386..9772448 FT /rpt_family="CT-rich" FT misc_feature 9772436..9772934 FT /note="similar to Homo sapiens EST AI740932 (NID:g5109220) FT wg18e02.x1" FT misc_feature 9772561..9772985 FT /note="similar to Homo sapiens EST BF985263 FT (NID:g12391583)" FT misc_feature 9772659..9773123 FT /note="similar to Homo sapiens EST BE002778 (NID:g8263011)" FT misc_feature 9772772..9773123 FT /note="similar to EST BM048593 (NID:g16777860)" FT misc_feature 9772777..9772993 FT /note="match to EST R49124 (NID:g820193) yg69e06.s1" FT misc_feature 9772781..9772993 FT /note="match to EST AW016260 (NID:g5865017)" FT misc_feature 9772782..9772993 FT /note="match to EST AW016261 (NID:g5865018)" FT misc_feature 9772926..9773271 FT /note="similar to Homo sapiens EST AI281683 (NID:g3919916) FT qu79d04.x1" FT misc_feature 9772977..9773541 FT /note="match to EST AW753099 (NID:g7668031)" FT repeat_region 9772999..9773134 FT /rpt_family="MaLR" FT misc_feature 9773012..9773279 FT /note="similar to Homo sapiens EST R74253 (NID:g848623) FT yi57a02.r1" FT misc_feature 9773112..9773894 FT /note="similar to Homo sapiens EST BG109605 FT (NID:g12603111)" FT misc_feature 9773386..9774184 FT /note="match to EST BG677067 (NID:g13908464)" FT repeat_region 9773467..9773928 FT /rpt_family="L2" FT repeat_region 9774268..9774331 FT /rpt_family="MaLR" FT repeat_region 9774433..9774462 FT /rpt_family="(TTTTTA)n" FT repeat_region 9774447..9774562 FT /rpt_family="L1" FT misc_feature 9774455..9774935 FT /note="match to EST T78411 (NID:g696920) yd80g01.s1" FT misc_feature 9774462..9774779 FT /note="similar to Homo sapiens EST H65393 (NID:g1024133) FT yr67h10.s1" FT repeat_region 9774563..9774681 FT /rpt_family="MIR" FT misc_feature 9774907..9775330 FT /note="match to EST H65392 (NID:g1024132) yr67h10.r1" FT misc_feature 9775225 FT /note="similar to Homo sapiens EST AA745010 (NID:g2783774) FT nv43c11.r1" FT repeat_region 9775617..9775915 FT /rpt_family="Alu" FT repeat_region 9775981..9776115 FT /rpt_family="L2" FT repeat_region 9776185..9776286 FT /rpt_family="MaLR" FT repeat_region 9776321..9776454 FT /rpt_family="CT-rich" FT misc_feature 9776426..9776816 FT /note="similar to Homo sapiens EST BF826330 FT (NID:g12169468)" FT misc_feature 9776472..9776862 FT /note="similar to Homo sapiens EST T81778 (NID:g704785) FT yd30c05.s1" FT misc_feature 9776555..9777125 FT /note="match to EST AI912640 (NID:g5632495) we12a05.x1" FT repeat_region 9776733..9777042 FT /rpt_family="MaLR" FT misc_feature 9776831..9776832 FT /note="similar to Homo sapiens EST BF826330 FT (NID:g12169468)" FT repeat_region 9777075..9777477 FT /rpt_family="MaLR" FT misc_feature 9777167 FT /note="match to EST AI912640 (NID:g5632495) we12a05.x1" FT misc_feature 9777459..9777860 FT /note="similar to Homo sapiens EST R87947 (NID:g946760) FT yo47e12.r1" FT repeat_region 9777561..9777717 FT /rpt_family="MaLR" FT misc_feature 9777574..9777869 FT /note="match to EST T84443 (NID:g712731) yd32c06.r1" FT misc_feature 9777809..9778406 FT /note="match to EST AW451618 (NID:g6992394)" FT misc_feature 9777809..9778172 FT /note="match to EST BF512348 (NID:g11597527)" FT misc_feature 9777972..9778236 FT /note="match to EST N45423 (NID:g1186589) yv28b02.r1" FT misc_feature 9778277..9778516 FT /note="match to EST AW837913 (NID:g7931887)" FT misc_feature 9778308..9778625 FT /note="match to EST AA101955 (NID:g1645552) zl77e12.r1" FT misc_feature 9778316..9778625 FT /note="similar to Homo sapiens EST AW837985 (NID:g7931959)" FT repeat_region 9778502..9778610 FT /rpt_family="L2" FT misc_feature 9778626..9778712 FT /note="similar to Homo sapiens EST AW837985 (NID:g7931959)" FT misc_feature 9778626..9778667 FT /note="match to EST AA101955 (NID:g1645552) zl77e12.r1" FT repeat_region 9778670..9778843 FT /rpt_family="L2" FT misc_feature 9778819 FT /note="match to EST AA101955 (NID:g1645552) zl77e12.r1" FT repeat_region 9778918..9778988 FT /rpt_family="Alu" FT misc_feature 9778918..9779482 FT /note="similar to Homo sapiens EST BE439552 (NID:g9439034)" FT misc_feature 9778937..9779263 FT /note="similar to Homo sapiens EST R24509 (NID:g779397) FT yh36b08.s1" FT misc_feature 9778939..9779309 FT /note="similar to Homo sapiens EST F27930 (NID:g4813556)" FT misc_feature 9778960..9779240 FT /note="similar to Homo sapiens EST AA745010 (NID:g2783774) FT nv43c11.r1" FT repeat_region 9779261..9779531 FT /rpt_family="L2" FT misc_feature 9779493..9779663 FT /note="similar to Homo sapiens EST T07568 (NID:g318717)" FT repeat_region 9779662..9779740 FT /rpt_family="(TTCC)n" FT misc_feature 9779694..9779731 FT /note="similar to Homo sapiens EST T07568 (NID:g318717)" FT repeat_region 9779755..9780042 FT /rpt_family="Alu" FT misc_feature 9780099..9780455 FT /note="match to EST AV660437 (NID:g9881451)" FT repeat_region 9780427..9780461 FT /rpt_family="T-rich" FT repeat_region 9780432..9780689 FT /rpt_family="Alu" FT misc_feature 9780466..9780924 FT /note="similar to Homo sapiens EST AA632196 (NID:g2555610) FT np63d06.s1" FT repeat_region 9780713..9780797 FT /rpt_family="MIR" FT repeat_region 9781041..9781336 FT /rpt_family="Alu" FT repeat_region 9781363..9781396 FT /rpt_family="(TC)n" FT repeat_region 9781380..9781471 FT /rpt_family="L2" FT misc_feature 9781491..9781636 FT /note="match to EST R49124 (NID:g820193) yg69e06.s1" FT repeat_region 9781526..9781592 FT /rpt_family="L2" FT repeat_region 9781967..9782114 FT /rpt_family="L2" FT repeat_region 9782796..9782906 FT /rpt_family="MIR" FT misc_feature 9783036..9784960 FT /note="CpG_island (%GC=65.6, o/e=0.70, #CpGs=155)" FT misc_feature 9783512..9784144 FT /note="similar to Mus musculus EST BB643871 FT (NID:g15402158)" FT misc_feature 9783623..9784387 FT /note="match to EST BE746231 (NID:g10160223)" FT misc_feature 9783710..9784335 FT /note="similar to Mus musculus EST BB622272 FT (NID:g15397693)" FT misc_feature 9784242..9784900 FT /note="similar to Mus musculus EST BB642329 FT (NID:g15401861)" FT misc_feature 9784865..9785358 FT /note="match to EST AI148329 (NID:g3676011) qb83a01.x1" FT misc_feature 9786479..9786816 FT /note="match to EST AI770006 (NID:g5236515) wh66d08.x1" FT repeat_region 9786501..9786591 FT /rpt_family="L2" FT repeat_region 9786760..9786867 FT /rpt_family="MIR" FT repeat_region 9786916..9787037 FT /rpt_family="MER103" FT misc_feature 9787081..9787415 FT /note="similar to Homo sapiens EST AW071489 (NID:g6026487) FT xa44f08.x1" FT repeat_region 9787308..9787743 FT /rpt_family="L2" FT repeat_region 9787419..9787456 FT /rpt_family="(TACTG)n" FT repeat_region 9787811..9787996 FT /rpt_family="MIR" FT misc_feature 9788104..9788520 FT /note="match to EST AA720836 (NID:g2736971) nw08c06.s1" FT repeat_region 9788222..9788384 FT /rpt_family="MIR" FT repeat_region 9788386..9788583 FT /rpt_family="MER1_type" FT repeat_region 9788646..9788751 FT /rpt_family="MIR" FT repeat_region 9788832..9788963 FT /rpt_family="MaLR" FT repeat_region 9788989..9789197 FT /rpt_family="L1" FT repeat_region 9789188..9789804 FT /rpt_family="L1" FT repeat_region 9789805..9790114 FT /rpt_family="Alu" FT repeat_region 9790115..9790154 FT /rpt_family="L1" FT repeat_region 9790327..9790754 FT /rpt_family="L1" FT repeat_region 9790637..9790726 FT /rpt_family="(TA)n" FT repeat_region 9791563..9791749 FT /rpt_family="MIR" FT repeat_region 9791847..9792007 FT /rpt_family="CR1" FT repeat_region 9792094..9792265 FT /rpt_family="MER1_type" FT repeat_region 9792277..9792444 FT /rpt_family="MER1_type" FT repeat_region 9792830..9792868 FT /rpt_family="L2" FT repeat_region 9792929..9793209 FT /rpt_family="MaLR" FT repeat_region 9793210..9793561 FT /rpt_family="MaLR" FT repeat_region 9793784..9793810 FT /rpt_family="(T)n" FT repeat_region 9793968..9793995 FT /rpt_family="AT_rich" FT misc_feature 9794091..9794094 FT /note="similar to Homo sapiens EST BE439552 (NID:g9439034)" FT repeat_region 9794495..9794515 FT /rpt_family="AT_rich" FT repeat_region 9794837..9795006 FT /rpt_family="MIR" FT repeat_region 9795554..9795669 FT /rpt_family="MIR" FT repeat_region 9795774..9796075 FT /rpt_family="Alu" FT repeat_region 9796080..9796228 FT /rpt_family="MIR" FT repeat_region 9796556..9796631 FT /rpt_family="MIR" FT repeat_region 9796632..9796653 FT /rpt_family="(T)n" FT misc_feature 9796695..9797520 FT /note="match to EST BM005995 (NID:g16520349)" FT repeat_region 9796934..9797011 FT /rpt_family="MIR" FT repeat_region 9797507..9797737 FT /rpt_family="MIR" FT repeat_region 9798061..9798189 FT /rpt_family="MIR" FT repeat_region 9798200..9798653 FT /rpt_family="MaLR" FT repeat_region 9798690..9798775 FT /rpt_family="L2" FT repeat_region 9798855..9799040 FT /rpt_family="MIR" FT repeat_region 9799419..9799497 FT /rpt_family="Alu" FT misc_feature 9799473..9799952 FT /note="match to EST AA677020 (NID:g2657542) zj59a11.s1" FT repeat_region 9799542..9799629 FT /rpt_family="L2" FT misc_feature 9799697..9800035 FT /note="match to EST AA487825 (NID:g2215256) ab12g09.r1" FT misc_feature 9799929..9800293 FT /note="match to EST BF431255 (NID:g11443369)" FT repeat_region 9800265..9800359 FT /rpt_family="MIR" FT misc_feature 9800284..9800761 FT /note="match to EST H66737 (NID:g1025477) yr83f12.r1" FT repeat_region 9800371..9800581 FT /rpt_family="MIR" FT misc_feature 9800371..9800865 FT /note="match to EST BI762013 (NID:g15753591)" FT misc_feature 9800522..9800855 FT /note="similar to Homo sapiens EST AA610385 (NID:g2458813) FT np93a09.s1" FT repeat_region 9800845..9801224 FT /rpt_family="MaLR" FT misc_feature 9800880 FT /note="similar to Homo sapiens EST AA610385 (NID:g2458813) FT np93a09.s1" FT repeat_region 9800910..9800937 FT /rpt_family="(TTTA)n" FT repeat_region 9801732..9801857 FT /rpt_family="ERVL" FT repeat_region 9801874..9802226 FT /rpt_family="MaLR" FT repeat_region 9802227..9802531 FT /rpt_family="MER2_type" FT repeat_region 9802532..9802565 FT /rpt_family="MaLR" FT repeat_region 9803040..9803288 FT /rpt_family="ERVL" FT repeat_region 9804167..9804202 FT /rpt_family="(T)n" FT repeat_region 9804173..9804487 FT /rpt_family="Alu" FT repeat_region 9804684..9804897 FT /rpt_family="MIR" FT repeat_region 9804994..9805164 FT /rpt_family="MIR" FT repeat_region 9805283..9805455 FT /rpt_family="L2" FT repeat_region 9805463..9805562 FT /rpt_family="L2" FT repeat_region 9806441..9806617 FT /rpt_family="ERVL" FT misc_feature 9806635..9807158 FT /note="match to EST BI012928 (NID:g14416999)" FT repeat_region 9806729..9807048 FT /rpt_family="MaLR" FT repeat_region 9807051..9807302 FT /rpt_family="Alu" FT misc_feature 9807330..9807762 FT /note="match to EST N68595 (NID:g1224756) za31a10.s1" FT repeat_region 9807418..9807663 FT /rpt_family="MIR" FT repeat_region 9807749..9808233 FT /rpt_family="ERVK" FT repeat_region 9808838..9809219 FT /rpt_family="L2" FT repeat_region 9810123..9810166 FT /rpt_family="(TAA)n" FT repeat_region 9810460..9810491 FT /rpt_family="MER1_type" FT misc_feature 9810799..9811071 FT /note="match to EST AI791594 (NID:g5339310) oj58g01.y5" FT misc_feature 9810799..9811038 FT /note="match to EST AI733098 (NID:g5054211) oj58g01.x5" FT repeat_region 9811252..9811381 FT /rpt_family="MIR" FT repeat_region 9811467..9811491 FT /rpt_family="(T)n" FT repeat_region 9811542..9811593 FT /rpt_family="MIR" FT repeat_region 9811627..9811886 FT /rpt_family="L2" FT repeat_region 9811928..9811998 FT /rpt_family="MIR" FT repeat_region 9812686..9812830 FT /rpt_family="MaLR" FT repeat_region 9812831..9813401 FT /rpt_family="MaLR" FT repeat_region 9813402..9813716 FT /rpt_family="MaLR" FT repeat_region 9813862..9813964 FT /rpt_family="L2" FT misc_feature 9814165..9814606 FT /note="match to EST AW887118 (NID:g8049131)" FT repeat_region 9815161..9815206 FT /rpt_family="L2" FT repeat_region 9815344..9815437 FT /rpt_family="L2" FT repeat_region 9815438..9815779 FT /rpt_family="Alu" FT repeat_region 9815557..9815612 FT /rpt_family="(TAAAAA)n" FT repeat_region 9815780..9815836 FT /rpt_family="L2" FT repeat_region 9815863..9815986 FT /rpt_family="L2" FT repeat_region 9816092..9816185 FT /rpt_family="MaLR" FT repeat_region 9816272..9816373 FT /rpt_family="MaLR" FT repeat_region 9816991..9817238 FT /rpt_family="MaLR" FT repeat_region 9817497..9817511 FT /rpt_family="MER1_type" FT repeat_region 9817512..9817823 FT /rpt_family="Alu" FT repeat_region 9817799..9817825 FT /rpt_family="(TAAA)n" FT repeat_region 9817824..9817905 FT /rpt_family="MER1_type" FT repeat_region 9817918..9817967 FT /rpt_family="MaLR" FT repeat_region 9817971..9818292 FT /rpt_family="L1" FT misc_feature 9818204..9818749 FT /note="match to EST AW880863 (NID:g8042873)" FT repeat_region 9818388..9818435 FT /rpt_family="L1" FT repeat_region 9818478..9818940 FT /rpt_family="MaLR" FT repeat_region 9818961..9819071 FT /rpt_family="L2" FT repeat_region 9819979..9820332 FT /rpt_family="ERV1" FT repeat_region 9820465..9820764 FT /rpt_family="Alu" FT repeat_region 9820741..9820764 FT /rpt_family="(A)n" FT repeat_region 9820894..9821275 FT /rpt_family="L1" FT repeat_region 9821276..9821579 FT /rpt_family="Alu" FT repeat_region 9821580..9822975 FT /rpt_family="L1" FT repeat_region 9822976..9823281 FT /rpt_family="L1" FT repeat_region 9823282..9824242 FT /rpt_family="L1" FT repeat_region 9823896..9823985 FT /rpt_family="T-rich" FT repeat_region 9824256..9824440 FT /rpt_family="L1" FT misc_feature 9824412..9824872 FT /note="match to EST H59222 (NID:g1012054) yr03f12.s1" FT misc_feature 9824468 FT /note="match to EST W01603 (NID:g1273620) za36g06.r1" FT repeat_region 9824508..9824740 FT /rpt_family="L1" FT misc_feature 9824924..9825251 FT /note="match to EST H59221 (NID:g1012053) yr03f12.r1" FT misc_feature 9825052..9825301 FT /note="match to EST AI245796 (NID:g3841193) qk27a12.x1" FT misc_feature 9825056..9825562 FT /note="match to EST AW779902 (NID:g7794505) hn90a04.x1" FT misc_feature 9825290..9825317 FT /note="match to EST W01603 (NID:g1273620) za36g06.r1" FT repeat_region 9825613..9826013 FT /rpt_family="MaLR" FT repeat_region 9825721..9825755 FT /rpt_family="(TGAA)n" FT misc_feature 9825898..9826243 FT /note="match to EST R10498 (NID:g762454) yf37e06.r1" FT repeat_region 9826250..9826379 FT /rpt_family="L2" FT misc_feature 9826760..9827363 FT /note="match to EST AW271605 (NID:g6658635) xs16c03.x1" FT repeat_region 9826894..9827073 FT /rpt_family="CR1" FT repeat_region 9827084..9827209 FT /rpt_family="MER1_type" FT misc_feature 9827092..9827526 FT /note="match to EST W01603 (NID:g1273620) za36g06.r1" FT misc_feature 9827170..9827667 FT /note="match to EST BE464278 (NID:g9510053) hx87a08.x1" FT misc_feature 9827269..9827739 FT /note="match to EST W87895 (NID:g1401980) zh66e06.r1" FT repeat_region 9827585..9827630 FT /rpt_family="MIR" FT misc_feature 9827848..9828224 FT /note="match to EST AI433678 (NID:g4290861) ti88b12.x1" FT misc_feature 9827850..9828212 FT /note="match to EST AI580406 (NID:g4564782) tm42h03.x1" FT repeat_region 9827868..9827891 FT /rpt_family="AT_rich" FT misc_feature 9827971..9828224 FT /note="similar to Mus musculus EST BI154904 FT (NID:g14614905)" FT misc_feature 9828009..9828216 FT /note="match to EST AA059043 (NID:g1551869) zf63h01.r1" FT misc_feature 9828044..9828149 FT /note="match to EST AW016261 (NID:g5865018)" FT misc_feature 9828044..9828224 FT /note="match to EST BI762013 (NID:g15753591)" FT /note="match to EST AW016260 (NID:g5865017)" FT repeat_region 9828922..9828993 FT /rpt_family="Alu" FT repeat_region 9829202..9829338 FT /rpt_family="MIR" FT repeat_region 9829417..9829616 FT /rpt_family="MIR" FT repeat_region 9829636..9830568 FT /rpt_family="L2" FT repeat_region 9830746..9830932 FT /rpt_family="Alu" FT repeat_region 9830934..9832165 FT /rpt_family="L1" FT misc_feature 9832522..9832809 FT /note="match to EST AA577887 (NID:g2356071) nn25d12.s1" FT repeat_region 9832552..9832683 FT /rpt_family="MIR" FT misc_feature 9832580..9832584 FT /note="match to EST BI012928 (NID:g14416999)" FT repeat_region 9832820..9833017 FT /rpt_family="MaLR" FT repeat_region 9833018..9833554 FT /rpt_family="ERVL" FT repeat_region 9833575..9833729 FT /rpt_family="MaLR" FT repeat_region 9834345..9834402 FT /rpt_family="MIR" FT repeat_region 9835571..9835851 FT /rpt_family="L2" FT repeat_region 9835900..9835986 FT /rpt_family="L2" FT repeat_region 9836252..9836318 FT /rpt_family="CR1" FT misc_feature 9836505..9836656 FT /note="similar to Mus musculus EST BI154904 FT (NID:g14614905)" FT misc_feature 9836505..9836640 FT /note="match to EST BI762013 (NID:g15753591)" FT /note="match to EST AI433678 (NID:g4290861) ti88b12.x1" FT misc_feature 9836505..9836532 FT /note="match to EST AW016260 (NID:g5865017)" FT repeat_region 9836790..9836917 FT /rpt_family="MER1_type" FT repeat_region 9837340..9837428 FT /rpt_family="L1" FT repeat_region 9837429..9837742 FT /rpt_family="Alu" FT repeat_region 9837713..9837745 FT /rpt_family="(A)n" FT repeat_region 9837743..9837933 FT /rpt_family="L1" FT repeat_region 9837923..9837946 FT /rpt_family="AT_rich" FT repeat_region 9838105..9838522 FT /rpt_family="L2" FT repeat_region 9839276..9839333 FT /rpt_family="L2" FT repeat_region 9839572..9839721 FT /rpt_family="MIR" FT repeat_region 9839746..9839828 FT /rpt_family="MIR" FT repeat_region 9839827..9839873 FT /rpt_family="(ATG)n" FT repeat_region 9839909..9839937 FT /rpt_family="MIR" FT repeat_region 9839938..9841616 FT /rpt_family="L1" FT repeat_region 9841617..9841801 FT /rpt_family="MIR" FT misc_feature 9841752..9841758 FT /note="similar to Homo sapiens EST AA719797 (NID:g2732896) FT zg54c07.s1" FT repeat_region 9842088..9842227 FT /rpt_family="L1" FT repeat_region 9842233..9842368 FT /rpt_family="L1" FT repeat_region 9842369..9842731 FT /rpt_family="MaLR" FT repeat_region 9842732..9842917 FT /rpt_family="L1" FT repeat_region 9842981..9843026 FT /rpt_family="CT-rich" FT repeat_region 9842992..9843369 FT /rpt_family="L1" FT misc_feature 9843498..9843777 FT /note="match to EST T99602 (NID:g749339) ye65g05.r1" FT repeat_region 9844121..9844223 FT /rpt_family="MIR" FT repeat_region 9844454..9844815 FT /rpt_family="ERVL" FT repeat_region 9845149..9845399 FT /rpt_family="MIR" FT repeat_region 9845669..9845772 FT /rpt_family="MIR" FT repeat_region 9845774..9845804 FT /rpt_family="(A)n" FT repeat_region 9846351..9846493 FT /rpt_family="MIR" FT repeat_region 9846645..9846935 FT /rpt_family="Alu" FT repeat_region 9847048..9847071 FT /rpt_family="(T)n" FT repeat_region 9847597..9847807 FT /rpt_family="MIR" FT repeat_region 9848585..9848753 FT /rpt_family="MIR" FT misc_feature 9848683..9848684 FT /note="similar to Homo sapiens EST T54145 (NID:g656006) FT ya92g10.s1" FT repeat_region 9848754..9849119 FT /rpt_family="MaLR" FT repeat_region 9849120..9849149 FT /rpt_family="MIR" FT repeat_region 9849171..9849275 FT /rpt_family="L2" FT repeat_region 9849576..9849725 FT /rpt_family="MIR" FT repeat_region 9850105..9850264 FT /rpt_family="L2" FT repeat_region 9850321..9850624 FT /rpt_family="Alu" FT misc_feature 9850345..9850846 FT /note="similar to Homo sapiens EST T54145 (NID:g656006) FT ya92g10.s1" FT misc_feature 9850764..9851069 FT /note="similar to Homo sapiens EST T54241 (NID:g656102) FT ya92g10.r1" FT repeat_region 9850811..9850953 FT /rpt_family="L2" FT repeat_region 9853869..9854174 FT /rpt_family="Alu" FT repeat_region 9854533..9854817 FT /rpt_family="Alu" FT misc_feature 9854796..9854813 FT /note="similar to Homo sapiens EST BG219116 FT (NID:g13745137)" FT misc_feature 9854798..9854817 FT /note="similar to Homo sapiens EST AI367730 (NID:g4137475) FT qv75h11.x1" FT repeat_region 9857237..9857257 FT /rpt_family="AT_rich" FT repeat_region 9858912..9859004 FT /rpt_family="L2" FT repeat_region 9859281..9859473 FT /rpt_family="ERVL" FT repeat_region 9859597..9859674 FT /rpt_family="AcHobo" FT repeat_region 9860159..9860257 FT /rpt_family="AcHobo" FT misc_feature 9860189..9860194 FT /note="match to EST BF356251 (NID:g11315325)" FT repeat_region 9860268..9860329 FT /rpt_family="MIR" FT repeat_region 9860330..9860875 FT /rpt_family="ERVL" FT repeat_region 9861028..9861130 FT /rpt_family="MIR" FT repeat_region 9862378..9862441 FT /rpt_family="L2" FT repeat_region 9862487..9862687 FT /rpt_family="L2" FT repeat_region 9862688..9863126 FT /rpt_family="MaLR" FT repeat_region 9863127..9863256 FT /rpt_family="L2" FT repeat_region 9863319..9863360 FT /rpt_family="(TGAA)n" FT repeat_region 9863384..9863467 FT /rpt_family="L2" FT repeat_region 9863497..9863640 FT /rpt_family="L2" FT repeat_region 9863641..9864194 FT /rpt_family="ERV1" FT repeat_region 9864195..9864559 FT /rpt_family="L2" FT repeat_region 9864652..9864775 FT /rpt_family="L2" FT repeat_region 9864776..9865035 FT /rpt_family="Alu" FT repeat_region 9865396..9865831 FT /rpt_family="ERVL" FT repeat_region 9866418..9866522 FT /rpt_family="MaLR" FT repeat_region 9866756..9866970 FT /rpt_family="MER1_type" FT misc_feature 9867079..9867531 FT /note="match to EST AA724087 (NID:g2741794) ah98h09.s1" FT repeat_region 9867703..9867784 FT /rpt_family="MIR" FT repeat_region 9867824..9867881 FT /rpt_family="(TTA)n" FT repeat_region 9867933..9868196 FT /rpt_family="L2" FT misc_feature 9868732..9869210 FT /note="match to EST AW172566 (NID:g6438514) xj79f10.x1" FT repeat_region 9869023..9869122 FT /rpt_family="MIR" FT repeat_region 9869113..9869152 FT /rpt_family="(ATG)n" FT misc_feature 9870405..9870861 FT /note="match to EST BE326892 (NID:g9200668) hr67c03.x1" FT misc_feature 9870518..9870982 FT /note="match to EST W51903 (NID:g1349197) zc45d03.r1" FT repeat_region 9870877..9870961 FT /rpt_family="L2" FT repeat_region 9871282..9871386 FT /rpt_family="L2" FT repeat_region 9871458..9871881 FT /rpt_family="MaLR" FT repeat_region 9872346..9872410 FT /rpt_family="MIR" FT repeat_region 9872546..9872704 FT /rpt_family="Alu" FT repeat_region 9872712..9872732 FT /rpt_family="AT_rich" FT repeat_region 9872913..9873363 FT /rpt_family="MaLR" FT repeat_region 9873364..9873516 FT /rpt_family="MIR" FT repeat_region 9873746..9873826 FT /rpt_family="MIR" FT repeat_region 9874671..9874774 FT /rpt_family="ERVL" FT repeat_region 9874818..9874861 FT /rpt_family="(TG)n" FT repeat_region 9874850..9874934 FT /rpt_family="L2" FT repeat_region 9875021..9875478 FT /rpt_family="MaLR" FT repeat_region 9875519..9875710 FT /rpt_family="L2" FT repeat_region 9875836..9875909 FT /rpt_family="MER1_type" FT misc_feature 9877000..9877290 FT /note="similar to Homo sapiens EST BF822868 FT (NID:g12163197)" FT repeat_region 9877046..9877088 FT /rpt_family="MER1_type" FT repeat_region 9877231..9877334 FT /rpt_family="MIR" FT repeat_region 9877672..9877790 FT /rpt_family="MER1_type" FT repeat_region 9877827..9877930 FT /rpt_family="ERVL" FT repeat_region 9877952..9878243 FT /rpt_family="Alu" FT repeat_region 9878217..9878251 FT /rpt_family="(CAAA)n" FT misc_feature 9878365..9878748 FT /note="match to EST BF351014 (NID:g11310088)" FT misc_feature 9878385..9878758 FT /note="similar to Homo sapiens EST BE161128 (NID:g8623758)" FT repeat_region 9878826..9878872 FT /rpt_family="(TTCA)n" FT repeat_region 9879682..9879748 FT /rpt_family="L2" FT repeat_region 9879770..9879806 FT /rpt_family="AT_rich" FT repeat_region 9879797..9880505 FT /rpt_family="ERV1" FT repeat_region 9880606..9880643 FT /rpt_family="L2" FT misc_feature 9880643..9881007 FT /note="match to EST T91065 (NID:g722978) yd59e08.s1" FT repeat_region 9880655..9880737 FT /rpt_family="L2" FT misc_feature 9880940..9881252 FT /note="match to EST R00591 (NID:g750327) ye74b01.r1" FT repeat_region 9880978..9881036 FT /rpt_family="(TG)n" FT misc_feature 9881031 FT /note="match to EST BI063250 (NID:g14470777)" FT misc_feature 9881055..9881255 FT /note="match to EST T85929 (NID:g714281) yd59e08.r1" FT misc_feature 9881066..9881589 FT /note="match to EST BI063250 (NID:g14470777)" FT misc_feature 9881146..9881792 FT /note="match to EST BI062805 (NID:g14470332)" FT repeat_region 9882819..9882983 FT /rpt_family="MER1_type" FT repeat_region 9883137..9883308 FT /rpt_family="MER1_type" FT repeat_region 9883309..9883479 FT /rpt_family="CR1" FT repeat_region 9883977..9884092 FT /rpt_family="MIR" FT repeat_region 9884093..9884352 FT /rpt_family="Alu" FT misc_feature 9884600..9884953 FT /note="match to EST BF910504 (NID:g12301962)" FT repeat_region 9884757..9884787 FT /rpt_family="(CA)n" FT repeat_region 9884842..9884895 FT /rpt_family="MIR" FT gene complement(9889191..9943669) FT /gene="SLC2A9" FT mRNA complement(join(9889191..9889266,9892234..9892335, FT 9909859..9909969,9922009..9922196,9943537..9943669)) FT /gene="SLC2A9" FT CDS complement(join(<9889191..9889266,9892234..9892335, FT 9909859..9909969,9922009..9922196,9943537..>9943669)) FT /codon_start=1 FT /gene="SLC2A9" FT /product="unknown" FT /note="Homo sapiens solute carrier family 2 (facilitated FT glucose transporter), member 9 (SLC2A9), mRNA.; FT H_FH0560N11.1 This gene was based on gi(9910553) Continued FT from H_NH0448G15.1 Continues as H_NH0751L19.2" FT /protein_id="AAY41052.1" FT /translation="ESTWPYLFGVIVVPAVVQLLSLPFLPDSPRYLLLEKHNEARAVKA FT FQTFLGKADVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQVVTVIVTMACYQLCG FT LNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETLAAVFSGLVIEHLGRRPLLIGGFGL FT MGLFFGTLTITLTLQDHAPWVPYLSIVGILAIIASFCSGP" FT misc_feature 9956834..9957114 FT /note="CpG_island (%GC=61.9, o/e=0.82, #CpGs=23)" FT repeat_region 10085556..10085653 FT /rpt_family="MIR" FT misc_feature 10085668..10085677 FT /note="match to EST BF985158 (NID:g12391478)" FT misc_feature 10085960..10086154 FT /note="match to EST BE158995 (NID:g8621716)" FT misc_feature 10086056..10086154 FT /note="match to EST BG681381 (NID:g13912778)" FT /note="match to EST BM083771 (NID:g16951402)" FT /note="match to EST AL516187 (NID:g12779680)" FT /note="match to EST BF725378 (NID:g12041289) bx15b12.y1" FT /note="match to EST BE068242 (NID:g8412892)" FT /note="match to EST BI830092 (NID:g15941642)" FT misc_feature 10086064..10086154 FT /note="match to EST BG830849 (NID:g14178436)" FT misc_feature 10086067..10086154 FT /note="match to EST BG475367 (NID:g13407560)" FT misc_feature 10086087..10086154 FT /note="match to EST BF985673 (NID:g12391993)" FT misc_feature 10086123..10086154 FT /note="match to EST AI355609 (NID:g4095752) qt58g10.x1" FT misc_feature 10086451..10086458 FT /note="match to EST BE180908 (NID:g8660084)" FT repeat_region 10087340..10087428 FT /rpt_family="MER1_type" FT misc_feature 10088538..10088540 FT /note="match to EST AL583675 (NID:g12952865)" FT misc_feature 10088758..10089173 FT /note="match to EST BF741926 (NID:g12068602)" FT misc_feature 10089326..10089564 FT /note="match to EST BF978787 (NID:g12346002)" FT misc_feature 10089331..10089564 FT /note="match to EST BI830092 (NID:g15941642)" FT /note="match to EST BE158995 (NID:g8621716)" FT /note="match to EST AL583675 (NID:g12952865)" FT /note="match to EST BM083771 (NID:g16951402)" FT /note="match to EST AI355609 (NID:g4095752) qt58g10.x1" FT /note="match to EST BG681381 (NID:g13912778)" FT /note="match to EST BG475367 (NID:g13407560)" FT /note="match to EST BF725378 (NID:g12041289) bx15b12.y1" FT /note="match to EST AL516187 (NID:g12779680)" FT /note="match to EST BG830849 (NID:g14178436)" FT /note="match to EST BE068242 (NID:g8412892)" FT misc_feature 10089331..10089567 FT /note="match to EST BF985673 (NID:g12391993)" FT misc_feature 10089337..10089564 FT /note="match to EST BF734652 (NID:g12059889)" FT misc_feature 10089338..10089519 FT /note="match to EST BF766251 (NID:g12114151)" FT misc_feature 10089338..10089564 FT /note="match to EST T35445 (NID:g617543)" FT misc_feature 10089344..10089564 FT /note="match to EST BI858177 (NID:g15998924)" FT misc_feature 10089349..10089564 FT /note="match to EST BE936748 (NID:g10462824)" FT misc_feature 10089359..10089564 FT /note="match to EST BF380771 (NID:g11369896)" FT misc_feature 10089371..10089564 FT /note="match to EST BI084175 (NID:g14502505)" FT misc_feature 10089375..10089564 FT /note="match to EST BF985158 (NID:g12391478)" FT misc_feature 10089389..10089564 FT /note="match to EST BF762373 (NID:g12110273)" FT misc_feature 10089402..10089564 FT /note="match to EST BE535484 (NID:g9764129)" FT misc_feature 10089407..10089564 FT /note="similar to Mus musculus EST BE912657 FT (NID:g10409644)" FT misc_feature 10089429..10089564 FT /note="similar to Mus musculus EST BI155777 FT (NID:g14615778)" FT misc_feature 10089460..10089564 FT /note="match to EST BI825876 (NID:g15937426)" FT misc_feature 10089493..10089564 FT /note="match to EST AL557273 (NID:g12900716)" FT misc_feature 10089515..10089564 FT /note="similar to Mus musculus EST BI159435 FT (NID:g14619436)" FT misc_feature 10089538..10089564 FT /note="match to EST BG751589 (NID:g14062242)" FT misc_feature 10089541..10089564 FT /note="match to EST BG763510 (NID:g14074163)" FT misc_feature 10089548..10089564 FT /note="match to EST BF985506 (NID:g12391826)" FT misc_feature 10089911..10089997 FT /note="match to EST BE888823 (NID:g10345512)" FT misc_feature 10089917..10089997 FT /note="match to EST BG763510 (NID:g14074163)" FT /note="match to EST BI830092 (NID:g15941642)" FT /note="match to EST BF978787 (NID:g12346002)" FT /note="match to EST BE158995 (NID:g8621716)" FT /note="match to EST BI084175 (NID:g14502505)" FT /note="match to EST BF985158 (NID:g12391478)" FT /note="similar to Mus musculus EST BE912657 FT (NID:g10409644)" FT /note="match to EST BE535484 (NID:g9764129)" FT /note="match to EST AI355609 (NID:g4095752) qt58g10.x1" FT /note="similar to Mus musculus EST BI159435 FT (NID:g14619436)" FT /note="match to EST AL557273 (NID:g12900716)" FT /note="match to EST BI825876 (NID:g15937426)" FT /note="match to EST BF725378 (NID:g12041289) bx15b12.y1" FT /note="match to EST BF380771 (NID:g11369896)" FT /note="match to EST BF985506 (NID:g12391826)" FT /note="match to EST BF734652 (NID:g12059889)" FT /note="similar to Mus musculus EST BI155777 FT (NID:g14615778)" FT /note="match to EST BG751589 (NID:g14062242)" FT /note="match to EST BG475367 (NID:g13407560)" FT /note="match to EST BM083771 (NID:g16951402)" FT /note="match to EST BG830849 (NID:g14178436)" FT /note="match to EST AL516187 (NID:g12779680)" FT /note="match to EST BI858177 (NID:g15998924)" FT /note="match to EST AL583675 (NID:g12952865)" FT misc_feature 10089917..10089999 FT /note="match to EST BE068242 (NID:g8412892)" FT misc_feature 10089917..10089951 FT /note="match to EST T35445 (NID:g617543)" FT misc_feature 10089917..10089976 FT /note="match to EST BF762373 (NID:g12110273)" FT misc_feature 10089917..10089982 FT /note="match to EST BE936748 (NID:g10462824)" FT misc_feature 10089917..10089938 FT /note="match to EST BG681381 (NID:g13912778)" FT misc_feature 10089918..10089997 FT /note="match to EST R15530 (NID:g768733)" FT misc_feature 10089943..10089997 FT /note="match to EST AW362207 (NID:g6866857)" FT misc_feature 10089948..10089997 FT /note="match to EST AW408779 (NID:g6927836)" FT misc_feature 10089959..10089997 FT /note="match to EST AL538873 (NID:g12867569)" FT misc_feature 10089968..10089997 FT /note="match to EST BF766339 (NID:g12114239)" FT misc_feature 10089986..10089997 FT /note="match to EST AW408535 (NID:g6927592)" FT misc_feature 10090021 FT /note="match to EST BF898726 (NID:g12290185)" FT misc_feature 10090027..10090028 FT /note="match to EST BE936748 (NID:g10462824)" FT misc_feature 10090098..10090544 FT /note="match to EST BF898726 (NID:g12290185)" FT misc_feature 10090278..10090357 FT /note="match to EST AW374174 (NID:g6878828)" FT misc_feature 10090279..10090357 FT /note="match to EST AW582570 (NID:g7257619)" FT misc_feature 10090288..10090365 FT /note="match to EST BG475367 (NID:g13407560)" FT /note="match to EST BI084175 (NID:g14502505)" FT /note="match to EST AW408535 (NID:g6927592)" FT /note="match to EST BI858177 (NID:g15998924)" FT /note="match to EST AW408779 (NID:g6927836)" FT /note="match to EST BG830849 (NID:g14178436)" FT /note="match to EST BE535484 (NID:g9764129)" FT /note="match to EST AI355609 (NID:g4095752) qt58g10.x1" FT /note="match to EST BF985506 (NID:g12391826)" FT /note="match to EST BI830092 (NID:g15941642)" FT /note="match to EST BF380771 (NID:g11369896)" FT /note="match to EST BF734652 (NID:g12059889)" FT /note="match to EST BF985158 (NID:g12391478)" FT /note="match to EST AL583675 (NID:g12952865)" FT /note="similar to Mus musculus EST BI159435 FT (NID:g14619436)" FT /note="match to EST BG763510 (NID:g14074163)" FT /note="similar to Mus musculus EST BE912657 FT (NID:g10409644)" FT /note="match to EST BE888823 (NID:g10345512)" FT /note="match to EST BF978787 (NID:g12346002)" FT /note="match to EST AL557273 (NID:g12900716)" FT /note="match to EST R15530 (NID:g768733)" FT /note="match to EST AL516187 (NID:g12779680)" FT /note="match to EST AW362207 (NID:g6866857)" FT /note="match to EST AL538873 (NID:g12867569)" FT /note="similar to Mus musculus EST BI155777 FT (NID:g14615778)" FT /note="match to EST BF766339 (NID:g12114239)" FT /note="match to EST BG751589 (NID:g14062242)" FT /note="match to EST BI825876 (NID:g15937426)" FT misc_feature 10090288..10090305 FT /note="match to EST BF725378 (NID:g12041289) bx15b12.y1" FT misc_feature 10090288..10090350 FT /note="match to EST BM083771 (NID:g16951402)" FT misc_feature 10090288..10090357 FT /note="match to EST BE158995 (NID:g8621716)" FT misc_feature 10090289..10090365 FT /note="match to EST BG285290 (NID:g13037277)" FT misc_feature 10090302..10090365 FT /note="match to EST BE180908 (NID:g8660084)" FT misc_feature 10090311..10090362 FT /note="similar to Homo sapiens EST BG998757 FT (NID:g14402827)" FT misc_feature 10090314..10090357 FT /note="match to EST AW818268 (NID:g7911262)" FT misc_feature 10090315..10090365 FT /note="similar to Mus musculus EST BI149274 FT (NID:g14609275)" FT misc_feature 10090321..10090357 FT /note="similar to Homo sapiens EST BF981901 FT (NID:g12384713)" FT misc_feature 10090325..10090365 FT /note="match to EST AI392815 (NID:g4222362) tg10a04.x1" FT misc_feature 10090404..10090700 FT /note="match to EST BI029249 (NID:g14435879)" FT misc_feature 10090587..10091030 FT /note="similar to Homo sapiens EST BF880649 FT (NID:g12270775)" FT repeat_region 10090759..10091028 FT /rpt_family="Alu" FT misc_feature 10090805..10090884 FT /note="similar to Homo sapiens EST AL575888 FT (NID:g12937494)" FT repeat_region 10091467..10091871 FT /rpt_family="MaLR" FT repeat_region 10091926..10091996 FT /rpt_family="MIR" FT misc_feature 10093322..10093818 FT /note="match to EST BI825876 (NID:g15937426)" FT misc_feature 10094604..10094624 FT /note="match to EST BI825876 (NID:g15937426)" FT misc_feature 10094604..10094634 FT /note="match to EST BI830092 (NID:g15941642)" FT misc_feature 10095328..10095799 FT /note="match to EST AW992342 (NID:g8252439)" FT misc_feature 10096392..10096641 FT /note="similar to Homo sapiens EST BF759831 FT (NID:g12107731)" FT misc_feature 10096522..10096956 FT /note="match to EST AI247365 (NID:g3842762) qh40a02.x1" FT misc_feature 10096790..10096956 FT /note="match to EST AA905561 (NID:g3040684) oj97b10.s1" FT misc_feature 10099084..10099301 FT /note="match to EST BF911772 (NID:g12303230)" FT misc_feature 10099328..10099515 FT /note="match to EST BE158950 (NID:g8621671)" FT misc_feature 10099331..10099508 FT /note="match to EST AW818268 (NID:g7911262)" FT misc_feature 10099331..10099488 FT /note="match to EST AW374174 (NID:g6878828)" FT misc_feature 10099331..10099515 FT /note="match to EST AW582570 (NID:g7257619)" FT misc_feature 10099334..10099515 FT /note="match to EST AW379138 (NID:g6883797)" FT /note="match to EST BE068270 (NID:g8412920)" FT misc_feature 10099335..10099488 FT /note="similar to Mus musculus EST BI155777 FT (NID:g14615778)" FT misc_feature 10099335..10099515 FT /note="similar to Homo sapiens EST BG998757 FT (NID:g14402827)" FT /note="match to EST AI392815 (NID:g4222362) tg10a04.x1" FT /note="match to EST AL538873 (NID:g12867569)" FT /note="similar to Mus musculus EST BI149274 FT (NID:g14609275)" FT /note="match to EST AL557273 (NID:g12900716)" FT /note="match to EST BG285290 (NID:g13037277)" FT /note="similar to Homo sapiens EST BF981901 FT (NID:g12384713)" FT /note="match to EST BE888823 (NID:g10345512)" FT /note="similar to Mus musculus EST BE912657 FT (NID:g10409644)" FT /note="similar to Mus musculus EST BI159435 FT (NID:g14619436)" FT /note="match to EST AL583675 (NID:g12952865)" FT /note="match to EST BG763510 (NID:g14074163)" FT /note="match to EST BI084175 (NID:g14502505)" FT /note="match to EST AW408535 (NID:g6927592)" FT /note="match to EST BE180908 (NID:g8660084)" FT /note="match to EST BI858177 (NID:g15998924)" FT /note="match to EST BG830849 (NID:g14178436)" FT /note="match to EST BE535484 (NID:g9764129)" FT /note="match to EST AW408779 (NID:g6927836)" FT /note="match to EST AW362207 (NID:g6866857)" FT misc_feature 10099335..10099525 FT /note="match to EST BG475367 (NID:g13407560)" FT misc_feature 10099335..10099357 FT /note="match to EST BF380771 (NID:g11369896)" FT misc_feature 10099335..10099517 FT /note="match to EST R15530 (NID:g768733)" FT misc_feature 10099335..10099523 FT /note="match to EST BF985506 (NID:g12391826)" FT /note="match to EST BF766339 (NID:g12114239)" FT misc_feature 10099335..10099370 FT /note="match to EST AI355609 (NID:g4095752) qt58g10.x1" FT misc_feature 10099335..10099359 FT /note="match to EST BF734652 (NID:g12059889)" FT misc_feature 10099335..10099503 FT /note="match to EST BF985158 (NID:g12391478)" FT misc_feature 10099340..10099515 FT /note="similar to Mus musculus EST BG342307 FT (NID:g13148745)" FT misc_feature 10099349..10099515 FT /note="match to EST BI547910 (NID:g15435222)" FT misc_feature 10099381..10099515 FT /note="match to EST AW374903 (NID:g6879557)" FT misc_feature 10099383..10099515 FT /note="similar to Danio rerio EST BI984930 (NID:g16376809) FT fu12e10.y3" FT misc_feature 10099386..10099515 FT /note="match to EST BG897490 (NID:g14307731)" FT misc_feature 10099405..10099515 FT /note="match to EST BI559466 (NID:g15446780)" FT misc_feature 10100611..10100763 FT /note="match to EST AA346760 (NID:g1999016)" FT misc_feature 10100612..10100763 FT /note="match to EST AW960317 (NID:g8150001)" FT /note="match to EST BF811436 (NID:g12140544)" FT misc_feature 10100614..10100763 FT /note="similar to Mus musculus EST BF152211 (NID:g11033606) FT uz30d08.y1" FT misc_feature 10100616..10100763 FT /note="match to EST AW408535 (NID:g6927592)" FT /note="match to EST BI858177 (NID:g15998924)" FT /note="match to EST AW362207 (NID:g6866857)" FT /note="match to EST BG897490 (NID:g14307731)" FT /note="match to EST AW379138 (NID:g6883797)" FT /note="match to EST BI559466 (NID:g15446780)" FT /note="match to EST AL538873 (NID:g12867569)" FT /note="similar to Mus musculus EST BI149274 FT (NID:g14609275)" FT /note="similar to Mus musculus EST BG342307 FT (NID:g13148745)" FT /note="match to EST AL557273 (NID:g12900716)" FT /note="match to EST BG285290 (NID:g13037277)" FT /note="match to EST BI547910 (NID:g15435222)" FT /note="similar to Homo sapiens EST BF981901 FT (NID:g12384713)" FT /note="match to EST BE888823 (NID:g10345512)" FT /note="similar to Mus musculus EST BE912657 FT (NID:g10409644)" FT /note="similar to Mus musculus EST BI159435 FT (NID:g14619436)" FT /note="match to EST AW374903 (NID:g6879557)" FT /note="similar to Danio rerio EST BI984930 (NID:g16376809) FT fu12e10.y3" FT /note="match to EST AL583675 (NID:g12952865)" FT /note="match to EST BG763510 (NID:g14074163)" FT /note="match to EST BI084175 (NID:g14502505)" FT misc_feature 10100616..10100707 FT /note="match to EST AW408779 (NID:g6927836)" FT misc_feature 10100616..10100695 FT /note="match to EST BG830849 (NID:g14178436)" FT misc_feature 10100616..10100624 FT /note="match to EST BE535484 (NID:g9764129)" FT misc_feature 10100616..10100631 FT /note="match to EST BE068270 (NID:g8412920)" FT /note="match to EST BE158950 (NID:g8621671)" FT misc_feature 10100616..10100773 FT /note="match to EST BE180908 (NID:g8660084)" FT /note="match to EST AI392815 (NID:g4222362) tg10a04.x1" FT /note="similar to Homo sapiens EST BG998757 FT (NID:g14402827)" FT misc_feature 10100616..10100771 FT /note="match to EST AW582570 (NID:g7257619)" FT misc_feature 10100621..10100763 FT /note="match to EST BI831941 (NID:g15943491)" FT misc_feature 10100626..10100763 FT /note="match to EST AW364554 (NID:g6869204)" FT misc_feature 10100637..10100763 FT /note="match to EST AW841939 (NID:g7935922)" FT misc_feature 10100650..10100769 FT /note="match to EST BE080808 (NID:g8471098)" FT misc_feature 10100744 FT /note="match to EST BG830849 (NID:g14178436)" FT misc_feature 10101803..10102214 FT /note="match to EST BF909639 (NID:g12301097)" FT repeat_region 10101844..10102057 FT /rpt_family="MIR" FT misc_feature 10102010..10102011 FT /note="match to EST M78652 (NID:g272967)" FT misc_feature 10102160..10102161 FT /note="match to EST BF905485 (NID:g12296944)" FT misc_feature 10102254..10102386 FT /note="match to EST BF905485 (NID:g12296944)" FT misc_feature 10102311..10102624 FT /note="match to EST M78652 (NID:g272967)" FT misc_feature 10103050..10103461 FT /note="match to EST BG983601 (NID:g14386336)" FT misc_feature 10103707..10104261 FT /note="similar to Homo sapiens EST BG992119 FT (NID:g14396189)" FT repeat_region 10103844..10103941 FT /rpt_family="MIR" FT repeat_region 10103942..10104290 FT /rpt_family="MaLR" FT misc_feature 10104067..10104456 FT /note="match to EST AW936078 (NID:g8111484)" FT misc_feature 10104108..10104458 FT /note="match to EST AW875920 (NID:g8013887)" FT repeat_region 10104291..10104333 FT /rpt_family="MIR" FT misc_feature 10104443..10104659 FT /note="match to EST BF911769 (NID:g12303227)" FT repeat_region 10104561..10104591 FT /rpt_family="(TGAA)n" FT misc_feature 10104707..10105269 FT /note="match to EST AV699470 (NID:g10301441)" FT repeat_region 10104885..10104947 FT /rpt_family="(CA)n" FT repeat_region 10105130..10105321 FT /rpt_family="MER1_type" FT misc_feature 10105310..10105383 FT /note="match to EST AV699470 (NID:g10301441)" FT misc_feature 10105520..10105553 FT /note="match to EST AW408535 (NID:g6927592)" FT misc_feature 10105520..10105550 FT /note="match to EST BG897490 (NID:g14307731)" FT misc_feature 10105520..10105555 FT /note="match to EST AW841939 (NID:g7935922)" FT misc_feature 10105520..10105610 FT /note="match to EST BI559466 (NID:g15446780)" FT /note="match to EST BI831941 (NID:g15943491)" FT /note="match to EST AL538873 (NID:g12867569)" FT /note="similar to Mus musculus EST BI149274 FT (NID:g14609275)" FT /note="similar to Mus musculus EST BG342307 FT (NID:g13148745)" FT /note="similar to Mus musculus EST BF152211 (NID:g11033606) FT uz30d08.y1" FT /note="match to EST AL557273 (NID:g12900716)" FT /note="match to EST BG285290 (NID:g13037277)" FT /note="match to EST BI547910 (NID:g15435222)" FT /note="similar to Homo sapiens EST BF981901 FT (NID:g12384713)" FT /note="match to EST AW960317 (NID:g8150001)" FT /note="match to EST BE888823 (NID:g10345512)" FT /note="similar to Mus musculus EST BE912657 FT (NID:g10409644)" FT /note="similar to Mus musculus EST BI159435 FT (NID:g14619436)" FT /note="match to EST AW374903 (NID:g6879557)" FT /note="similar to Danio rerio EST BI984930 (NID:g16376809) FT fu12e10.y3" FT /note="match to EST BF811436 (NID:g12140544)" FT /note="match to EST AL583675 (NID:g12952865)" FT /note="match to EST BG763510 (NID:g14074163)" FT /note="match to EST AA346760 (NID:g1999016)" FT /note="match to EST AW364554 (NID:g6869204)" FT misc_feature 10105520..10105581 FT /note="match to EST BI084175 (NID:g14502505)" FT misc_feature 10105520..10105542 FT /note="match to EST BI858177 (NID:g15998924)" FT misc_feature 10105520..10105546 FT /note="match to EST AW379138 (NID:g6883797)" FT misc_feature 10105520..10105551 FT /note="match to EST AW362207 (NID:g6866857)" FT misc_feature 10105528..10105572 FT /note="match to EST AW582570 (NID:g7257619)" FT misc_feature 10105532..10105611 FT /note="match to EST AI392815 (NID:g4222362) tg10a04.x1" FT misc_feature 10105533..10105610 FT /note="match to EST BI561715 (NID:g15449029)" FT misc_feature 10105545..10105610 FT /note="similar to Rattus sp. EST AI231098 (NID:g3814978)" FT misc_feature 10105583..10105610 FT /note="match to EST AA357297 (NID:g2009637)" FT misc_feature 10105855..10106147 FT /note="similar to Homo sapiens EST AI424876 (NID:g4270899) FT tg38g02.x1" FT repeat_region 10107103..10107888 FT /rpt_family="L1" FT repeat_region 10107716..10107751 FT /rpt_family="G-rich" FT misc_feature 10108091..10108123 FT /note="match to EST AA346760 (NID:g1999016)" FT misc_feature 10108165..10108167 FT /note="match to EST AW408535 (NID:g6927592)" FT repeat_region 10108674..10108817 FT /rpt_family="ERVL" FT misc_feature 10109266..10109742 FT /note="match to EST BG984467 (NID:g14387202)" FT misc_feature 10110150 FT /note="match to EST AW275652 (NID:g6662682) xp39c04.x1" FT misc_feature 10110200..10110322 FT /note="match to EST AW275652 (NID:g6662682) xp39c04.x1" FT repeat_region 10110380..10110478 FT /rpt_family="L2" FT repeat_region 10110736..10110887 FT /rpt_family="MIR" FT misc_feature 10110994..10111427 FT /note="match to EST BI019957 (NID:g14426587)" FT misc_feature 10111912..10112197 FT /note="match to EST BG979922 (NID:g14382657)" FT repeat_region 10112134..10112260 FT /rpt_family="L2" FT repeat_region 10112357..10112550 FT /rpt_family="MER1_type" FT misc_feature 10113130..10113394 FT /note="match to EST BE833431 (NID:g10265809)" FT misc_feature 10113700..10114106 FT /note="match to EST AW770902 (NID:g7702951) hn54h05.x1" FT repeat_region 10113717..10113774 FT /rpt_family="MER1_type" FT misc_feature 10114295..10114592 FT /note="match to EST T67235 (NID:g676675) ya53e12.r4" FT repeat_region 10114404..10114697 FT /rpt_family="L2" FT repeat_region 10114698..10115011 FT /rpt_family="Alu" FT repeat_region 10115012..10115558 FT /rpt_family="L2" FT misc_feature 10115802..10115807 FT /note="match to EST AW408779 (NID:g6927836)" FT repeat_region 10116575..10116612 FT /rpt_family="MIR" FT repeat_region 10117264..10117352 FT /rpt_family="MIR" FT misc_feature 10117439..10117549 FT /note="match to EST BG763510 (NID:g14074163)" FT misc_feature 10117576..10118952 FT /note="CpG_island (%GC=71.5, o/e=0.90, #CpGs=160)" FT misc_feature 10117737..10117853 FT /note="similar to Danio rerio EST BI984930 (NID:g16376809) FT fu12e10.y3" FT misc_feature 10117737..10117832 FT /note="match to EST BF811436 (NID:g12140544)" FT misc_feature 10117737..10117815 FT /note="match to EST AL583675 (NID:g12952865)" FT misc_feature 10117737..10117858 FT /note="match to EST BI559466 (NID:g15446780)" FT /note="match to EST BI831941 (NID:g15943491)" FT /note="match to EST AL538873 (NID:g12867569)" FT /note="similar to Mus musculus EST BI149274 FT (NID:g14609275)" FT /note="similar to Mus musculus EST BG342307 FT (NID:g13148745)" FT /note="match to EST BI561715 (NID:g15449029)" FT /note="similar to Mus musculus EST BF152211 (NID:g11033606) FT uz30d08.y1" FT /note="match to EST AL557273 (NID:g12900716)" FT /note="match to EST BG285290 (NID:g13037277)" FT /note="match to EST BF978787 (NID:g12346002)" FT /note="similar to Mus musculus EST BI155777 FT (NID:g14615778)" FT /note="match to EST BI547910 (NID:g15435222)" FT /note="similar to Homo sapiens EST BF981901 FT (NID:g12384713)" FT /note="match to EST AW960317 (NID:g8150001)" FT /note="match to EST AA357297 (NID:g2009637)" FT /note="match to EST AL516187 (NID:g12779680)" FT /note="match to EST BG751589 (NID:g14062242)" FT /note="match to EST BE888823 (NID:g10345512)" FT /note="similar to Mus musculus EST BE912657 FT (NID:g10409644)" FT /note="similar to Mus musculus EST BI159435 FT (NID:g14619436)" FT /note="match to EST AW374903 (NID:g6879557)" FT /note="similar to Rattus sp. EST AI231098 (NID:g3814978)" FT misc_feature 10117737..10117863 FT /note="match to EST AW364554 (NID:g6869204)" FT misc_feature 10117738..10117858 FT /note="similar to Mus musculus EST BB842806 FT (NID:g17043537)" FT misc_feature 10117769..10117858 FT /note="match to EST BG724171 (NID:g14003358)" FT repeat_region 10118129..10118268 FT /rpt_family="GC_rich" FT misc_feature 10118275..10118663 FT /note="match to EST BI559466 (NID:g15446780)" FT misc_feature 10118275..10118581 FT /note="match to EST BG724171 (NID:g14003358)" FT misc_feature 10118275..10118574 FT /note="match to EST BI831941 (NID:g15943491)" FT misc_feature 10118275..10118475 FT /note="match to EST AL538873 (NID:g12867569)" FT misc_feature 10118275..10118473 FT /note="match to EST BI561715 (NID:g15449029)" FT misc_feature 10118275..10118461 FT /note="match to EST AL557273 (NID:g12900716)" FT misc_feature 10118275..10118460 FT /note="match to EST BG285290 (NID:g13037277)" FT misc_feature 10118275..10118424 FT /note="match to EST BF978787 (NID:g12346002)" FT misc_feature 10118275..10118328 FT /note="similar to Mus musculus EST BI149274 FT (NID:g14609275)" FT /note="similar to Mus musculus EST BB842806 FT (NID:g17043537)" FT /note="similar to Mus musculus EST BG342307 FT (NID:g13148745)" FT /note="similar to Mus musculus EST BF152211 (NID:g11033606) FT uz30d08.y1" FT /note="similar to Mus musculus EST BI155777 FT (NID:g14615778)" FT misc_feature 10118275..10118398 FT /note="match to EST BI547910 (NID:g15435222)" FT misc_feature 10118275..10118382 FT /note="similar to Homo sapiens EST BF981901 FT (NID:g12384713)" FT misc_feature 10118275..10118371 FT /note="match to EST AW960317 (NID:g8150001)" FT /note="match to EST AA357297 (NID:g2009637)" FT misc_feature 10118275..10118364 FT /note="match to EST AL516187 (NID:g12779680)" FT misc_feature 10118275..10118359 FT /note="match to EST BG751589 (NID:g14062242)" FT misc_feature 10118275..10118296 FT /note="similar to Mus musculus EST BI159435 FT (NID:g14619436)" FT misc_feature 10118275..10118347 FT /note="similar to Rattus sp. EST AI231098 (NID:g3814978)" FT misc_feature 10118360..10118487 FT /note="similar to Mus musculus EST BB842806 FT (NID:g17043537)" FT misc_feature 10118360..10118475 FT /note="similar to Mus musculus EST BI149274 FT (NID:g14609275)" FT /note="similar to Mus musculus EST BG342307 FT (NID:g13148745)" FT misc_feature 10118360..10118467 FT /note="similar to Mus musculus EST BF152211 (NID:g11033606) FT uz30d08.y1" FT misc_feature 10118360..10118410 FT /note="similar to Mus musculus EST BI155777 FT (NID:g14615778)" FT repeat_region 10118608..10118630 FT /rpt_family="GC_rich" FT misc_feature 10118856..10118857 FT /note="match to EST BI561715 (NID:g15449029)" FT /note="match to EST AL557273 (NID:g12900716)" FT misc_feature 10120174..10120544 FT /note="match to EST BE003194 (NID:g8263427)" FT repeat_region 10121404..10121570 FT /rpt_family="ERVL" FT repeat_region 10125557..10125916 FT /rpt_family="MaLR" FT repeat_region 10129001..10129928 FT /rpt_family="ERVK" FT repeat_region 10130692..10130737 FT /rpt_family="ERVL" FT repeat_region 10130734..10131066 FT /rpt_family="ERVL" FT misc_feature 10133137..10133252 FT /note="similar to Homo sapiens EST BE183489 (NID:g8662673)" FT misc_feature 10133300..10133550 FT /note="similar to Homo sapiens EST BE183489 (NID:g8662673)" FT repeat_region 10139350..10139425 FT /rpt_family="L1" FT repeat_region 10139513..10139620 FT /rpt_family="L1" FT repeat_region 10139734..10139881 FT /rpt_family="L1" FT repeat_region 10139971..10140463 FT /rpt_family="L1" FT repeat_region 10144384..10144795 FT /rpt_family="ERVL" FT misc_feature 10145283..10145290 FT /note="match to EST BE888823 (NID:g10345512)" FT repeat_region 10148165..10148433 FT /rpt_family="Alu" FT repeat_region 10150039..10150241 FT /rpt_family="MER1_type" FT repeat_region 10153189..10153331 FT /rpt_family="MER1_type" FT misc_feature 10158998..10159481 FT /note="match to EST AI125781 (NID:g3594295) qd95f02.x1" FT repeat_region 10159862..10159905 FT /rpt_family="(CCCCCA)n" FT misc_feature 10160999..10161610 FT /note="similar to Homo sapiens EST AL575888 FT (NID:g12937494)" FT misc_feature 10161264..10161633 FT /note="similar to Homo sapiens EST BF908270 FT (NID:g12299728)" FT misc_feature 10161786..10162029 FT /note="similar to Homo sapiens EST AA190646 (NID:g1779759) FT zq44a10.r1" FT misc_feature 10161931..10162206 FT /note="similar to Homo sapiens EST BF038985 FT (NID:g10746602)" FT misc_feature 10162260..10162291 FT /note="similar to Homo sapiens EST BF038985 FT (NID:g10746602)" FT misc_feature complement(10162444..10357827) FT /note="Quality: Phrap Quality >=40 99.7% of Sequence; FT Estimated Total Number of Errors is 0.6.; STS Content:; FT SHGC-86135 G61558; WI-9872 G05448; SHGC-50686 G33724; FT SHGC-24200 G33354; SHGC-51172 G34253; WI-4297 G04613; FT SHGC-51247 G34292; SHGC4-1530 G01882; WI-945 G02751; FT SHGC-50683 G33721; SHGC-84465 G51855; SHGC-82103 G51922" FT misc_feature 10458130..10459353 FT /note="CpG_island (%GC=73.0, o/e=0.91, #CpGs=161)" FT misc_feature 10462833..10463689 FT /note="CpG_island (%GC=65.5, o/e=0.72, #CpGs=83)" FT misc_feature 10476860..10477095 FT /note="CpG_island (%GC=58.5, o/e=0.77, #CpGs=17)" FT misc_feature 10490098..10635270 FT /note="Quality: Phrap Quality >=40 99.5% of Sequence; FT Estimated Total Number of Errors is 0.7.; STS Content:; FT SHGC-50469 G33565" FT repeat_region 10762855..10763131 FT /rpt_family="MaLR" FT repeat_region 10763132..10763245 FT /rpt_family="MER1_type" FT repeat_region 10763338..10763625 FT /rpt_family="Alu" FT repeat_region 10763965..10764070 FT /rpt_family="MIR" FT repeat_region 10764911..10765084 FT /rpt_family="L1" FT repeat_region 10765153..10765185 FT /rpt_family="AT_rich" FT repeat_region 10765350..10765851 FT /rpt_family="MaLR" FT repeat_region 10766097..10766290 FT /rpt_family="L2" FT repeat_region 10767372..10767783 FT /rpt_family="ERVL" FT repeat_region 10767815..10768264 FT /rpt_family="L1" FT repeat_region 10768265..10768623 FT /rpt_family="Alu" FT repeat_region 10768624..10768902 FT /rpt_family="L1" FT repeat_region 10769515..10769603 FT /rpt_family="MIR" FT repeat_region 10769911..10770022 FT /rpt_family="MER1_type" FT repeat_region 10770033..10770344 FT /rpt_family="Alu" FT repeat_region 10770464..10770569 FT /rpt_family="L2" FT repeat_region 10770817..10771052 FT /rpt_family="MIR" FT repeat_region 10771100..10771371 FT /rpt_family="MaLR" FT repeat_region 10771372..10771599 FT /rpt_family="Alu" FT repeat_region 10772559..10772652 FT /rpt_family="L2" FT repeat_region 10772882..10773138 FT /rpt_family="MaLR" FT repeat_region 10773139..10773440 FT /rpt_family="Alu" FT repeat_region 10773441..10773671 FT /rpt_family="MaLR" FT repeat_region 10773692..10773833 FT /rpt_family="MER1_type" FT repeat_region 10775876..10775934 FT /rpt_family="L2" FT repeat_region 10776220..10776255 FT /rpt_family="AT_rich" FT repeat_region 10776273..10776492 FT /rpt_family="MIR" FT repeat_region 10776568..10776877 FT /rpt_family="Alu" FT repeat_region 10776912..10777007 FT /rpt_family="T-rich" FT repeat_region 10783139..10783263 FT /rpt_family="MIR" FT repeat_region 10784600..10784954 FT /rpt_family="MaLR" FT repeat_region 10785839..10785953 FT /rpt_family="MIR" FT repeat_region 10785975..10786247 FT /rpt_family="Alu" FT repeat_region 10786460..10786517 FT /rpt_family="MER2_type" FT repeat_region 10786600..10786671 FT /rpt_family="MER2_type" FT repeat_region 10786672..10786969 FT /rpt_family="Alu" FT repeat_region 10786970..10787131 FT /rpt_family="MER2_type" FT repeat_region 10787300..10787353 FT /rpt_family="Mariner" FT repeat_region 10787844..10788066 FT /rpt_family="MIR" FT repeat_region 10788186..10788226 FT /rpt_family="(T)n" FT repeat_region 10788228..10788704 FT /rpt_family="L1" FT repeat_region 10788926..10789113 FT /rpt_family="(TTTC)n" FT repeat_region 10789126..10789275 FT /rpt_family="(TTTCC)n" FT repeat_region 10789373..10789487 FT /rpt_family="L2" FT repeat_region 10789488..10789620 FT /rpt_family="Alu" FT repeat_region 10789621..10789639 FT /rpt_family="L2" FT repeat_region 10790053..10790166 FT /rpt_family="ERVL" FT repeat_region 10790533..10790843 FT /rpt_family="Alu" FT repeat_region 10792353..10792800 FT /rpt_family="MaLR" FT repeat_region 10793418..10793489 FT /rpt_family="CT-rich" FT repeat_region 10793903..10794034 FT /rpt_family="L2" FT repeat_region 10794788..10795310 FT /rpt_family="ERV1" FT repeat_region 10795371..10795537 FT /rpt_family="ERV1" FT repeat_region 10795538..10795937 FT /rpt_family="L1" FT repeat_region 10795938..10795964 FT /rpt_family="(TTTG)n" FT repeat_region 10795965..10796969 FT /rpt_family="L1" FT repeat_region 10796975..10797923 FT /rpt_family="L1" FT repeat_region 10797912..10800400 FT /rpt_family="L1" FT repeat_region 10800407..10800980 FT /rpt_family="ERV1" FT repeat_region 10801271..10801646 FT /rpt_family="MaLR" FT repeat_region 10801699..10801771 FT /rpt_family="MaLR" FT repeat_region 10802028..10802150 FT /rpt_family="MaLR" FT repeat_region 10802342..10802382 FT /rpt_family="(TG)n" FT repeat_region 10802382..10802427 FT /rpt_family="(GA)n" FT repeat_region 10803193..10803553 FT /rpt_family="MaLR" FT repeat_region 10804038..10804439 FT /rpt_family="MaLR" FT repeat_region 10805031..10805056 FT /rpt_family="(TG)n" FT repeat_region 10805952..10805979 FT /rpt_family="AT_rich" FT repeat_region 10806017..10806558 FT /rpt_family="ERV1" FT repeat_region 10806568..10806600 FT /rpt_family="AT_rich" FT repeat_region 10806661..10807184 FT /rpt_family="ERVL" FT repeat_region 10807547..10807900 FT /rpt_family="MaLR" FT repeat_region 10808016..10808251 FT /rpt_family="L1" FT repeat_region 10808860..10809245 FT /rpt_family="MaLR" FT repeat_region 10809595..10809892 FT /rpt_family="ERVL" FT repeat_region 10809926..10810128 FT /rpt_family="L1" FT repeat_region 10810169..10810668 FT /rpt_family="MaLR" FT repeat_region 10810707..10811464 FT /rpt_family="L1" FT repeat_region 10811682..10811826 FT /rpt_family="L1" FT repeat_region 10811866..10812018 FT /rpt_family="L1" FT repeat_region 10812019..10812314 FT /rpt_family="Alu" FT repeat_region 10812315..10812433 FT /rpt_family="L1" FT repeat_region 10812533..10812555 FT /rpt_family="AT_rich" FT repeat_region 10812617..10812742 FT /rpt_family="L2" FT repeat_region 10812791..10812978 FT /rpt_family="MER1_type" FT repeat_region 10813843..10813912 FT /rpt_family="L1" FT repeat_region 10814249..10814492 FT /rpt_family="MIR" FT repeat_region 10815383..10815750 FT /rpt_family="MaLR" FT repeat_region 10816505..10816556 FT /rpt_family="AT_rich" FT repeat_region 10816609..10816927 FT /rpt_family="Alu" FT repeat_region 10817188..10817216 FT /rpt_family="(CAA)n" FT repeat_region 10817337..10817403 FT /rpt_family="AT_rich" FT repeat_region 10817649..10818033 FT /rpt_family="L2" FT repeat_region 10818121..10818195 FT /rpt_family="MIR" FT repeat_region 10818197..10818414 FT /rpt_family="MER1_type" FT repeat_region 10818634..10819240 FT /rpt_family="MaLR" FT repeat_region 10819984..10820120 FT /rpt_family="L1" FT repeat_region 10820351..10820758 FT /rpt_family="MaLR" FT repeat_region 10820946..10821018 FT /rpt_family="MaLR" FT repeat_region 10821019..10821326 FT /rpt_family="Alu" FT repeat_region 10821327..10821620 FT /rpt_family="MaLR" FT repeat_region 10822145..10822588 FT /rpt_family="L1" FT repeat_region 10822589..10822856 FT /rpt_family="Alu" FT repeat_region 10822857..10823090 FT /rpt_family="L1" FT repeat_region 10823122..10823327 FT /rpt_family="L1" FT repeat_region 10823538..10823697 FT /rpt_family="L1" FT repeat_region 10823738..10823803 FT /rpt_family="CT-rich" FT repeat_region 10823830..10823980 FT /rpt_family="L1" FT repeat_region 10824079..10824379 FT /rpt_family="L1" FT repeat_region 10824380..10824696 FT /rpt_family="Alu" FT repeat_region 10824697..10825179 FT /rpt_family="L1" FT repeat_region 10824824..10825179 FT /rpt_family="L1" FT repeat_region 10825135..10825228 FT /rpt_family="(CATATA)n" FT repeat_region 10825229..10825260 FT /rpt_family="(TG)n" FT repeat_region 10825324..10825642 FT /rpt_family="L1" FT repeat_region 10825653..10826050 FT /rpt_family="L1" FT repeat_region 10831197..10831552 FT /rpt_family="MaLR" FT repeat_region 10831596..10831765 FT /rpt_family="MER1_type" FT repeat_region 10832036..10832376 FT /rpt_family="L2" FT repeat_region 10833063..10833083 FT /rpt_family="MaLR" FT repeat_region 10833084..10833454 FT /rpt_family="MaLR" FT repeat_region 10833455..10833915 FT /rpt_family="MaLR" FT repeat_region 10836128..10836453 FT /rpt_family="ERV1" FT repeat_region 10836721..10836770 FT /rpt_family="(CA)n" FT repeat_region 10836924..10837339 FT /rpt_family="MaLR" FT repeat_region 10838568..10838600 FT /rpt_family="(CAAAAA)n" FT repeat_region 10838891..10839007 FT /rpt_family="MIR" FT repeat_region 10839532..10839686 FT /rpt_family="MER1_type" FT repeat_region 10839557..10839592 FT /rpt_family="AT_rich" FT repeat_region 10839687..10840006 FT /rpt_family="Alu" FT repeat_region 10839977..10840045 FT /rpt_family="A-rich" FT repeat_region 10840253..10840834 FT /rpt_family="L1" FT repeat_region 10840835..10841476 FT /rpt_family="L1" FT repeat_region 10841487..10841636 FT /rpt_family="L1" FT repeat_region 10841721..10842203 FT /rpt_family="L1" FT repeat_region 10842248..10842551 FT /rpt_family="Alu" FT repeat_region 10842533..10842594 FT /rpt_family="AT_rich" FT repeat_region 10842696..10842816 FT /rpt_family="ERVL" FT repeat_region 10843175..10843789 FT /rpt_family="L1" FT repeat_region 10843848..10843924 FT /rpt_family="(TA)n" FT repeat_region 10843921..10844129 FT /rpt_family="L1" FT repeat_region 10844150..10844413 FT /rpt_family="L1" FT misc_feature 10844453..10844715 FT /note="similar to Homo sapiens EST BF833525 FT (NID:g12183131)" FT repeat_region 10844713..10845225 FT /rpt_family="MaLR" FT repeat_region 10845533..10845844 FT /rpt_family="Alu" FT repeat_region 10845815..10845881 FT /rpt_family="(CAAAAA)n" FT repeat_region 10846490..10846771 FT /rpt_family="Alu" FT repeat_region 10847312..10847339 FT /rpt_family="AT_rich" FT repeat_region 10847316..10847443 FT /rpt_family="L1" FT repeat_region 10847516..10847609 FT /rpt_family="(CA)n" FT repeat_region 10847616..10847910 FT /rpt_family="MaLR" FT repeat_region 10847912..10847979 FT /rpt_family="L1" FT repeat_region 10847980..10848331 FT /rpt_family="L1" FT repeat_region 10848475..10848603 FT /rpt_family="Alu" FT repeat_region 10848893..10848927 FT /rpt_family="AT_rich" FT repeat_region 10849696..10849751 FT /rpt_family="MER1_type" FT repeat_region 10849745..10849766 FT /rpt_family="(TTTA)n" FT repeat_region 10854908..10854968 FT /rpt_family="T-rich" FT repeat_region 10856531..10856669 FT /rpt_family="MER1_type" FT repeat_region 10856778..10856827 FT /rpt_family="AT_rich" FT repeat_region 10856961..10857286 FT /rpt_family="L1" FT repeat_region 10859288..10859367 FT /rpt_family="(TATATG)n" FT repeat_region 10859375..10859777 FT /rpt_family="L1" FT repeat_region 10859863..10860144 FT /rpt_family="L1" FT repeat_region 10860145..10860591 FT /rpt_family="MaLR" FT repeat_region 10860592..10860611 FT /rpt_family="L1" FT repeat_region 10860771..10861053 FT /rpt_family="Alu" FT repeat_region 10861062..10861210 FT /rpt_family="L1" FT repeat_region 10861216..10861532 FT /rpt_family="L1" FT repeat_region 10861283..10861305 FT /rpt_family="AT_rich" FT repeat_region 10861567..10861627 FT /rpt_family="AT_rich" FT repeat_region 10861647..10861823 FT /rpt_family="L1" FT repeat_region 10861856..10862110 FT /rpt_family="L1" FT repeat_region 10862185..10862206 FT /rpt_family="AT_rich" FT repeat_region 10863357..10863387 FT /rpt_family="AT_rich" FT repeat_region 10863654..10863676 FT /rpt_family="(T)n" FT repeat_region 10864387..10864465 FT /rpt_family="MIR" FT repeat_region 10865385..10865529 FT /rpt_family="L2" FT repeat_region 10865847..10865886 FT /rpt_family="AT_rich" FT repeat_region 10865869..10866165 FT /rpt_family="Alu" FT repeat_region 10866183..10866280 FT /rpt_family="MIR" FT repeat_region 10866444..10866752 FT /rpt_family="Alu" FT repeat_region 10866724..10866762 FT /rpt_family="A-rich" FT repeat_region 10866868..10867347 FT /rpt_family="ERVL" FT repeat_region 10867591..10867688 FT /rpt_family="MER1_type" FT repeat_region 10867776..10867973 FT /rpt_family="MER1_type" FT repeat_region 10869167..10870049 FT /rpt_family="L1" FT repeat_region 10870020..10870078 FT /rpt_family="T-rich" FT repeat_region 10870050..10870320 FT /rpt_family="Alu" FT repeat_region 10870321..10871568 FT /rpt_family="L1" FT repeat_region 10871569..10871649 FT /rpt_family="L2" FT repeat_region 10871859..10872386 FT /rpt_family="L2" FT repeat_region 10872765..10873228 FT /rpt_family="MaLR" FT repeat_region 10873229..10873453 FT /rpt_family="CR1" FT repeat_region 10873492..10873820 FT /rpt_family="L1" FT repeat_region 10873843..10873939 FT /rpt_family="MIR" FT repeat_region 10873993..10874369 FT /rpt_family="MaLR" FT repeat_region 10874686..10875041 FT /rpt_family="MaLR" FT repeat_region 10875149..10875254 FT /rpt_family="MaLR" FT repeat_region 10875579..10875928 FT /rpt_family="MaLR" FT repeat_region 10877572..10877593 FT /rpt_family="AT_rich" FT repeat_region 10878039..10878140 FT /rpt_family="MIR" FT repeat_region 10878781..10878935 FT /rpt_family="MER1_type" FT repeat_region 10879371..10879452 FT /rpt_family="L2" FT repeat_region 10879479..10879566 FT /rpt_family="MIR" FT repeat_region 10879557..10879641 FT /rpt_family="polypyrimidine" FT repeat_region 10879642..10879668 FT /rpt_family="(CAT)n" FT repeat_region 10879654..10879759 FT /rpt_family="MIR" FT repeat_region 10880029..10880089 FT /rpt_family="AT_rich" FT repeat_region 10880072..10880365 FT /rpt_family="Alu" FT repeat_region 10880219..10880246 FT /rpt_family="(T)n" FT repeat_region 10881050..10881086 FT /rpt_family="(TG)n" FT repeat_region 10881434..10882166 FT /rpt_family="L2" FT repeat_region 10882220..10882414 FT /rpt_family="L2" FT repeat_region 10882950..10883219 FT /rpt_family="MIR" FT repeat_region 10883653..10883850 FT /rpt_family="MIR" FT repeat_region 10883847..10883920 FT /rpt_family="MIR" FT repeat_region 10883994..10884062 FT /rpt_family="CT-rich" FT repeat_region 10884213..10884381 FT /rpt_family="MIR" FT repeat_region 10884577..10884992 FT /rpt_family="MaLR" FT repeat_region 10885706..10886016 FT /rpt_family="ERV1" FT repeat_region 10886188..10886208 FT /rpt_family="AT_rich" FT repeat_region 10886663..10886722 FT /rpt_family="MIR" FT repeat_region 10886890..10886980 FT /rpt_family="MER1_type" FT repeat_region 10887238..10887484 FT /rpt_family="L1" FT repeat_region 10887550..10887859 FT /rpt_family="Alu" FT repeat_region 10888052..10889289 FT /rpt_family="L1" FT repeat_region 10889029..10889053 FT /rpt_family="AT_rich" FT repeat_region 10889312..10889627 FT /rpt_family="Alu" FT misc_feature 10889371..10889769 FT /note="match to EST AI809822 (NID:g5396388) wh77f03.x1" FT repeat_region 10889605..10889627 FT /rpt_family="(TAAAAA)n" FT repeat_region 10891268..10891360 FT /rpt_family="MIR" FT repeat_region 10891320..10891340 FT /rpt_family="AT_rich" FT repeat_region 10891361..10891655 FT /rpt_family="Alu" FT repeat_region 10891656..10891708 FT /rpt_family="MIR" FT repeat_region 10891962..10892064 FT /rpt_family="ERVL" FT repeat_region 10892606..10892659 FT /rpt_family="(TTTTTG)n" FT repeat_region 10892642..10892932 FT /rpt_family="Alu" FT repeat_region 10893790..10894269 FT /rpt_family="MaLR" FT repeat_region 10894353..10894544 FT /rpt_family="MIR" FT misc_feature 10894521..10895146 FT /note="match to EST BE880154 (NID:g10328930)" FT repeat_region 10895512..10895622 FT /rpt_family="AcHobo" FT repeat_region 10895672..10896168 FT /rpt_family="AcHobo" FT repeat_region 10896049..10896098 FT /rpt_family="(TG)n" FT repeat_region 10897259..10897714 FT /rpt_family="MaLR" FT repeat_region 10897912..10898122 FT /rpt_family="MIR" FT repeat_region 10898230..10898542 FT /rpt_family="L1" FT repeat_region 10899084..10899178 FT /rpt_family="(CCCTA)n" FT repeat_region 10899180..10899353 FT /rpt_family="Alu" FT repeat_region 10899354..10899406 FT /rpt_family="Alu" FT repeat_region 10899407..10899551 FT /rpt_family="Alu" FT repeat_region 10900185..10900495 FT /rpt_family="Alu" FT misc_feature 10900458..10900490 FT /note="match to EST BE880154 (NID:g10328930)" FT repeat_region 10900465..10900500 FT /rpt_family="(A)n" FT repeat_region 10901622..10902074 FT /rpt_family="MaLR" FT repeat_region 10902177..10902325 FT /rpt_family="(TCCA)n" FT repeat_region 10902312..10902445 FT /rpt_family="L2" FT repeat_region 10902640..10902861 FT /rpt_family="L2" FT repeat_region 10902969..10903097 FT /rpt_family="MIR" FT repeat_region 10903317..10903339 FT /rpt_family="(CAAAA)n" FT repeat_region 10903464..10903491 FT /rpt_family="AT_rich" FT repeat_region 10903474..10903731 FT /rpt_family="L1" FT repeat_region 10904335..10904741 FT /rpt_family="ERVL" FT repeat_region 10904878..10904929 FT /rpt_family="(TA)n" FT repeat_region 10905010..10905063 FT /rpt_family="(TG)n" FT repeat_region 10905199..10905491 FT /rpt_family="Alu" FT repeat_region 10905896..10906258 FT /rpt_family="L1" FT repeat_region 10906262..10906393 FT /rpt_family="L1" FT repeat_region 10906459..10906658 FT /rpt_family="L1" FT repeat_region 10906659..10907013 FT /rpt_family="MaLR" FT repeat_region 10907014..10907319 FT /rpt_family="L1" FT repeat_region 10907317..10907473 FT /rpt_family="L1" FT repeat_region 10907467..10907742 FT /rpt_family="L1" FT repeat_region 10907948..10908123 FT /rpt_family="L1" FT repeat_region 10908150..10908710 FT /rpt_family="L1" FT repeat_region 10908244..10908273 FT /rpt_family="AT_rich" FT repeat_region 10908738..10909013 FT /rpt_family="L1" FT repeat_region 10909053..10909081 FT /rpt_family="AT_rich" FT repeat_region 10910095..10910179 FT /rpt_family="MIR" FT repeat_region 10910156..10910180 FT /rpt_family="AT_rich" FT repeat_region 10910401..10910445 FT /rpt_family="L1" FT repeat_region 10910446..10910478 FT /rpt_family="L1" FT repeat_region 10910639..10910891 FT /rpt_family="MaLR" FT repeat_region 10910892..10911323 FT /rpt_family="MaLR" FT repeat_region 10911324..10911441 FT /rpt_family="MaLR" FT repeat_region 10911469..10911589 FT /rpt_family="AcHobo" FT repeat_region 10911636..10911750 FT /rpt_family="MIR" FT repeat_region 10912675..10913103 FT /rpt_family="MaLR" FT repeat_region 10913110..10913308 FT /rpt_family="L2" FT repeat_region 10913364..10913403 FT /rpt_family="(GA)n" FT repeat_region 10913401..10913858 FT /rpt_family="ERVL" FT repeat_region 10913859..10914062 FT /rpt_family="L2" FT repeat_region 10914065..10914181 FT /rpt_family="L2" FT repeat_region 10914203..10914270 FT /rpt_family="L2" FT repeat_region 10914271..10914579 FT /rpt_family="Alu" FT repeat_region 10914580..10914889 FT /rpt_family="L2" FT repeat_region 10914639..10914670 FT /rpt_family="(T)n" FT repeat_region 10915091..10915253 FT /rpt_family="MIR" FT repeat_region 10915920..10916091 FT /rpt_family="L1" FT repeat_region 10916134..10916222 FT /rpt_family="L2" FT repeat_region 10916228..10916378 FT /rpt_family="MER1_type" FT repeat_region 10916396..10916535 FT /rpt_family="L2" FT repeat_region 10916746..10917092 FT /rpt_family="L1" FT repeat_region 10917096..10917223 FT /rpt_family="L1" FT repeat_region 10917384..10917839 FT /rpt_family="L1" FT repeat_region 10917889..10917965 FT /rpt_family="(TTTTC)n" FT repeat_region 10917938..10918239 FT /rpt_family="Alu" FT repeat_region 10918265..10918513 FT /rpt_family="L1" FT repeat_region 10918519..10918845 FT /rpt_family="L2" FT repeat_region 10919050..10919149 FT /rpt_family="MIR" FT repeat_region 10919940..10920130 FT /rpt_family="MER1_type" FT repeat_region 10920370..10920488 FT /rpt_family="MIR" FT repeat_region 10920425..10920446 FT /rpt_family="AT_rich" FT repeat_region 10920493..10920854 FT /rpt_family="L1" FT repeat_region 10920670..10920704 FT /rpt_family="AT_rich" FT repeat_region 10920855..10921026 FT /rpt_family="MaLR" FT repeat_region 10921027..10921335 FT /rpt_family="Alu" FT repeat_region 10921313..10921335 FT /rpt_family="(TAAA)n" FT repeat_region 10921336..10921521 FT /rpt_family="MaLR" FT repeat_region 10921522..10922419 FT /rpt_family="L1" FT repeat_region 10922567..10922589 FT /rpt_family="AT_rich" FT repeat_region 10922654..10922855 FT /rpt_family="L1" FT repeat_region 10922853..10923199 FT /rpt_family="L1" FT repeat_region 10924615..10924691 FT /rpt_family="MER1_type" FT repeat_region 10924875..10924929 FT /rpt_family="L2" FT repeat_region 10926253..10926629 FT /rpt_family="MaLR" FT repeat_region 10927025..10927111 FT /rpt_family="L2" FT repeat_region 10928033..10928201 FT /rpt_family="MIR" FT repeat_region 10928278..10928321 FT /rpt_family="MIR" FT repeat_region 10928573..10928645 FT /rpt_family="MIR" FT repeat_region 10931891..10932063 FT /rpt_family="MIR" FT repeat_region 10932275..10932399 FT /rpt_family="MIR" FT repeat_region 10932420..10932757 FT /rpt_family="(TA)n" FT repeat_region 10932758..10932808 FT /rpt_family="(CATA)n" FT repeat_region 10932902..10933099 FT /rpt_family="MIR" FT repeat_region 10934290..10934592 FT /rpt_family="Alu" FT repeat_region 10934570..10934592 FT /rpt_family="(A)n" FT repeat_region 10934593..10935059 FT /rpt_family="MaLR" FT misc_feature 10936176..10936541 FT /note="match to EST AW852230 (NID:g7947747)" FT repeat_region 10937070..10937275 FT /rpt_family="MER1_type" FT repeat_region 10937457..10937587 FT /rpt_family="MIR" FT repeat_region 10937808..10937835 FT /rpt_family="AT_rich" FT repeat_region 10937897..10938005 FT /rpt_family="MIR" FT repeat_region 10938171..10938376 FT /rpt_family="MIR" FT repeat_region 10938868..10938921 FT /rpt_family="(TA)n" FT repeat_region 10939020..10939123 FT /rpt_family="MIR" FT repeat_region 10939128..10939205 FT /rpt_family="MIR" FT misc_feature 10939276..10939279 FT /note="match to EST AW852230 (NID:g7947747)" FT repeat_region 10940615..10941000 FT /rpt_family="MaLR" FT repeat_region 10941001..10942617 FT /rpt_family="MaLR" FT repeat_region 10942618..10942985 FT /rpt_family="MaLR" FT repeat_region 10943104..10943333 FT /rpt_family="MIR" FT repeat_region 10943490..10943637 FT /rpt_family="MIR" FT repeat_region 10944593..10944762 FT /rpt_family="(TAGA)n" FT repeat_region 10944771..10945016 FT /rpt_family="MIR" FT repeat_region 10946259..10947021 FT /rpt_family="ERV1" FT repeat_region 10947156..10947548 FT /rpt_family="ERVL" FT repeat_region 10947726..10947847 FT /rpt_family="ERVL" FT repeat_region 10947862..10948248 FT /rpt_family="ERVL" FT repeat_region 10948501..10948593 FT /rpt_family="ERV1" FT repeat_region 10948590..10948936 FT /rpt_family="ERV1" FT repeat_region 10948997..10949334 FT /rpt_family="MaLR" FT repeat_region 10949367..10949433 FT /rpt_family="MIR" FT repeat_region 10949435..10950461 FT /rpt_family="ERVL" FT repeat_region 10950480..10950877 FT /rpt_family="ERVL" FT repeat_region 10951011..10951340 FT /rpt_family="ERVL" FT repeat_region 10951691..10951724 FT /rpt_family="(TG)n" FT repeat_region 10951765..10951792 FT /rpt_family="AT_rich" FT repeat_region 10952378..10952519 FT /rpt_family="MIR" FT repeat_region 10953001..10953170 FT /rpt_family="MIR" FT repeat_region 10954208..10954409 FT /rpt_family="L2" FT repeat_region 10954737..10955002 FT /rpt_family="(TTTC)n" FT repeat_region 10955205..10955342 FT /rpt_family="L2" FT repeat_region 10955410..10955952 FT /rpt_family="ERVL" FT repeat_region 10956009..10956042 FT /rpt_family="(T)n" FT repeat_region 10956014..10956323 FT /rpt_family="Alu" FT repeat_region 10956703..10956759 FT /rpt_family="(CA)n" FT repeat_region 10956763..10956961 FT /rpt_family="ERVL" FT repeat_region 10956962..10957676 FT /rpt_family="L1" FT repeat_region 10957674..10957959 FT /rpt_family="L1" FT repeat_region 10957960..10958253 FT /rpt_family="Alu" FT repeat_region 10958254..10958567 FT /rpt_family="L1" FT repeat_region 10958964..10959023 FT /rpt_family="(TC)n" FT repeat_region 10959023..10959067 FT /rpt_family="(CA)n" FT misc_feature 10959643..10960154 FT /note="match to EST BF815692 (NID:g12150488)" FT repeat_region 10960432..10960816 FT /rpt_family="ERV1" FT repeat_region 10961179..10961229 FT /rpt_family="MER1_type" FT repeat_region 10961584..10961710 FT /rpt_family="L2" FT repeat_region 10961723..10961745 FT /rpt_family="AT_rich" FT repeat_region 10961818..10961928 FT /rpt_family="CR1" FT repeat_region 10961992..10962166 FT /rpt_family="MIR" FT repeat_region 10962900..10963041 FT /rpt_family="L1" FT repeat_region 10963042..10963348 FT /rpt_family="Alu" FT repeat_region 10963321..10963348 FT /rpt_family="(A)n" FT repeat_region 10963349..10963361 FT /rpt_family="L1" FT repeat_region 10963379..10963786 FT /rpt_family="L1" FT repeat_region 10963774..10963794 FT /rpt_family="AT_rich" FT repeat_region 10964092..10964208 FT /rpt_family="L2" FT repeat_region 10964427..10964486 FT /rpt_family="MIR" FT repeat_region 10964506..10964702 FT /rpt_family="MIR" FT repeat_region 10965219..10965588 FT /rpt_family="(CA)n" FT repeat_region 10965617..10965747 FT /rpt_family="(CA)n" FT repeat_region 10965791..10965972 FT /rpt_family="(CA)n" FT misc_feature 10966028..10966416 FT /note="match to EST BF375134 (NID:g11337159)" FT repeat_region 10966459..10966511 FT /rpt_family="MIR" FT repeat_region 10967382..10967412 FT /rpt_family="AT_rich" FT repeat_region 10967442..10967469 FT /rpt_family="AT_rich" FT repeat_region 10967557..10968520 FT /rpt_family="L1" FT repeat_region 10969145..10969181 FT /rpt_family="AT_rich" FT repeat_region 10969269..10969294 FT /rpt_family="AT_rich" FT misc_feature 10969459..10969933 FT /note="match to EST AI862611 (NID:g5526718) wh99g01.x1" FT repeat_region 10969609..10969715 FT /rpt_family="MER1_type?" FT repeat_region 10969716..10969947 FT /rpt_family="Alu" FT repeat_region 10969751..10969771 FT /rpt_family="AT_rich" FT repeat_region 10969923..10969947 FT /rpt_family="(A)n" FT repeat_region 10969948..10970346 FT /rpt_family="MER1_type?" FT repeat_region 10971164..10971223 FT /rpt_family="polypyrimidine" FT repeat_region 10971225..10971271 FT /rpt_family="L2" FT repeat_region 10971949..10972044 FT /rpt_family="MIR" FT repeat_region 10972050..10972106 FT /rpt_family="(T)n" FT repeat_region 10972077..10972387 FT /rpt_family="Alu" FT repeat_region 10972918..10973252 FT /rpt_family="MaLR" FT misc_feature 10973205..10973365 FT /note="match to EST AW847164 (NID:g7942681)" FT repeat_region 10973768..10973853 FT /rpt_family="L2" FT repeat_region 10974262..10974291 FT /rpt_family="(CAAAAA)n" FT repeat_region 10974364..10974465 FT /rpt_family="MIR" FT repeat_region 10974670..10974692 FT /rpt_family="AT_rich" FT repeat_region 10975120..10975239 FT /rpt_family="L2" FT repeat_region 10975616..10975780 FT /rpt_family="MIR" FT repeat_region 10976053..10976424 FT /rpt_family="MaLR" FT repeat_region 10976466..10976624 FT /rpt_family="Alu" FT repeat_region 10977265..10977445 FT /rpt_family="MIR" FT repeat_region 10977864..10978070 FT /rpt_family="L1" FT repeat_region 10978071..10978375 FT /rpt_family="Alu" FT repeat_region 10978353..10978376 FT /rpt_family="(CAAA)n" FT repeat_region 10978376..10978407 FT /rpt_family="L1" FT repeat_region 10978468..10978533 FT /rpt_family="MIR" FT repeat_region 10980613..10980869 FT /rpt_family="MIR" FT repeat_region 10981793..10981929 FT /rpt_family="L2" FT repeat_region 10982066..10982193 FT /rpt_family="L2" FT repeat_region 10982963..10983483 FT /rpt_family="ERV1" FT repeat_region 10983807..10984359 FT /rpt_family="ERV1" FT repeat_region 10984280..10984329 FT /rpt_family="A-rich" FT repeat_region 10985931..10986052 FT /rpt_family="MIR" FT repeat_region 10986834..10986932 FT /rpt_family="ERV1" FT repeat_region 10986933..10987466 FT /rpt_family="L1" FT repeat_region 10987927..10988288 FT /rpt_family="MaLR" FT repeat_region 10988640..10988988 FT /rpt_family="MaLR" FT repeat_region 10989412..10989760 FT /rpt_family="L1" FT repeat_region 10989961..10989984 FT /rpt_family="AT_rich" FT repeat_region 10990025..10990322 FT /rpt_family="MaLR" FT repeat_region 10990403..10990550 FT /rpt_family="MaLR" FT repeat_region 10990521..10990548 FT /rpt_family="AT_rich" FT repeat_region 10991140..10991165 FT /rpt_family="(TG)n" FT repeat_region 10991195..10991579 FT /rpt_family="ERVL" FT repeat_region 10991765..10992142 FT /rpt_family="L2" FT repeat_region 10992450..10992840 FT /rpt_family="L1" FT repeat_region 10993178..10993615 FT /rpt_family="L1" FT repeat_region 10994556..10995046 FT /rpt_family="MaLR" FT repeat_region 10994739..10994787 FT /rpt_family="(CA)n" FT repeat_region 10995225..10995397 FT /rpt_family="ERVL" FT repeat_region 10995739..10996033 FT /rpt_family="Alu" FT repeat_region 10996111..10996152 FT /rpt_family="(TTA)n" FT repeat_region 10996252..10996498 FT /rpt_family="L1" FT repeat_region 10996886..10997200 FT /rpt_family="Alu" FT repeat_region 10997165..10997203 FT /rpt_family="A-rich" FT repeat_region 10998668..10998702 FT /rpt_family="AT_rich" FT repeat_region 10998831..10998931 FT /rpt_family="(CA)n" FT repeat_region 10998866..10998931 FT /rpt_family="ERV1" FT repeat_region 10999318..10999402 FT /rpt_family="L2" FT repeat_region 10999560..10999960 FT /rpt_family="L2" FT repeat_region 11000273..11000401 FT /rpt_family="L2" FT repeat_region 11000842..11000961 FT /rpt_family="MIR" FT repeat_region 11001145..11001186 FT /rpt_family="(CAAAAA)n" FT repeat_region 11001420..11001446 FT /rpt_family="AT_rich" FT repeat_region 11001590..11001728 FT /rpt_family="MIR" FT repeat_region 11001901..11002102 FT /rpt_family="MER1_type" FT repeat_region 11002794..11003046 FT /rpt_family="MER2_type" FT repeat_region 11003048..11003527 FT /rpt_family="ERVL" FT repeat_region 11003437..11003483 FT /rpt_family="(CA)n" FT repeat_region 11003528..11004007 FT /rpt_family="MER2_type" FT repeat_region 11004011..11004069 FT /rpt_family="MER2_type" FT repeat_region 11004264..11004455 FT /rpt_family="ERVL" FT repeat_region 11004456..11004884 FT /rpt_family="MaLR" FT repeat_region 11004885..11004911 FT /rpt_family="ERVL" FT repeat_region 11004912..11005295 FT /rpt_family="MaLR" FT repeat_region 11005296..11005394 FT /rpt_family="ERVL" FT repeat_region 11005439..11005603 FT /rpt_family="MIR" FT repeat_region 11006303..11006435 FT /rpt_family="MIR" FT repeat_region 11006608..11006741 FT /rpt_family="ERVL" FT repeat_region 11006742..11007110 FT /rpt_family="MaLR" FT repeat_region 11007111..11007325 FT /rpt_family="ERVL" FT repeat_region 11007365..11007451 FT /rpt_family="L2" FT repeat_region 11007880..11007981 FT /rpt_family="(TATATG)n" FT repeat_region 11008044..11008297 FT /rpt_family="L1" FT repeat_region 11008304..11008626 FT /rpt_family="MER1_type" FT repeat_region 11008784..11008921 FT /rpt_family="MIR" FT repeat_region 11009376..11009969 FT /rpt_family="L2" FT repeat_region 11010000..11010095 FT /rpt_family="MIR" FT repeat_region 11010180..11010262 FT /rpt_family="MaLR" FT repeat_region 11010312..11010678 FT /rpt_family="MaLR" FT repeat_region 11010746..11010938 FT /rpt_family="MIR" FT repeat_region 11011342..11011593 FT /rpt_family="MIR" FT repeat_region 11031582..11031707 FT /rpt_family="L1" FT repeat_region 11031716..11031823 FT /rpt_family="MaLR" FT repeat_region 11031947..11032238 FT /rpt_family="Alu" FT repeat_region 11032239..11032556 FT /rpt_family="L1" FT repeat_region 11032566..11032664 FT /rpt_family="(TA)n" FT repeat_region 11032665..11032827 FT /rpt_family="L1" FT repeat_region 11032828..11033185 FT /rpt_family="MaLR" FT repeat_region 11033186..11033293 FT /rpt_family="L1" FT repeat_region 11033298..11033386 FT /rpt_family="L1" FT repeat_region 11033534..11033714 FT /rpt_family="MaLR" FT repeat_region 11033855..11034232 FT /rpt_family="MaLR" FT repeat_region 11034368..11034444 FT /rpt_family="MaLR" FT repeat_region 11034811..11034974 FT /rpt_family="L1" FT repeat_region 11036210..11036233 FT /rpt_family="AT_rich" FT repeat_region 11036805..11036852 FT /rpt_family="AT_rich" FT repeat_region 11037272..11037346 FT /rpt_family="MIR" FT repeat_region 11037616..11037736 FT /rpt_family="(TA)n" FT repeat_region 11037821..11037879 FT /rpt_family="(TA)n" FT repeat_region 11038293..11038403 FT /rpt_family="MIR" FT repeat_region 11039868..11040001 FT /rpt_family="MIR" FT repeat_region 11040539..11040701 FT /rpt_family="MIR" FT repeat_region 11040725..11040927 FT /rpt_family="CR1" FT repeat_region 11042041..11042439 FT /rpt_family="MaLR" FT repeat_region 11042465..11042635 FT /rpt_family="MIR" FT repeat_region 11043103..11043127 FT /rpt_family="AT_rich" FT repeat_region 11043144..11043166 FT /rpt_family="(TTTTTA)n" FT repeat_region 11043811..11043958 FT /rpt_family="ERVL" FT repeat_region 11043857..11043987 FT /rpt_family="MaLR" FT repeat_region 11049406..11049703 FT /rpt_family="Alu" FT repeat_region 11049899..11049971 FT /rpt_family="MER1_type" FT repeat_region 11050020..11050232 FT /rpt_family="MIR" FT repeat_region 11050405..11050657 FT /rpt_family="L1" FT repeat_region 11051036..11051094 FT /rpt_family="MIR" FT repeat_region 11052215..11052243 FT /rpt_family="(CA)n" FT repeat_region 11052243..11052271 FT /rpt_family="(GA)n" FT repeat_region 11053279..11053616 FT /rpt_family="MaLR" FT repeat_region 11053643..11053786 FT /rpt_family="MIR" FT repeat_region 11053897..11054168 FT /rpt_family="Alu" FT repeat_region 11054169..11054195 FT /rpt_family="(TA)n" FT repeat_region 11054369..11054411 FT /rpt_family="(TG)n" FT repeat_region 11054681..11054833 FT /rpt_family="ERVL" FT repeat_region 11054991..11055292 FT /rpt_family="Alu" FT repeat_region 11056082..11056106 FT /rpt_family="(A)n" FT repeat_region 11056326..11056469 FT /rpt_family="MIR" FT repeat_region 11056727..11057056 FT /rpt_family="Alu" FT repeat_region 11057184..11057238 FT /rpt_family="L2" FT repeat_region 11057263..11057324 FT /rpt_family="ERV1" FT repeat_region 11057341..11057738 FT /rpt_family="MaLR" FT repeat_region 11057769..11057799 FT /rpt_family="(TCTCTG)n" FT repeat_region 11057800..11057898 FT /rpt_family="(TA)n" FT repeat_region 11058951..11059509 FT /rpt_family="ERV1" FT repeat_region 11059545..11059698 FT /rpt_family="MIR" FT repeat_region 11060594..11060766 FT /rpt_family="MIR" FT repeat_region 11060872..11061561 FT /rpt_family="L1" FT repeat_region 11061593..11061894 FT /rpt_family="Alu" FT repeat_region 11062208..11062253 FT /rpt_family="Mariner" FT repeat_region 11062254..11062325 FT /rpt_family="AT_rich" FT repeat_region 11062431..11062534 FT /rpt_family="MIR" FT repeat_region 11068829..11069263 FT /rpt_family="MaLR" FT repeat_region 11069275..11069502 FT /rpt_family="MIR" FT repeat_region 11069672..11069707 FT /rpt_family="AT_rich" FT repeat_region 11069724..11069901 FT /rpt_family="(GAAA)n" FT repeat_region 11070037..11070129 FT /rpt_family="L2" FT repeat_region 11070144..11070321 FT /rpt_family="L1" FT repeat_region 11070359..11070829 FT /rpt_family="MaLR" FT repeat_region 11071064..11071271 FT /rpt_family="L1" FT repeat_region 11071815..11072046 FT /rpt_family="MIR" FT repeat_region 11072193..11073072 FT /rpt_family="ERV1" FT repeat_region 11073571..11073599 FT /rpt_family="AT_rich" FT repeat_region 11073877..11074066 FT /rpt_family="MIR" FT repeat_region 11074284..11074367 FT /rpt_family="MIR" FT repeat_region 11074882..11075009 FT /rpt_family="L2" FT repeat_region 11075135..11075192 FT /rpt_family="L2" FT repeat_region 11075306..11075372 FT /rpt_family="MIR" FT repeat_region 11075481..11076029 FT /rpt_family="L2" FT repeat_region 11076061..11076276 FT /rpt_family="MIR" FT repeat_region 11076289..11076471 FT /rpt_family="MER1_type" FT repeat_region 11076650..11076957 FT /rpt_family="L1" FT repeat_region 11077065..11077087 FT /rpt_family="AT_rich" FT repeat_region 11077110..11077326 FT /rpt_family="L1" FT repeat_region 11077483..11077548 FT /rpt_family="(CATATA)n" FT repeat_region 11077976..11078021 FT /rpt_family="AT_rich" FT repeat_region 11078130..11078356 FT /rpt_family="MIR" FT repeat_region 11078637..11078759 FT /rpt_family="L1" FT repeat_region 11078839..11078876 FT /rpt_family="(TTTA)n" FT repeat_region 11078877..11079441 FT /rpt_family="L1" FT repeat_region 11079442..11080084 FT /rpt_family="L1" FT repeat_region 11080295..11080363 FT /rpt_family="(TA)n" FT repeat_region 11080460..11080524 FT /rpt_family="GA-rich" FT repeat_region 11080687..11081044 FT /rpt_family="MaLR" FT repeat_region 11081198..11081357 FT /rpt_family="MIR" FT repeat_region 11081364..11081440 FT /rpt_family="MIR" FT repeat_region 11081544..11081572 FT /rpt_family="AT_rich" FT repeat_region 11081622..11081661 FT /rpt_family="MIR" FT repeat_region 11081952..11081979 FT /rpt_family="(TTTG)n" FT repeat_region 11082005..11082027 FT /rpt_family="AT_rich" FT repeat_region 11082169..11082180 FT /rpt_family="MaLR" FT repeat_region 11082181..11082552 FT /rpt_family="MaLR" FT repeat_region 11082553..11083116 FT /rpt_family="MaLR" FT repeat_region 11083365..11083649 FT /rpt_family="Alu" FT repeat_region 11083830..11084193 FT /rpt_family="MaLR" FT repeat_region 11084776..11084884 FT /rpt_family="MIR" FT repeat_region 11085430..11085627 FT /rpt_family="L2" FT repeat_region 11085644..11085928 FT /rpt_family="Alu" FT repeat_region 11086045..11086153 FT /rpt_family="MIR" FT repeat_region 11086608..11086707 FT /rpt_family="MIR" FT repeat_region 11087339..11087515 FT /rpt_family="MIR" FT repeat_region 11087785..11087843 FT /rpt_family="(TAA)n" FT repeat_region 11088064..11088399 FT /rpt_family="ERVL" FT repeat_region 11089085..11089394 FT /rpt_family="Alu" FT repeat_region 11089838..11089896 FT /rpt_family="Mariner" FT repeat_region 11089897..11090198 FT /rpt_family="Alu" FT repeat_region 11090199..11090250 FT /rpt_family="Mariner" FT repeat_region 11090372..11090593 FT /rpt_family="MER1_type" FT repeat_region 11090604..11090716 FT /rpt_family="MIR" FT repeat_region 11091366..11091772 FT /rpt_family="MaLR" FT repeat_region 11091867..11092244 FT /rpt_family="L2" FT repeat_region 11092296..11093641 FT /rpt_family="L1" FT repeat_region 11093647..11093952 FT /rpt_family="Alu" FT repeat_region 11094002..11094513 FT /rpt_family="L1" FT repeat_region 11094532..11094878 FT /rpt_family="MaLR" FT repeat_region 11094883..11096070 FT /rpt_family="L1" FT repeat_region 11096071..11096284 FT /rpt_family="Alu" FT repeat_region 11096285..11097777 FT /rpt_family="L1" FT repeat_region 11097787..11097881 FT /rpt_family="L2" FT repeat_region 11097938..11098134 FT /rpt_family="MIR" FT repeat_region 11098725..11099031 FT /rpt_family="Alu" FT repeat_region 11099595..11099651 FT /rpt_family="L2" FT repeat_region 11101990..11102284 FT /rpt_family="Alu" FT repeat_region 11102365..11102548 FT /rpt_family="MIR" FT repeat_region 11102818..11103087 FT /rpt_family="Alu" FT repeat_region 11103505..11103783 FT /rpt_family="L1" FT repeat_region 11107355..11107479 FT /rpt_family="MaLR" FT repeat_region 11107660..11107732 FT /rpt_family="MIR" FT repeat_region 11109079..11109391 FT /rpt_family="L1" FT repeat_region 11109507..11110263 FT /rpt_family="ERV1" FT repeat_region 11110926..11111118 FT /rpt_family="L2" FT repeat_region 11111778..11111805 FT /rpt_family="(CA)n" FT repeat_region 11111821..11111955 FT /rpt_family="MIR" FT repeat_region 11112546..11112940 FT /rpt_family="MaLR" FT repeat_region 11112957..11113039 FT /rpt_family="L2" FT repeat_region 11113293..11113433 FT /rpt_family="L2" FT repeat_region 11113464..11113575 FT /rpt_family="L2" FT repeat_region 11113951..11113979 FT /rpt_family="(CA)n" FT repeat_region 11115148..11115222 FT /rpt_family="MIR" FT repeat_region 11116126..11116175 FT /rpt_family="L2" FT repeat_region 11116311..11116734 FT /rpt_family="MaLR" FT repeat_region 11116922..11117111 FT /rpt_family="MIR" FT repeat_region 11118066..11118246 FT /rpt_family="ERVL" FT repeat_region 11119507..11119610 FT /rpt_family="MIR" FT repeat_region 11120074..11120147 FT /rpt_family="MaLR" FT repeat_region 11122032..11123002 FT /rpt_family="AcHobo" FT repeat_region 11123043..11123248 FT /rpt_family="MIR" FT repeat_region 11123552..11123954 FT /rpt_family="L1" FT repeat_region 11123955..11124254 FT /rpt_family="Alu" FT repeat_region 11124255..11125291 FT /rpt_family="L1" FT repeat_region 11125538..11125559 FT /rpt_family="AcHobo" FT repeat_region 11125560..11125863 FT /rpt_family="Alu" FT repeat_region 11125864..11125935 FT /rpt_family="AcHobo" FT repeat_region 11125995..11126118 FT /rpt_family="L2" FT repeat_region 11126388..11126536 FT /rpt_family="L2" FT repeat_region 11126752..11126809 FT /rpt_family="L1" FT repeat_region 11128555..11128870 FT /rpt_family="Alu" FT repeat_region 11129075..11129348 FT /rpt_family="Alu" FT repeat_region 11129754..11130048 FT /rpt_family="Alu" FT repeat_region 11130160..11131060 FT /rpt_family="Ricksha" FT repeat_region 11131061..11131085 FT /rpt_family="(TTTG)n" FT repeat_region 11131086..11131680 FT /rpt_family="Ricksha" FT repeat_region 11131680..11131722 FT /rpt_family="Ricksha" FT repeat_region 11131723..11131737 FT /rpt_family="ERVL" FT repeat_region 11131743..11131812 FT /rpt_family="Ricksha" FT repeat_region 11132274..11132913 FT /rpt_family="L2" FT repeat_region 11133018..11133081 FT /rpt_family="MIR" FT repeat_region 11133359..11133760 FT /rpt_family="MaLR" FT repeat_region 11133922..11134040 FT /rpt_family="MIR" FT repeat_region 11134053..11134168 FT /rpt_family="MIR" FT repeat_region 11134189..11134250 FT /rpt_family="L2" FT repeat_region 11134287..11134754 FT /rpt_family="MaLR" FT repeat_region 11135326..11135559 FT /rpt_family="CT-rich" FT repeat_region 11135613..11136457 FT /rpt_family="MER2_type" FT repeat_region 11136658..11136747 FT /rpt_family="(TCCCC)n" FT repeat_region 11136932..11136975 FT /rpt_family="(TG)n" FT repeat_region 11136976..11137072 FT /rpt_family="L1" FT repeat_region 11138205..11138411 FT /rpt_family="CR1" FT repeat_region 11141122..11141283 FT /rpt_family="(TGGA)n" FT repeat_region 11142054..11142155 FT /rpt_family="CT-rich" FT repeat_region 11142159..11142335 FT /rpt_family="(TTC)n" FT repeat_region 11142828..11142848 FT /rpt_family="AT_rich" FT repeat_region 11143008..11143112 FT /rpt_family="MER1_type" FT repeat_region 11143786..11144051 FT /rpt_family="Alu" FT repeat_region 11144560..11144609 FT /rpt_family="ERVL" FT repeat_region 11144610..11144994 FT /rpt_family="MaLR" FT repeat_region 11144995..11145222 FT /rpt_family="ERVL" FT repeat_region 11151646..11152318 FT /rpt_family="L1" FT repeat_region 11152331..11152468 FT /rpt_family="ERVL" FT repeat_region 11152469..11152827 FT /rpt_family="MaLR" FT repeat_region 11152828..11153177 FT /rpt_family="ERVL" FT repeat_region 11153457..11153754 FT /rpt_family="Alu" FT repeat_region 11154229..11154773 FT /rpt_family="ERV" FT repeat_region 11155258..11155528 FT /rpt_family="L1" FT repeat_region 11156650..11156745 FT /rpt_family="MIR" FT repeat_region 11157681..11157843 FT /rpt_family="(GA)n" FT repeat_region 11158442..11158494 FT /rpt_family="MIR" FT repeat_region 11160020..11160158 FT /rpt_family="L1" FT repeat_region 11160675..11161103 FT /rpt_family="ERV1" FT repeat_region 11161132..11161157 FT /rpt_family="(CAA)n" FT repeat_region 11161373..11161409 FT /rpt_family="(CA)n" FT repeat_region 11162025..11162190 FT /rpt_family="MIR" FT repeat_region 11162969..11163100 FT /rpt_family="L2" FT repeat_region 11163104..11163302 FT /rpt_family="MaLR" FT repeat_region 11163573..11163725 FT /rpt_family="L2" FT repeat_region 11163726..11164085 FT /rpt_family="MaLR" FT repeat_region 11164873..11165031 FT /rpt_family="(TTATA)n" FT repeat_region 11165034..11165109 FT /rpt_family="(TA)n" FT repeat_region 11166423..11166538 FT /rpt_family="MIR" FT repeat_region 11167436..11167545 FT /rpt_family="(TA)n" FT repeat_region 11167774..11167891 FT /rpt_family="MIR" FT repeat_region 11167968..11168011 FT /rpt_family="(CA)n" FT repeat_region 11168487..11168646 FT /rpt_family="MIR" FT repeat_region 11168732..11168755 FT /rpt_family="AT_rich" FT repeat_region 11168994..11169128 FT /rpt_family="MIR" FT repeat_region 11169125..11169328 FT /rpt_family="MIR" FT repeat_region 11173439..11173802 FT /rpt_family="L1" FT repeat_region 11174704..11175166 FT /rpt_family="ERVL" FT repeat_region 11177162..11177288 FT /rpt_family="L2" FT repeat_region 11177289..11177322 FT /rpt_family="(TGAA)n" FT repeat_region 11177419..11177439 FT /rpt_family="AT_rich" FT repeat_region 11178206..11178415 FT /rpt_family="MIR" FT repeat_region 11178470..11178591 FT /rpt_family="MIR" FT repeat_region 11178592..11178658 FT /rpt_family="MER2_type" FT repeat_region 11178677..11178960 FT /rpt_family="MER2_type" FT repeat_region 11178962..11179267 FT /rpt_family="Alu" FT repeat_region 11179348..11179431 FT /rpt_family="MIR" FT repeat_region 11179976..11180095 FT /rpt_family="MIR" FT repeat_region 11180765..11181064 FT /rpt_family="Alu" FT repeat_region 11181136..11181917 FT /rpt_family="ERVL" FT repeat_region 11182096..11182188 FT /rpt_family="CR1" FT repeat_region 11182597..11182905 FT /rpt_family="L2" FT repeat_region 11183643..11184056 FT /rpt_family="MaLR" FT repeat_region 11184087..11184438 FT /rpt_family="MaLR" FT repeat_region 11184848..11184986 FT /rpt_family="MIR" FT repeat_region 11185051..11185160 FT /rpt_family="L2" FT repeat_region 11185524..11185551 FT /rpt_family="AT_rich" FT repeat_region 11185985..11186153 FT /rpt_family="MaLR" FT repeat_region 11186154..11186200 FT /rpt_family="(GA)n" FT repeat_region 11186201..11186371 FT /rpt_family="MaLR" FT repeat_region 11186605..11186816 FT /rpt_family="MER1_type" FT repeat_region 11187076..11187181 FT /rpt_family="MIR" FT repeat_region 11187189..11187229 FT /rpt_family="T-rich" FT repeat_region 11187448..11187542 FT /rpt_family="MIR" FT repeat_region 11187679..11188127 FT /rpt_family="MER2_type" FT repeat_region 11188132..11188710 FT /rpt_family="ERVL" FT repeat_region 11188711..11188819 FT /rpt_family="MER2_type" FT repeat_region 11189004..11189117 FT /rpt_family="MIR" FT repeat_region 11190689..11191050 FT /rpt_family="ERVL" FT repeat_region 11191126..11191295 FT /rpt_family="MIR" FT repeat_region 11192574..11192988 FT /rpt_family="MaLR" FT repeat_region 11193013..11193343 FT /rpt_family="L1" FT repeat_region 11193370..11193716 FT /rpt_family="Alu" FT repeat_region 11193731..11194162 FT /rpt_family="L1" FT repeat_region 11194504..11194631 FT /rpt_family="GA-rich" FT repeat_region 11195422..11195492 FT /rpt_family="(TTTAA)n" FT repeat_region 11197906..11197963 FT /rpt_family="CR1" FT misc_feature 11198049..11198460 FT /note="match to EST AI819483 (NID:g5438562) wj90e06.x1" FT repeat_region 11198510..11198537 FT /rpt_family="(TTTTA)n" FT repeat_region 11198693..11198888 FT /rpt_family="MIR" FT repeat_region 11198889..11198958 FT /rpt_family="ERVL" FT repeat_region 11199889..11199937 FT /rpt_family="(CA)n" FT repeat_region 11199984..11200137 FT /rpt_family="MIR" FT repeat_region 11200138..11200668 FT /rpt_family="ERVL" FT repeat_region 11200696..11200746 FT /rpt_family="MIR" FT repeat_region 11200867..11201249 FT /rpt_family="MaLR" FT repeat_region 11201452..11201744 FT /rpt_family="Alu" FT repeat_region 11201730..11201765 FT /rpt_family="AT_rich" FT repeat_region 11202063..11202879 FT /rpt_family="L1" FT repeat_region 11203479..11204516 FT /rpt_family="L1" FT repeat_region 11205261..11205356 FT /rpt_family="ERVL" FT repeat_region 11205738..11206206 FT /rpt_family="L1" FT repeat_region 11206207..11206271 FT /rpt_family="ERVL" FT repeat_region 11206307..11206695 FT /rpt_family="L1" FT repeat_region 11206403..11206438 FT /rpt_family="AT_rich" FT repeat_region 11206887..11206914 FT /rpt_family="AT_rich" FT repeat_region 11206914..11207029 FT /rpt_family="MIR" FT repeat_region 11207284..11207534 FT /rpt_family="L1" FT repeat_region 11207671..11207699 FT /rpt_family="AT_rich" FT repeat_region 11208066..11208852 FT /rpt_family="L1" FT repeat_region 11209520..11209905 FT /rpt_family="MaLR" FT repeat_region 11210849..11210998 FT /rpt_family="MIR" FT repeat_region 11211233..11211392 FT /rpt_family="Alu" FT misc_feature 11211470..11211716 FT /note="similar to Homo sapiens EST BF758988 FT (NID:g12106888)" FT repeat_region 11211960..11211989 FT /rpt_family="AT_rich" FT repeat_region 11212235..11212305 FT /rpt_family="MIR" FT repeat_region 11212517..11212870 FT /rpt_family="CR1" FT repeat_region 11212910..11213100 FT /rpt_family="MIR" FT repeat_region 11213182..11213615 FT /rpt_family="MaLR" FT repeat_region 11213618..11213670 FT /rpt_family="Mariner" FT repeat_region 11213671..11213982 FT /rpt_family="Alu" FT repeat_region 11213953..11213975 FT /rpt_family="(TAAA)n" FT repeat_region 11213983..11214014 FT /rpt_family="Mariner" FT repeat_region 11214022..11214601 FT /rpt_family="MER2_type" FT repeat_region 11214603..11214893 FT /rpt_family="Alu" FT repeat_region 11214898..11215105 FT /rpt_family="MER2_type" FT repeat_region 11215353..11215453 FT /rpt_family="CR1" FT repeat_region 11215879..11216152 FT /rpt_family="MaLR" FT repeat_region 11216212..11216452 FT /rpt_family="CR1" FT repeat_region 11216636..11217010 FT /rpt_family="MaLR" FT repeat_region 11217152..11217180 FT /rpt_family="(A)n" FT repeat_region 11218426..11218527 FT /rpt_family="MIR" FT repeat_region 11218757..11218927 FT /rpt_family="MIR" FT repeat_region 11218934..11219320 FT /rpt_family="ERV1" FT repeat_region 11219312..11219502 FT /rpt_family="MaLR" FT repeat_region 11219647..11219711 FT /rpt_family="L2" FT repeat_region 11219775..11219927 FT /rpt_family="MIR" FT repeat_region 11221274..11221648 FT /rpt_family="L1" FT repeat_region 11221791..11221970 FT /rpt_family="L1" FT repeat_region 11222248..11222599 FT /rpt_family="L1" FT repeat_region 11222395..11222418 FT /rpt_family="AT_rich" FT repeat_region 11222895..11223104 FT /rpt_family="L1" FT repeat_region 11223233..11223449 FT /rpt_family="MER1_type" FT repeat_region 11223463..11223565 FT /rpt_family="MIR" FT repeat_region 11224398..11224612 FT /rpt_family="MIR" FT repeat_region 11226601..11226701 FT /rpt_family="L2" FT repeat_region 11226745..11227171 FT /rpt_family="ERVL" FT repeat_region 11227266..11229035 FT /rpt_family="ERVL" FT repeat_region 11229042..11229485 FT /rpt_family="ERVL" FT repeat_region 11229956..11230133 FT /rpt_family="MIR" FT repeat_region 11230269..11230492 FT /rpt_family="MER1_type" FT repeat_region 11230531..11230624 FT /rpt_family="MIR" FT repeat_region 11231133..11231333 FT /rpt_family="MaLR" FT repeat_region 11231778..11231883 FT /rpt_family="L2" FT repeat_region 11232184..11232342 FT /rpt_family="MIR" FT repeat_region 11232341..11232389 FT /rpt_family="(TA)n" FT repeat_region 11233172..11233438 FT /rpt_family="Alu" FT repeat_region 11234116..11234219 FT /rpt_family="Alu" FT repeat_region 11234568..11234745 FT /rpt_family="MIR" FT repeat_region 11235775..11236014 FT /rpt_family="MIR" FT repeat_region 11236021..11236118 FT /rpt_family="MIR" FT repeat_region 11236581..11236668 FT /rpt_family="L2" FT repeat_region 11236747..11236794 FT /rpt_family="(TCCCC)n" FT repeat_region 11243291..11243885 FT /rpt_family="L1" FT repeat_region 11243882..11244198 FT /rpt_family="L1" FT repeat_region 11244199..11244268 FT /rpt_family="L1" FT repeat_region 11244270..11244622 FT /rpt_family="L1" FT repeat_region 11244624..11244729 FT /rpt_family="L1" FT repeat_region 11244806..11245066 FT /rpt_family="Alu" FT repeat_region 11245268..11245352 FT /rpt_family="GA-rich" FT repeat_region 11245396..11245500 FT /rpt_family="MER1_type" FT repeat_region 11245527..11245570 FT /rpt_family="AT_rich" FT repeat_region 11245559..11247286 FT /rpt_family="MER1_type" FT repeat_region 11246804..11246853 FT /rpt_family="(TTTTG)n" FT repeat_region 11247306..11247328 FT /rpt_family="AT_rich" FT repeat_region 11247381..11248538 FT /rpt_family="L1" FT repeat_region 11247384..11249008 FT /rpt_family="L1" FT repeat_region 11249009..11249305 FT /rpt_family="Alu" FT repeat_region 11249308..11249830 FT /rpt_family="MER1_type" FT repeat_region 11249860..11249980 FT /rpt_family="L1" FT repeat_region 11250167..11250194 FT /rpt_family="AT_rich" FT repeat_region 11250836..11250948 FT /rpt_family="MIR" FT repeat_region 11251354..11251659 FT /rpt_family="Alu" FT repeat_region 11251633..11251653 FT /rpt_family="(A)n" FT repeat_region 11251742..11252085 FT /rpt_family="L2" FT repeat_region 11255171..11255278 FT /rpt_family="GA-rich" FT repeat_region 11256088..11256429 FT /rpt_family="ERVL" FT repeat_region 11256646..11256888 FT /rpt_family="MIR" FT repeat_region 11258392..11258691 FT /rpt_family="MaLR" FT repeat_region 11258748..11258810 FT /rpt_family="L1" FT repeat_region 11258844..11258929 FT /rpt_family="L2" FT repeat_region 11259144..11259415 FT /rpt_family="L1" FT repeat_region 11259416..11259724 FT /rpt_family="Alu" FT misc_feature 11259701..11259724 FT /note="similar to Homo sapiens EST BF183502 FT (NID:g11061813)" FT repeat_region 11259725..11259760 FT /rpt_family="L1" FT repeat_region 11259762..11260027 FT /rpt_family="L1" FT repeat_region 11260028..11260289 FT /rpt_family="Alu" FT repeat_region 11260290..11260830 FT /rpt_family="L1" FT repeat_region 11260871..11260919 FT /rpt_family="MER1_type" FT repeat_region 11262229..11262253 FT /rpt_family="(T)n" FT repeat_region 11262412..11262711 FT /rpt_family="Alu" FT repeat_region 11262712..11262839 FT /rpt_family="Alu" FT repeat_region 11263449..11263481 FT /rpt_family="AT_rich" FT repeat_region 11263669..11264038 FT /rpt_family="ERVL" FT repeat_region 11263842..11263918 FT /rpt_family="A-rich" FT repeat_region 11264092..11264160 FT /rpt_family="(CATATA)n" FT repeat_region 11264459..11264509 FT /rpt_family="GA-rich" FT repeat_region 11264717..11265197 FT /rpt_family="L1" FT repeat_region 11265183..11265492 FT /rpt_family="L1" FT repeat_region 11265565..11265694 FT /rpt_family="L2" FT repeat_region 11265600..11265623 FT /rpt_family="AT_rich" FT repeat_region 11265706..11265980 FT /rpt_family="L1" FT repeat_region 11266177..11266288 FT /rpt_family="L1" FT repeat_region 11266389..11266539 FT /rpt_family="L1" FT repeat_region 11266790..11266977 FT /rpt_family="MER2_type" FT repeat_region 11267662..11269354 FT /rpt_family="L1" FT repeat_region 11269846..11270018 FT /rpt_family="MER1_type" FT repeat_region 11271065..11271109 FT /rpt_family="(TCTA)n" FT repeat_region 11271109..11271388 FT /rpt_family="Alu" FT repeat_region 11272219..11272239 FT /rpt_family="(TA)n" FT repeat_region 11272673..11273227 FT /rpt_family="ERVL" FT repeat_region 11273483..11273914 FT /rpt_family="MaLR" FT repeat_region 11274424..11274895 FT /rpt_family="L2" FT repeat_region 11275071..11275150 FT /rpt_family="L2" FT repeat_region 11275262..11275501 FT /rpt_family="MIR" FT repeat_region 11275618..11276081 FT /rpt_family="L2" FT repeat_region 11276105..11276427 FT /rpt_family="L2" FT repeat_region 11276438..11276950 FT /rpt_family="ERVL" FT repeat_region 11276978..11277078 FT /rpt_family="L2" FT repeat_region 11278140..11278182 FT /rpt_family="(T)n" FT repeat_region 11278155..11278464 FT /rpt_family="Alu" FT misc_feature 11278470..11278929 FT /note="match to EST AW881884 (NID:g8043894)" FT repeat_region 11278555..11278725 FT /rpt_family="MIR" FT repeat_region 11278802..11278960 FT /rpt_family="MER1_type" FT repeat_region 11280666..11280801 FT /rpt_family="MaLR" FT repeat_region 11281130..11281297 FT /rpt_family="MIR" FT repeat_region 11282346..11282730 FT /rpt_family="L2" FT repeat_region 11282860..11282923 FT /rpt_family="MIR" FT repeat_region 11283350..11283459 FT /rpt_family="MIR" FT repeat_region 11283531..11283551 FT /rpt_family="AT_rich" FT repeat_region 11284147..11284341 FT /rpt_family="MER1_type?" FT repeat_region 11284215..11284251 FT /rpt_family="AT_rich" FT repeat_region 11284463..11284827 FT /rpt_family="MaLR" FT repeat_region 11286444..11286811 FT /rpt_family="MaLR" FT repeat_region 11286885..11286925 FT /rpt_family="L2" FT repeat_region 11287110..11287164 FT /rpt_family="MER53" FT repeat_region 11287322..11287491 FT /rpt_family="(TA)n" FT repeat_region 11287575..11287688 FT /rpt_family="(TA)n" FT repeat_region 11287697..11288015 FT /rpt_family="MER2_type" FT repeat_region 11288019..11288134 FT /rpt_family="MER53" FT repeat_region 11288321..11288421 FT /rpt_family="AcHobo" FT repeat_region 11288727..11288948 FT /rpt_family="L2" FT repeat_region 11289499..11289730 FT /rpt_family="MIR" FT repeat_region 11289803..11289965 FT /rpt_family="MIR" FT repeat_region 11290294..11290431 FT /rpt_family="L2" FT repeat_region 11290661..11290734 FT /rpt_family="L2" FT repeat_region 11290777..11290831 FT /rpt_family="MIR" FT repeat_region 11291118..11291376 FT /rpt_family="Alu" FT repeat_region 11291233..11291253 FT /rpt_family="AT_rich" FT repeat_region 11292181..11292226 FT /rpt_family="MIR" FT repeat_region 11292669..11292757 FT /rpt_family="MER1_type" FT repeat_region 11292825..11293184 FT /rpt_family="MaLR" FT repeat_region 11293192..11293339 FT /rpt_family="MER1_type" FT repeat_region 11293698..11293729 FT /rpt_family="(TG)n" FT repeat_region 11293896..11293920 FT /rpt_family="AT_rich" FT repeat_region 11294468..11294761 FT /rpt_family="Alu" FT repeat_region 11294601..11294644 FT /rpt_family="T-rich" FT repeat_region 11294799..11295107 FT /rpt_family="Alu" FT repeat_region 11295081..11295142 FT /rpt_family="(TAAA)n" FT repeat_region 11295341..11295471 FT /rpt_family="Alu" FT repeat_region 11295469..11295501 FT /rpt_family="(TAAA)n" FT repeat_region 11295675..11295876 FT /rpt_family="MIR" FT repeat_region 11295897..11296014 FT /rpt_family="L2" FT repeat_region 11296575..11296605 FT /rpt_family="AT_rich" FT repeat_region 11296582..11296878 FT /rpt_family="Alu" FT repeat_region 11297082..11297169 FT /rpt_family="MIR" FT repeat_region 11297520..11297832 FT /rpt_family="ERV1" FT repeat_region 11298004..11298189 FT /rpt_family="CT-rich" FT repeat_region 11298178..11298485 FT /rpt_family="Alu" FT repeat_region 11298663..11298768 FT /rpt_family="MIR" FT repeat_region 11299039..11299150 FT /rpt_family="MIR" FT misc_feature 11299266..11466263 FT /note="Quality: Phrap Quality >=40 99.5% of Sequence; FT Estimated Total Number of Errors is 0.3.; STS Content:; FT SHGC-51595 G34132; WI-1308 G02734; SHGC-53120 G36506; FT SHGC-13880 G14876" FT repeat_region 11467077..11467167 FT /rpt_family="L2" FT repeat_region 11467168..11467532 FT /rpt_family="MaLR" FT repeat_region 11467327..11467361 FT /rpt_family="(TC)n" FT repeat_region 11467533..11467581 FT /rpt_family="L2" FT repeat_region 11467941..11468144 FT /rpt_family="MER1_type" FT repeat_region 11468289..11468470 FT /rpt_family="MIR" FT repeat_region 11468616..11468652 FT /rpt_family="(TA)n" FT repeat_region 11468712..11468874 FT /rpt_family="(TA)n" FT repeat_region 11469313..11469600 FT /rpt_family="Alu" FT repeat_region 11470046..11470085 FT /rpt_family="(TC)n" FT repeat_region 11470085..11470234 FT /rpt_family="(TA)n" FT repeat_region 11470509..11470672 FT /rpt_family="MIR" FT repeat_region 11470873..11470961 FT /rpt_family="MIR" FT repeat_region 11471489..11471542 FT /rpt_family="(TATATG)n" FT repeat_region 11471543..11471697 FT /rpt_family="L1" FT repeat_region 11471806..11471836 FT /rpt_family="(T)n" FT misc_feature 11472607..11473205 FT /note="match to EST AL041579 (NID:g5420929)" FT repeat_region 11472618..11472640 FT /rpt_family="(TTCA)n" FT repeat_region 11472798..11472934 FT /rpt_family="L2" FT repeat_region 11473012..11473273 FT /rpt_family="Alu" FT repeat_region 11473252..11473287 FT /rpt_family="AT_rich" FT repeat_region 11473447..11473646 FT /rpt_family="MIR" FT repeat_region 11473712..11473788 FT /rpt_family="L1" FT repeat_region 11473886..11474643 FT /rpt_family="L1" FT repeat_region 11474965..11475087 FT /rpt_family="MIR" FT repeat_region 11475354..11475384 FT /rpt_family="AT_rich" FT repeat_region 11475461..11475662 FT /rpt_family="MIR" FT repeat_region 11475820..11476156 FT /rpt_family="MaLR" FT repeat_region 11477334..11477379 FT /rpt_family="AT_rich" FT repeat_region 11477381..11477722 FT /rpt_family="MaLR" FT repeat_region 11478379..11479733 FT /rpt_family="L1" FT repeat_region 11479754..11479787 FT /rpt_family="T-rich" FT repeat_region 11479854..11479911 FT /rpt_family="(TA)n" FT repeat_region 11480115..11480430 FT /rpt_family="L2" FT repeat_region 11480858..11480951 FT /rpt_family="MIR" FT repeat_region 11480960..11481211 FT /rpt_family="L2" FT repeat_region 11481212..11481589 FT /rpt_family="MaLR" FT repeat_region 11481590..11482486 FT /rpt_family="L2" FT repeat_region 11482491..11482702 FT /rpt_family="ERVL" FT repeat_region 11482989..11483077 FT /rpt_family="MIR" FT repeat_region 11483756..11484013 FT /rpt_family="MER1_type" FT repeat_region 11485088..11485205 FT /rpt_family="MIR" FT repeat_region 11486929..11486950 FT /rpt_family="AT_rich" FT repeat_region 11487130..11487564 FT /rpt_family="MaLR" FT repeat_region 11487569..11487696 FT /rpt_family="MaLR" FT repeat_region 11487928..11488164 FT /rpt_family="MIR" FT repeat_region 11488216..11488241 FT /rpt_family="AT_rich" FT repeat_region 11488841..11489030 FT /rpt_family="MIR" FT repeat_region 11489167..11489353 FT /rpt_family="MIR" FT repeat_region 11490436..11490512 FT /rpt_family="L2" FT repeat_region 11490730..11491324 FT /rpt_family="ERVL" FT misc_feature 11491755..11491966 FT /note="similar to Homo sapiens EST BF738965 FT (NID:g12065641)" FT repeat_region 11492145..11492195 FT /rpt_family="CT-rich" FT repeat_region 11492166..11492514 FT /rpt_family="Alu" FT repeat_region 11492347..11492387 FT /rpt_family="(TG)n" FT repeat_region 11492678..11492973 FT /rpt_family="L1" FT repeat_region 11492974..11492994 FT /rpt_family="(T)n" FT repeat_region 11493276..11493349 FT /rpt_family="L1" FT repeat_region 11493394..11494125 FT /rpt_family="L1" FT repeat_region 11494129..11494456 FT /rpt_family="L1" FT repeat_region 11494663..11494927 FT /rpt_family="Alu" FT repeat_region 11494784..11494815 FT /rpt_family="AT_rich" FT repeat_region 11495118..11495358 FT /rpt_family="MIR" FT repeat_region 11495359..11495489 FT /rpt_family="MIR" FT repeat_region 11496409..11496524 FT /rpt_family="L2" FT repeat_region 11496874..11497040 FT /rpt_family="L2" FT repeat_region 11497061..11497267 FT /rpt_family="MER1_type" FT repeat_region 11497366..11497480 FT /rpt_family="L2" FT repeat_region 11499110..11499587 FT /rpt_family="MaLR" FT repeat_region 11499743..11499842 FT /rpt_family="L2" FT repeat_region 11499855..11500159 FT /rpt_family="ERVL" FT repeat_region 11500430..11500480 FT /rpt_family="(TAGA)n" FT repeat_region 11503188..11503615 FT /rpt_family="L2" FT repeat_region 11503611..11503859 FT /rpt_family="L2" FT repeat_region 11503861..11504190 FT /rpt_family="MaLR" FT repeat_region 11504516..11504664 FT /rpt_family="L2" FT repeat_region 11505196..11505299 FT /rpt_family="L2" FT repeat_region 11505305..11505392 FT /rpt_family="MaLR" FT repeat_region 11505397..11505641 FT /rpt_family="L1" FT repeat_region 11505618..11505684 FT /rpt_family="(TAAAA)n" FT repeat_region 11505694..11506008 FT /rpt_family="Alu" FT repeat_region 11505975..11506018 FT /rpt_family="polypurine" FT repeat_region 11506014..11506406 FT /rpt_family="MaLR" FT repeat_region 11506544..11506762 FT /rpt_family="MIR" FT repeat_region 11506844..11506898 FT /rpt_family="MIR" FT repeat_region 11507571..11507724 FT /rpt_family="MIR" FT repeat_region 11508189..11508566 FT /rpt_family="L2" FT repeat_region 11508929..11508981 FT /rpt_family="(TTA)n" FT repeat_region 11509265..11509679 FT /rpt_family="MaLR" FT repeat_region 11509766..11509807 FT /rpt_family="MIR" FT repeat_region 11509859..11509879 FT /rpt_family="AT_rich" FT repeat_region 11510249..11510368 FT /rpt_family="L2" FT repeat_region 11510877..11512080 FT /rpt_family="L2" FT repeat_region 11512707..11512921 FT /rpt_family="MIR" FT repeat_region 11512949..11513052 FT /rpt_family="MER1_type" FT repeat_region 11513320..11513445 FT /rpt_family="L2" FT repeat_region 11513577..11513819 FT /rpt_family="MIR" FT repeat_region 11513840..11514436 FT /rpt_family="ERVL" FT repeat_region 11514647..11514942 FT /rpt_family="MaLR" FT repeat_region 11515064..11515255 FT /rpt_family="L2" FT repeat_region 11515551..11515671 FT /rpt_family="MIR" FT repeat_region 11516692..11516829 FT /rpt_family="MIR" FT repeat_region 11517623..11517776 FT /rpt_family="MaLR" FT repeat_region 11517777..11517929 FT /rpt_family="MER1_type" FT repeat_region 11517930..11518240 FT /rpt_family="Alu" FT repeat_region 11518213..11518275 FT /rpt_family="A-rich" FT repeat_region 11518241..11518354 FT /rpt_family="MER1_type" FT repeat_region 11518355..11518494 FT /rpt_family="MaLR" FT repeat_region 11518486..11518524 FT /rpt_family="(TTTTTG)n" FT repeat_region 11518495..11518802 FT /rpt_family="Alu" FT repeat_region 11518803..11518972 FT /rpt_family="MaLR" FT repeat_region 11519034..11519405 FT /rpt_family="MaLR" FT repeat_region 11519415..11519799 FT /rpt_family="MaLR" FT repeat_region 11519973..11520165 FT /rpt_family="L1" FT repeat_region 11520157..11520181 FT /rpt_family="AT_rich" FT repeat_region 11520295..11520532 FT /rpt_family="MIR" FT repeat_region 11520607..11520835 FT /rpt_family="L2" FT repeat_region 11520926..11521267 FT /rpt_family="L1" FT repeat_region 11521376..11521518 FT /rpt_family="L2" FT repeat_region 11521868..11522027 FT /rpt_family="MIR" FT repeat_region 11522249..11522404 FT /rpt_family="AcHobo" FT repeat_region 11522637..11522774 FT /rpt_family="L2" FT repeat_region 11522842..11522919 FT /rpt_family="Alu" FT repeat_region 11523302..11523394 FT /rpt_family="MaLR" FT repeat_region 11523761..11523795 FT /rpt_family="(CA)n" FT repeat_region 11524461..11524577 FT /rpt_family="MIR" FT repeat_region 11524969..11525008 FT /rpt_family="(TAA)n" FT repeat_region 11525050..11525262 FT /rpt_family="MIR" FT repeat_region 11525595..11525776 FT /rpt_family="L1" FT repeat_region 11525786..11526004 FT /rpt_family="L1" FT repeat_region 11526001..11526609 FT /rpt_family="L1" FT repeat_region 11526632..11526701 FT /rpt_family="T-rich" FT repeat_region 11526798..11526909 FT /rpt_family="MIR" FT repeat_region 11527928..11528711 FT /rpt_family="L2" FT repeat_region 11529406..11529643 FT /rpt_family="L1" FT misc_feature 11529920..11530582 FT /note="match to EST BG429566 (NID:g13336072)" FT repeat_region 11529926..11530213 FT /rpt_family="L1" FT repeat_region 11530114..11530143 FT /rpt_family="AT_rich" FT repeat_region 11530466..11530649 FT /rpt_family="MIR" FT repeat_region 11531626..11531927 FT /rpt_family="Alu" FT repeat_region 11532101..11532605 FT /rpt_family="MaLR" FT repeat_region 11532663..11532687 FT /rpt_family="(T)n" FT repeat_region 11533011..11533319 FT /rpt_family="Alu" FT repeat_region 11533292..11533325 FT /rpt_family="(CAAAA)n" FT repeat_region 11533383..11533590 FT /rpt_family="MIR" FT repeat_region 11533719..11533842 FT /rpt_family="MIR" FT repeat_region 11534109..11534129 FT /rpt_family="AT_rich" FT repeat_region 11534130..11534155 FT /rpt_family="(TTG)n" FT repeat_region 11534154..11534462 FT /rpt_family="Alu" FT repeat_region 11534158..11534180 FT /rpt_family="(TTTTG)n" FT repeat_region 11535088..11535132 FT /rpt_family="(TTG)n" FT repeat_region 11535193..11535296 FT /rpt_family="MIR" FT repeat_region 11535539..11535603 FT /rpt_family="L1" FT repeat_region 11535604..11535623 FT /rpt_family="(T)n" FT repeat_region 11535908..11536413 FT /rpt_family="L1" FT repeat_region 11536414..11536892 FT /rpt_family="MaLR" FT repeat_region 11536893..11537412 FT /rpt_family="L1" FT repeat_region 11537636..11537713 FT /rpt_family="Mariner" FT repeat_region 11538264..11538539 FT /rpt_family="L1" FT repeat_region 11538525..11538553 FT /rpt_family="AT_rich" FT repeat_region 11538878..11538928 FT /rpt_family="(CA)n" FT repeat_region 11539518..11539730 FT /rpt_family="MIR" FT repeat_region 11540405..11540482 FT /rpt_family="MIR" FT repeat_region 11540574..11540629 FT /rpt_family="(CA)n" FT repeat_region 11540970..11541197 FT /rpt_family="MIR" FT repeat_region 11541341..11541666 FT /rpt_family="Alu" FT repeat_region 11541637..11541672 FT /rpt_family="(CAAAAA)n" FT repeat_region 11542260..11542482 FT /rpt_family="MER1_type" FT repeat_region 11542610..11542915 FT /rpt_family="Alu" FT repeat_region 11543410..11543431 FT /rpt_family="AT_rich" FT misc_feature complement(11543678..11735581) FT /note="Quality: Phrap Quality >=40 99.6% of Sequence; FT Estimated Total Number of Errors is 0.1.; STS Content:; FT SHGC-51370 G34033; SHGC-51082 G34197" FT repeat_region 12069625..12069670 FT /rpt_family="GA-rich" FT repeat_region 12070107..12070196 FT /rpt_family="Alu" FT repeat_region 12070270..12070572 FT /rpt_family="L2" FT repeat_region 12071288..12071416 FT /rpt_family="MaLR" FT repeat_region 12073423..12073536 FT /rpt_family="L2" FT repeat_region 12073646..12073770 FT /rpt_family="MIR" FT repeat_region 12073799..12073869 FT /rpt_family="Alu" FT repeat_region 12073914..12074043 FT /rpt_family="MIR" FT repeat_region 12074236..12074346 FT /rpt_family="L2" FT repeat_region 12074385..12074439 FT /rpt_family="AT_rich" FT repeat_region 12075334..12075665 FT /rpt_family="L1" FT repeat_region 12075478..12075508 FT /rpt_family="AT_rich" FT repeat_region 12076239..12076357 FT /rpt_family="ERVL" FT repeat_region 12076506..12076695 FT /rpt_family="Alu" FT repeat_region 12077210..12077290 FT /rpt_family="L2" FT repeat_region 12077763..12077803 FT /rpt_family="(TG)n" FT repeat_region 12077968..12078184 FT /rpt_family="MIR" FT repeat_region 12081311..12081439 FT /rpt_family="CR1" FT repeat_region 12081548..12081568 FT /rpt_family="AT_rich" FT repeat_region 12081555..12081619 FT /rpt_family="ERV1" FT repeat_region 12081569..12081613 FT /rpt_family="(CA)n" FT repeat_region 12081620..12081903 FT /rpt_family="Alu" FT repeat_region 12084245..12084520 FT /rpt_family="Alu" FT repeat_region 12084521..12084874 FT /rpt_family="MaLR" FT repeat_region 12084875..12084896 FT /rpt_family="Alu" FT repeat_region 12084904..12085115 FT /rpt_family="MIR" FT repeat_region 12085211..12085401 FT /rpt_family="MIR" FT repeat_region 12085528..12085675 FT /rpt_family="Alu" FT repeat_region 12086235..12086599 FT /rpt_family="L1" FT repeat_region 12086971..12086993 FT /rpt_family="(TTG)n" FT repeat_region 12086992..12087273 FT /rpt_family="Alu" FT repeat_region 12087278..12087298 FT /rpt_family="AT_rich" FT repeat_region 12087297..12087396 FT /rpt_family="MIR" FT repeat_region 12087717..12087809 FT /rpt_family="MIR" FT repeat_region 12088034..12088143 FT /rpt_family="L2" FT repeat_region 12089680..12089725 FT /rpt_family="(TAA)n" FT repeat_region 12089719..12089925 FT /rpt_family="MIR" FT repeat_region 12090417..12090511 FT /rpt_family="ERV1" FT repeat_region 12090554..12090674 FT /rpt_family="MIR" FT repeat_region 12091376..12091506 FT /rpt_family="MER1_type" FT repeat_region 12098526..12098752 FT /rpt_family="ERV1" FT repeat_region 12098734..12099222 FT /rpt_family="ERV1" FT repeat_region 12099448..12099593 FT /rpt_family="MIR" FT repeat_region 12100613..12100752 FT /rpt_family="MER1_type" FT repeat_region 12100782..12100917 FT /rpt_family="MER1_type" FT repeat_region 12102787..12102908 FT /rpt_family="MER1_type" FT repeat_region 12103085..12103999 FT /rpt_family="L1" FT repeat_region 12104046..12104203 FT /rpt_family="MIR" FT repeat_region 12104325..12104713 FT /rpt_family="L2" FT repeat_region 12104714..12104785 FT /rpt_family="ERVL" FT repeat_region 12105098..12105238 FT /rpt_family="L2" FT repeat_region 12105443..12105573 FT /rpt_family="MIR" FT repeat_region 12105636..12105722 FT /rpt_family="L2" FT repeat_region 12106080..12106110 FT /rpt_family="(TG)n" FT repeat_region 12106113..12106368 FT /rpt_family="MIR" FT repeat_region 12106754..12106908 FT /rpt_family="MIR" FT repeat_region 12107421..12107477 FT /rpt_family="(TG)n" FT repeat_region 12107813..12107847 FT /rpt_family="T-rich" FT repeat_region 12107818..12107995 FT /rpt_family="Alu" FT repeat_region 12108088..12108681 FT /rpt_family="L1" FT repeat_region 12108682..12109005 FT /rpt_family="MaLR" FT repeat_region 12109097..12109338 FT /rpt_family="L1" FT repeat_region 12109549..12110294 FT /rpt_family="(CATAT)n" FT repeat_region 12110335..12110524 FT /rpt_family="(TA)n" FT repeat_region 12110542..12110736 FT /rpt_family="(TA)n" FT repeat_region 12110743..12110898 FT /rpt_family="(CATAT)n" FT repeat_region 12110911..12111299 FT /rpt_family="(TA)n" FT repeat_region 12111316..12111454 FT /rpt_family="L1" FT repeat_region 12111352..12111371 FT /rpt_family="(ATTG)n" FT repeat_region 12111529..12111589 FT /rpt_family="(TA)n" FT repeat_region 12112245..12112606 FT /rpt_family="MaLR" FT repeat_region 12113378..12113414 FT /rpt_family="(TG)n" FT repeat_region 12116745..12116800 FT /rpt_family="L1" FT repeat_region 12116801..12116937 FT /rpt_family="L1" FT repeat_region 12116953..12117268 FT /rpt_family="Alu" FT repeat_region 12117241..12117268 FT /rpt_family="(A)n" FT repeat_region 12117315..12117513 FT /rpt_family="MaLR" FT repeat_region 12117514..12118536 FT /rpt_family="L1" FT repeat_region 12118747..12119146 FT /rpt_family="MaLR" FT repeat_region 12119152..12119352 FT /rpt_family="MaLR" FT repeat_region 12119366..12119676 FT /rpt_family="MaLR" FT repeat_region 12119672..12119836 FT /rpt_family="MaLR" FT repeat_region 12119860..12119981 FT /rpt_family="MaLR" FT repeat_region 12119987..12120430 FT /rpt_family="MaLR" FT repeat_region 12120957..12120980 FT /rpt_family="AT_rich" FT repeat_region 12121184..12121495 FT /rpt_family="L2" FT repeat_region 12121341..12121362 FT /rpt_family="(TTTTG)n" FT repeat_region 12121687..12122306 FT /rpt_family="ERV1" FT repeat_region 12122460..12122569 FT /rpt_family="MaLR" FT repeat_region 12122579..12122679 FT /rpt_family="ERVL" FT repeat_region 12123421..12123571 FT /rpt_family="MIR" FT repeat_region 12123621..12123755 FT /rpt_family="(CATATA)n" FT repeat_region 12124037..12124548 FT /rpt_family="ERVL" FT repeat_region 12124664..12124796 FT /rpt_family="MIR" FT repeat_region 12125060..12125238 FT /rpt_family="MER1_type" FT repeat_region 12125314..12125609 FT /rpt_family="ERVL" FT repeat_region 12125876..12125967 FT /rpt_family="MIR" FT repeat_region 12126328..12126737 FT /rpt_family="MaLR" FT repeat_region 12127726..12127853 FT /rpt_family="MIR" FT repeat_region 12128084..12128448 FT /rpt_family="MaLR" FT repeat_region 12128503..12128594 FT /rpt_family="(TA)n" FT repeat_region 12129447..12129538 FT /rpt_family="CT-rich" FT repeat_region 12129513..12129820 FT /rpt_family="Alu" FT repeat_region 12129821..12129940 FT /rpt_family="Alu" FT repeat_region 12130349..12130376 FT /rpt_family="AT_rich" FT repeat_region 12130365..12130535 FT /rpt_family="MIR" FT repeat_region 12130542..12130954 FT /rpt_family="MaLR" FT repeat_region 12131488..12136647 FT /rpt_family="L1" FT repeat_region 12132558..12132580 FT /rpt_family="AT_rich" FT repeat_region 12133594..12133615 FT /rpt_family="AT_rich" FT repeat_region 12134494..12134531 FT /rpt_family="AT_rich" FT repeat_region 12136648..12136791 FT /rpt_family="Alu" FT repeat_region 12136794..12137099 FT /rpt_family="L1" FT repeat_region 12137146..12138215 FT /rpt_family="L1" FT repeat_region 12137183..12137212 FT /rpt_family="(A)n" FT repeat_region 12137374..12137397 FT /rpt_family="AT_rich" FT repeat_region 12138378..12138504 FT /rpt_family="L2" FT repeat_region 12138524..12138599 FT /rpt_family="Mariner" FT repeat_region 12139421..12139514 FT /rpt_family="MIR" FT repeat_region 12139653..12139677 FT /rpt_family="(TGAA)n" FT repeat_region 12139846..12140142 FT /rpt_family="MaLR" FT repeat_region 12140331..12140381 FT /rpt_family="MIR" FT repeat_region 12140637..12140854 FT /rpt_family="L2" FT repeat_region 12141521..12142060 FT /rpt_family="L1" FT repeat_region 12142402..12142541 FT /rpt_family="MER103" FT repeat_region 12143571..12143591 FT /rpt_family="AT_rich" FT repeat_region 12143996..12144271 FT /rpt_family="Alu" FT repeat_region 12144446..12144630 FT /rpt_family="MaLR" FT repeat_region 12144693..12144729 FT /rpt_family="AT_rich" FT repeat_region 12145152..12145446 FT /rpt_family="Alu" FT repeat_region 12145416..12145445 FT /rpt_family="(CAAAA)n" FT repeat_region 12147660..12147702 FT /rpt_family="AT_rich" FT repeat_region 12148459..12148497 FT /rpt_family="AT_rich" FT repeat_region 12148737..12149037 FT /rpt_family="MER1_type" FT repeat_region 12149150..12149342 FT /rpt_family="MIR" FT repeat_region 12149467..12149885 FT /rpt_family="MaLR" FT repeat_region 12150528..12150640 FT /rpt_family="MIR" FT repeat_region 12151112..12151162 FT /rpt_family="(TA)n" FT repeat_region 12151117..12151195 FT /rpt_family="L1" FT repeat_region 12151284..12151566 FT /rpt_family="L1" FT repeat_region 12151979..12152031 FT /rpt_family="(TG)n" FT repeat_region 12154332..12154358 FT /rpt_family="(T)n" FT repeat_region 12154858..12154925 FT /rpt_family="L1" FT repeat_region 12154942..12155067 FT /rpt_family="MaLR" FT repeat_region 12155080..12156263 FT /rpt_family="L1" FT repeat_region 12156264..12156630 FT /rpt_family="MaLR" FT repeat_region 12156632..12156791 FT /rpt_family="MaLR" FT repeat_region 12161723..12161873 FT /rpt_family="MaLR" FT repeat_region 12163688..12164662 FT /rpt_family="L1" FT repeat_region 12165018..12165140 FT /rpt_family="MIR" FT repeat_region 12165893..12166018 FT /rpt_family="L2" FT repeat_region 12166388..12166416 FT /rpt_family="L2" FT repeat_region 12166417..12166847 FT /rpt_family="MaLR" FT repeat_region 12166848..12166957 FT /rpt_family="L2" FT repeat_region 12166992..12167533 FT /rpt_family="ERVL" FT repeat_region 12167549..12167791 FT /rpt_family="L1" FT repeat_region 12167718..12167739 FT /rpt_family="AT_rich" FT repeat_region 12167792..12168260 FT /rpt_family="MER2_type" FT repeat_region 12168261..12168490 FT /rpt_family="L1" FT repeat_region 12168509..12168802 FT /rpt_family="Alu" FT repeat_region 12169606..12169645 FT /rpt_family="AT_rich" FT repeat_region 12170258..12170571 FT /rpt_family="Alu" FT repeat_region 12170547..12170568 FT /rpt_family="AT_rich" FT repeat_region 12170890..12170916 FT /rpt_family="(TG)n" FT repeat_region 12171356..12171393 FT /rpt_family="AT_rich" FT repeat_region 12171951..12171999 FT /rpt_family="(CATA)n" FT repeat_region 12172778..12172895 FT /rpt_family="MIR" FT repeat_region 12172904..12173139 FT /rpt_family="L2" FT repeat_region 12173241..12173360 FT /rpt_family="MIR" FT repeat_region 12174473..12174495 FT /rpt_family="AT_rich" FT repeat_region 12174719..12174949 FT /rpt_family="MIR" FT repeat_region 12175666..12175787 FT /rpt_family="MIR" FT repeat_region 12176431..12177101 FT /rpt_family="L2" FT repeat_region 12177469..12177534 FT /rpt_family="L2" FT repeat_region 12177649..12177948 FT /rpt_family="Alu" FT repeat_region 12178405..12178943 FT /rpt_family="ERV1" FT repeat_region 12179144..12179506 FT /rpt_family="MaLR" FT repeat_region 12179636..12179958 FT /rpt_family="MaLR" FT repeat_region 12180055..12180645 FT /rpt_family="L2" FT repeat_region 12180857..12180898 FT /rpt_family="(A)n" FT repeat_region 12181598..12181768 FT /rpt_family="MIR" FT repeat_region 12181805..12181941 FT /rpt_family="MIR" FT repeat_region 12181972..12182067 FT /rpt_family="MIR" FT repeat_region 12182140..12182527 FT /rpt_family="AcHobo" FT repeat_region 12182240..12182262 FT /rpt_family="AT_rich" FT repeat_region 12182504..12182535 FT /rpt_family="AT_rich" FT repeat_region 12182546..12183103 FT /rpt_family="AcHobo" FT repeat_region 12182726..12182810 FT /rpt_family="AT_rich" FT repeat_region 12183118..12183556 FT /rpt_family="ERVL" FT repeat_region 12183568..12183649 FT /rpt_family="(TA)n" FT repeat_region 12183633..12183681 FT /rpt_family="ERVL" FT repeat_region 12183844..12183994 FT /rpt_family="AcHobo" FT repeat_region 12184060..12184240 FT /rpt_family="MER1_type" FT repeat_region 12184083..12184121 FT /rpt_family="(TA)n" FT repeat_region 12184995..12185289 FT /rpt_family="Alu" FT repeat_region 12185258..12185368 FT /rpt_family="A-rich" FT repeat_region 12185370..12185404 FT /rpt_family="(GGAA)n" FT repeat_region 12185407..12185695 FT /rpt_family="Alu" FT repeat_region 12185516..12185537 FT /rpt_family="AT_rich" FT repeat_region 12186283..12186360 FT /rpt_family="(TG)n" FT repeat_region 12186775..12186878 FT /rpt_family="L2" FT repeat_region 12186945..12187156 FT /rpt_family="MIR" FT repeat_region 12188283..12188672 FT /rpt_family="ERV1" FT repeat_region 12189081..12189108 FT /rpt_family="(A)n" FT repeat_region 12189284..12189531 FT /rpt_family="L1" FT repeat_region 12189935..12190775 FT /rpt_family="L1" FT repeat_region 12191508..12191663 FT /rpt_family="ERVL" FT repeat_region 12191664..12192164 FT /rpt_family="ERV1" FT repeat_region 12192165..12192404 FT /rpt_family="ERVL" FT repeat_region 12193023..12193046 FT /rpt_family="AT_rich" FT repeat_region 12193280..12193633 FT /rpt_family="MaLR" FT repeat_region 12193953..12193989 FT /rpt_family="AT_rich" FT repeat_region 12193993..12194270 FT /rpt_family="L1" FT repeat_region 12194343..12194369 FT /rpt_family="AT_rich" FT repeat_region 12194861..12194937 FT /rpt_family="AT_rich" FT repeat_region 12195036..12195081 FT /rpt_family="AT_rich" FT repeat_region 12195464..12195698 FT /rpt_family="L1" FT repeat_region 12195690..12195711 FT /rpt_family="AT_rich" FT repeat_region 12195718..12195789 FT /rpt_family="ERVL" FT repeat_region 12195792..12196215 FT /rpt_family="MaLR" FT repeat_region 12196216..12197147 FT /rpt_family="MaLR" FT repeat_region 12197148..12197329 FT /rpt_family="L1" FT repeat_region 12197318..12197342 FT /rpt_family="AT_rich" FT repeat_region 12197330..12198005 FT /rpt_family="MaLR" FT repeat_region 12198006..12198436 FT /rpt_family="MaLR" FT repeat_region 12198537..12198900 FT /rpt_family="MaLR" FT repeat_region 12199280..12199329 FT /rpt_family="AT_rich" FT repeat_region 12199516..12199536 FT /rpt_family="AT_rich" FT repeat_region 12199791..12200210 FT /rpt_family="MaLR" FT repeat_region 12200211..12200356 FT /rpt_family="MaLR" FT repeat_region 12200378..12200457 FT /rpt_family="GA-rich" FT repeat_region 12200475..12200647 FT /rpt_family="MaLR" FT repeat_region 12200650..12201079 FT /rpt_family="ERVL" FT repeat_region 12201546..12201822 FT /rpt_family="CR1" FT repeat_region 12203141..12203413 FT /rpt_family="Alu" FT repeat_region 12203394..12203414 FT /rpt_family="(A)n" FT repeat_region 12203562..12203587 FT /rpt_family="(TTTTG)n" FT repeat_region 12203569..12203862 FT /rpt_family="Alu" FT repeat_region 12204258..12204463 FT /rpt_family="MIR" FT repeat_region 12206046..12206650 FT /rpt_family="MaLR" FT repeat_region 12206692..12206775 FT /rpt_family="MIR" FT repeat_region 12207548..12208152 FT /rpt_family="MaLR" FT repeat_region 12208158..12208247 FT /rpt_family="MIR" FT repeat_region 12208271..12208330 FT /rpt_family="AT_rich" FT repeat_region 12208291..12208882 FT /rpt_family="L1" FT repeat_region 12208974..12209062 FT /rpt_family="MIR" FT repeat_region 12209916..12210106 FT /rpt_family="MaLR" FT repeat_region 12210109..12210282 FT /rpt_family="Alu" FT repeat_region 12210285..12210483 FT /rpt_family="MaLR" FT repeat_region 12210750..12211089 FT /rpt_family="MaLR" FT repeat_region 12212015..12212380 FT /rpt_family="MaLR" FT repeat_region 12212978..12213232 FT /rpt_family="L1" FT repeat_region 12213233..12213599 FT /rpt_family="MaLR" FT repeat_region 12213600..12213931 FT /rpt_family="L1" FT repeat_region 12213940..12213973 FT /rpt_family="(TA)n" FT repeat_region 12214273..12214381 FT /rpt_family="L1" FT repeat_region 12214968..12214990 FT /rpt_family="(TTTA)n" FT repeat_region 12215654..12216120 FT /rpt_family="L1" FT repeat_region 12216125..12216274 FT /rpt_family="L1" FT repeat_region 12216964..12216984 FT /rpt_family="AT_rich" FT repeat_region 12217078..12217369 FT /rpt_family="Alu" FT repeat_region 12217671..12218020 FT /rpt_family="L1" FT repeat_region 12218276..12218354 FT /rpt_family="(CA)n" FT repeat_region 12218593..12218797 FT /rpt_family="ERVL" FT repeat_region 12218788..12218981 FT /rpt_family="MaLR" FT repeat_region 12218989..12219037 FT /rpt_family="(CA)n" FT repeat_region 12219036..12219229 FT /rpt_family="MaLR" FT repeat_region 12220167..12220207 FT /rpt_family="MIR" FT repeat_region 12220342..12220638 FT /rpt_family="L1" FT repeat_region 12220865..12221043 FT /rpt_family="(TA)n" FT repeat_region 12221389..12221443 FT /rpt_family="MIR" FT repeat_region 12222688..12222817 FT /rpt_family="MIR" FT repeat_region 12223104..12223293 FT /rpt_family="L2" FT repeat_region 12223728..12223828 FT /rpt_family="L2" FT repeat_region 12224127..12224248 FT /rpt_family="MIR" FT repeat_region 12224848..12225238 FT /rpt_family="ERVL" FT misc_feature 12225099..12225252 FT /note="match to EST BG723674 (NID:g14002861)" FT repeat_region 12225303..12226424 FT /rpt_family="L1" FT repeat_region 12226425..12226583 FT /rpt_family="MIR" FT repeat_region 12227894..12227920 FT /rpt_family="(CA)n" FT repeat_region 12228304..12228419 FT /rpt_family="L2" FT repeat_region 12228771..12228924 FT /rpt_family="MIR" FT repeat_region 12229121..12229497 FT /rpt_family="MaLR" FT repeat_region 12229514..12229621 FT /rpt_family="(TA)n" FT repeat_region 12229732..12229782 FT /rpt_family="A-rich" FT repeat_region 12229796..12229933 FT /rpt_family="L1" FT repeat_region 12230059..12230619 FT /rpt_family="ERV1" FT repeat_region 12231066..12231412 FT /rpt_family="MaLR" FT repeat_region 12231585..12231706 FT /rpt_family="L2" FT repeat_region 12231727..12231797 FT /rpt_family="CR1" FT repeat_region 12232151..12232347 FT /rpt_family="CR1" FT repeat_region 12232449..12232481 FT /rpt_family="(T)n" FT repeat_region 12232451..12232762 FT /rpt_family="Alu" FT repeat_region 12233344..12233474 FT /rpt_family="MIR" FT repeat_region 12234062..12234087 FT /rpt_family="AT_rich" FT repeat_region 12235035..12235520 FT /rpt_family="L1" FT repeat_region 12235521..12235880 FT /rpt_family="MaLR" FT repeat_region 12235881..12237359 FT /rpt_family="L1" FT repeat_region 12237391..12237473 FT /rpt_family="L1" FT repeat_region 12237444..12237465 FT /rpt_family="AT_rich" FT repeat_region 12237678..12237908 FT /rpt_family="AcHobo" FT repeat_region 12238290..12238744 FT /rpt_family="MaLR" FT repeat_region 12238848..12239502 FT /rpt_family="MaLR" FT repeat_region 12239078..12239100 FT /rpt_family="(TC)n" FT repeat_region 12239100..12239139 FT /rpt_family="(CA)n" FT repeat_region 12239503..12239617 FT /rpt_family="Alu" FT repeat_region 12239617..12239726 FT /rpt_family="(TA)n" FT repeat_region 12239745..12239867 FT /rpt_family="Alu" FT repeat_region 12239879..12239930 FT /rpt_family="Alu" FT repeat_region 12239924..12239994 FT /rpt_family="AT_rich" FT repeat_region 12239991..12240751 FT /rpt_family="MaLR" FT repeat_region 12240771..12241345 FT /rpt_family="MaLR" FT repeat_region 12241990..12242130 FT /rpt_family="MIR" FT repeat_region 12242821..12242921 FT /rpt_family="MIR" FT repeat_region 12242934..12243312 FT /rpt_family="MaLR" FT repeat_region 12244209..12244307 FT /rpt_family="MIR" FT repeat_region 12244347..12244395 FT /rpt_family="(CAAA)n" FT misc_feature 12244676..12244802 FT /note="match to EST BG723674 (NID:g14002861)" FT repeat_region 12244844..12244994 FT /rpt_family="Alu" FT repeat_region 12244973..12244994 FT /rpt_family="(A)n" FT repeat_region 12245562..12246153 FT /rpt_family="L2" FT repeat_region 12246154..12246461 FT /rpt_family="Alu" FT repeat_region 12246434..12246461 FT /rpt_family="(A)n" FT repeat_region 12246462..12246755 FT /rpt_family="L2" FT repeat_region 12246878..12247007 FT /rpt_family="L2" FT repeat_region 12247391..12247853 FT /rpt_family="ERVL" FT repeat_region 12247848..12247881 FT /rpt_family="(TCCC)n" FT repeat_region 12247911..12248021 FT /rpt_family="(TCTA)n" FT repeat_region 12248004..12248059 FT /rpt_family="ERVL" FT misc_feature 12248559..12248594 FT /note="match to EST BG723674 (NID:g14002861)" FT repeat_region 12248589..12248696 FT /rpt_family="MIR" FT repeat_region 12248817..12248899 FT /rpt_family="L2" FT repeat_region 12249052..12249089 FT /rpt_family="(TG)n" FT repeat_region 12249310..12249478 FT /rpt_family="MER1_type" FT repeat_region 12249503..12249602 FT /rpt_family="MIR" FT repeat_region 12250522..12250572 FT /rpt_family="(TTTTTG)n" FT repeat_region 12250557..12250851 FT /rpt_family="Alu" FT misc_feature 12296260..12296501 FT /note="CpG_island (%GC=59.9, o/e=0.86, #CpGs=18)" FT repeat_region 12498950..12498991 FT /rpt_family="(TG)n" FT repeat_region 12499422..12499672 FT /rpt_family="MER2_type" FT repeat_region 12499671..12499807 FT /rpt_family="MER2_type" FT repeat_region 12500964..12501010 FT /rpt_family="AT_rich" FT repeat_region 12501015..12501232 FT /rpt_family="MIR" FT repeat_region 12501259..12501740 FT /rpt_family="ERVL" FT repeat_region 12502331..12502358 FT /rpt_family="AT_rich" FT repeat_region 12502934..12503052 FT /rpt_family="GA-rich" FT repeat_region 12503671..12504041 FT /rpt_family="MaLR" FT repeat_region 12504042..12505592 FT /rpt_family="MaLR" FT repeat_region 12505593..12505978 FT /rpt_family="MaLR" FT repeat_region 12506024..12506266 FT /rpt_family="MIR" FT repeat_region 12506765..12506953 FT /rpt_family="MaLR" FT repeat_region 12506954..12507238 FT /rpt_family="Alu" FT repeat_region 12507239..12507432 FT /rpt_family="MaLR" FT repeat_region 12507530..12507594 FT /rpt_family="MIR" FT repeat_region 12507682..12507812 FT /rpt_family="MIR" FT repeat_region 12509072..12509559 FT /rpt_family="L1" FT repeat_region 12509654..12509690 FT /rpt_family="(A)n" FT repeat_region 12510302..12510451 FT /rpt_family="L1" FT repeat_region 12510433..12510470 FT /rpt_family="AT_rich" FT repeat_region 12512759..12512856 FT /rpt_family="L1" FT repeat_region 12512885..12514450 FT /rpt_family="L1" FT repeat_region 12513792..12513812 FT /rpt_family="AT_rich" FT repeat_region 12515160..12515526 FT /rpt_family="MaLR" FT repeat_region 12515530..12517124 FT /rpt_family="MaLR" FT repeat_region 12517125..12517490 FT /rpt_family="MaLR" FT repeat_region 12517309..12517334 FT /rpt_family="(TC)n" FT repeat_region 12518159..12518200 FT /rpt_family="(TA)n" FT repeat_region 12518375..12518444 FT /rpt_family="MIR" FT repeat_region 12519308..12519436 FT /rpt_family="L2" FT repeat_region 12520083..12520288 FT /rpt_family="L1" FT repeat_region 12522060..12522244 FT /rpt_family="L1" FT repeat_region 12522545..12522593 FT /rpt_family="Alu" FT repeat_region 12522621..12522967 FT /rpt_family="MaLR" FT repeat_region 12522968..12523101 FT /rpt_family="L2" FT repeat_region 12523995..12524132 FT /rpt_family="MIR" FT misc_feature 12524281..12524286 FT /note="match to EST AI381886 (NID:g4194667) te72b04.x1" FT repeat_region 12524734..12525318 FT /rpt_family="ERVL" FT repeat_region 12525320..12525397 FT /rpt_family="L1" FT repeat_region 12525401..12526540 FT /rpt_family="L1" FT repeat_region 12531056..12531583 FT /rpt_family="L1" FT repeat_region 12531637..12532278 FT /rpt_family="L1" FT repeat_region 12531923..12531964 FT /rpt_family="AT_rich" FT repeat_region 12532892..12532975 FT /rpt_family="MIR" FT repeat_region 12534716..12535005 FT /rpt_family="Alu" FT repeat_region 12535095..12535182 FT /rpt_family="L1" FT misc_feature 12535705..12535710 FT /note="similar to Homo sapiens EST AI566038 (NID:g4524490) FT tn52f03.x1" FT repeat_region 12535911..12536397 FT /rpt_family="L1" FT repeat_region 12536403..12537312 FT /rpt_family="L1" FT repeat_region 12537314..12537612 FT /rpt_family="Alu" FT repeat_region 12537735..12538831 FT /rpt_family="L1" FT repeat_region 12538009..12538060 FT /rpt_family="T-rich" FT misc_feature 12538930..12539241 FT /note="similar to Homo sapiens EST BG386770 FT (NID:g13280216)" FT misc_feature 12538930..12539160 FT /note="similar to Homo sapiens EST BE394355 (NID:g9339720)" FT /note="similar to Homo sapiens EST BG764620 FT (NID:g14075273)" FT /note="similar to Homo sapiens EST BF892674 FT (NID:g12284133)" FT misc_feature 12538930..12539238 FT /note="similar to Homo sapiens EST BI092759 FT (NID:g14511089)" FT misc_feature 12538930..12539141 FT /note="similar to Homo sapiens EST AA158688 (NID:g1733499) FT zo78d11.r1" FT misc_feature 12538935..12539241 FT /note="similar to Homo sapiens EST AI566038 (NID:g4524490) FT tn52f03.x1" FT repeat_region 12540146..12540169 FT /rpt_family="AT_rich" FT repeat_region 12540167..12541536 FT /rpt_family="L1" FT repeat_region 12540435..12540466 FT /rpt_family="AT_rich" FT repeat_region 12540569..12540593 FT /rpt_family="(TTTTTG)n" FT repeat_region 12541539..12541599 FT /rpt_family="MaLR" FT repeat_region 12541819..12541950 FT /rpt_family="L2" FT repeat_region 12541990..12542017 FT /rpt_family="(T)n" FT repeat_region 12542326..12542615 FT /rpt_family="Alu" FT repeat_region 12543275..12543746 FT /rpt_family="ERVL" FT misc_feature 12543295..12543348 FT /note="match to EST AW663909 (NID:g7456448) hi73d10.x1" FT repeat_region 12543873..12544665 FT /rpt_family="ERVL" FT repeat_region 12544792..12544860 FT /rpt_family="AT_rich" FT repeat_region 12544868..12544919 FT /rpt_family="(TA)n" FT repeat_region 12545010..12545044 FT /rpt_family="AT_rich" FT misc_feature 12545062..12545135 FT /note="match to EST AW663909 (NID:g7456448) hi73d10.x1" FT repeat_region 12545485..12545671 FT /rpt_family="L1" FT repeat_region 12547186..12547370 FT /rpt_family="L2" FT repeat_region 12547414..12547624 FT /rpt_family="L2" FT repeat_region 12547625..12547906 FT /rpt_family="ERVL" FT misc_feature 12547638..12547814 FT /note="match to EST AW663909 (NID:g7456448) hi73d10.x1" FT /note="match to EST AI798675 (NID:g5364147) we91c08.x1" FT repeat_region 12548437..12548486 FT /rpt_family="MIR" FT repeat_region 12548487..12548711 FT /rpt_family="MER1_type" FT repeat_region 12548712..12548787 FT /rpt_family="MIR" FT misc_feature 12550163..12550473 FT /note="match to EST AI381886 (NID:g4194667) te72b04.x1" FT repeat_region 12550857..12551062 FT /rpt_family="L1" FT repeat_region 12551441..12551532 FT /rpt_family="(TAAA)n" FT repeat_region 12551736..12551974 FT /rpt_family="L1" FT repeat_region 12552135..12552253 FT /rpt_family="MIR" FT repeat_region 12552407..12552749 FT /rpt_family="MaLR" FT repeat_region 12552768..12553066 FT /rpt_family="MER1_type" FT repeat_region 12553214..12553307 FT /rpt_family="L1" FT repeat_region 12553399..12553567 FT /rpt_family="(TA)n" FT repeat_region 12553571..12553652 FT /rpt_family="AT_rich" FT repeat_region 12553766..12553887 FT /rpt_family="L1" FT repeat_region 12553954..12554197 FT /rpt_family="L1" FT repeat_region 12554479..12554851 FT /rpt_family="L1" FT repeat_region 12555205..12555248 FT /rpt_family="CT-rich" FT repeat_region 12555408..12555428 FT /rpt_family="AT_rich" FT repeat_region 12555631..12555656 FT /rpt_family="(T)n" FT repeat_region 12556150..12556534 FT /rpt_family="AcHobo" FT repeat_region 12557507..12557641 FT /rpt_family="MIR" FT repeat_region 12557677..12558031 FT /rpt_family="MaLR" FT misc_feature 12558075..12558388 FT /note="match to EST AA917784 (NID:g3057674) on82b03.s1" FT repeat_region 12558119..12558159 FT /rpt_family="(CATA)n" FT repeat_region 12559015..12559302 FT /rpt_family="MaLR" FT repeat_region 12559468..12559515 FT /rpt_family="L2" FT repeat_region 12560046..12560069 FT /rpt_family="AT_rich" FT repeat_region 12560460..12560489 FT /rpt_family="MER2_type" FT repeat_region 12561493..12561827 FT /rpt_family="MaLR" FT repeat_region 12562038..12562232 FT /rpt_family="L2" FT repeat_region 12562233..12562643 FT /rpt_family="MaLR" FT repeat_region 12562644..12562703 FT /rpt_family="L2" FT repeat_region 12563079..12563187 FT /rpt_family="L2" FT repeat_region 12566657..12566860 FT /rpt_family="L1" FT repeat_region 12566943..12567112 FT /rpt_family="MER1_type" FT repeat_region 12567133..12567266 FT /rpt_family="(TA)n" FT repeat_region 12567951..12568112 FT /rpt_family="MIR" FT repeat_region 12568993..12569071 FT /rpt_family="MIR" FT repeat_region 12569453..12569485 FT /rpt_family="AT_rich" FT repeat_region 12569589..12569669 FT /rpt_family="(TA)n" FT repeat_region 12569759..12569948 FT /rpt_family="CR1" FT repeat_region 12570238..12570442 FT /rpt_family="MER1_type" FT repeat_region 12570515..12570663 FT /rpt_family="Alu" FT repeat_region 12570726..12570774 FT /rpt_family="(TC)n" FT repeat_region 12571103..12571478 FT /rpt_family="ERVL" FT repeat_region 12572241..12572262 FT /rpt_family="AT_rich" FT misc_feature 12572525..12572797 FT /note="match to EST AW663909 (NID:g7456448) hi73d10.x1" FT /note="match to EST AI798675 (NID:g5364147) we91c08.x1" FT misc_feature 12572570..12573025 FT /note="match to EST AW511102 (NID:g7149180) hd43b12.x1" FT repeat_region 12573281..12573466 FT /rpt_family="MIR" FT repeat_region 12573599..12573627 FT /rpt_family="AT_rich" FT repeat_region 12575372..12575784 FT /rpt_family="MaLR" FT repeat_region 12575866..12576278 FT /rpt_family="MaLR" FT repeat_region 12577053..12577266 FT /rpt_family="L2" FT repeat_region 12578152..12578259 FT /rpt_family="MIR" FT repeat_region 12578339..12578543 FT /rpt_family="MER1_type" FT repeat_region 12578545..12578842 FT /rpt_family="Alu" FT repeat_region 12579767..12579936 FT /rpt_family="MIR" FT repeat_region 12581351..12581483 FT /rpt_family="MIR" FT repeat_region 12582462..12582624 FT /rpt_family="MIR" FT repeat_region 12582880..12583095 FT /rpt_family="MER1_type" FT repeat_region 12583111..12583356 FT /rpt_family="L1" FT repeat_region 12583425..12584145 FT /rpt_family="L2" FT repeat_region 12584278..12584299 FT /rpt_family="AT_rich" FT repeat_region 12584553..12584599 FT /rpt_family="AT_rich" FT repeat_region 12585227..12585708 FT /rpt_family="L1" FT repeat_region 12585444..12585464 FT /rpt_family="AT_rich" FT repeat_region 12585709..12586122 FT /rpt_family="L1" FT repeat_region 12586095..12586141 FT /rpt_family="AT_rich" FT repeat_region 12586123..12586873 FT /rpt_family="L1" FT repeat_region 12586874..12587177 FT /rpt_family="Alu" FT repeat_region 12587178..12587315 FT /rpt_family="L1" FT repeat_region 12588050..12588069 FT /rpt_family="(TG)n" FT repeat_region 12588184..12588479 FT /rpt_family="MaLR" FT repeat_region 12590190..12590550 FT /rpt_family="MaLR" FT repeat_region 12590611..12590826 FT /rpt_family="MER1_type" FT repeat_region 12591199..12591229 FT /rpt_family="AT_rich" FT repeat_region 12591418..12591458 FT /rpt_family="(TAA)n" FT repeat_region 12591915..12592102 FT /rpt_family="L1" FT repeat_region 12592094..12592119 FT /rpt_family="AT_rich" FT repeat_region 12592896..12593194 FT /rpt_family="Alu" FT repeat_region 12593289..12593403 FT /rpt_family="L1" FT repeat_region 12593450..12593626 FT /rpt_family="MIR" FT repeat_region 12593627..12594067 FT /rpt_family="ERVL" FT repeat_region 12594068..12594082 FT /rpt_family="MIR" FT repeat_region 12594083..12594461 FT /rpt_family="MaLR" FT repeat_region 12594275..12594297 FT /rpt_family="(TC)n" FT repeat_region 12594462..12594498 FT /rpt_family="MIR" FT repeat_region 12596328..12598560 FT /rpt_family="L1" FT repeat_region 12598566..12598899 FT /rpt_family="MaLR" FT repeat_region 12598897..12598920 FT /rpt_family="AT_rich" FT repeat_region 12598905..12598949 FT /rpt_family="L1" FT repeat_region 12603333..12603423 FT /rpt_family="(TA)n" FT repeat_region 12603449..12603493 FT /rpt_family="(CA)n" FT repeat_region 12603499..12603844 FT /rpt_family="ERVL" FT repeat_region 12603855..12604212 FT /rpt_family="MaLR" FT repeat_region 12604218..12604280 FT /rpt_family="Mariner" FT repeat_region 12604451..12604566 FT /rpt_family="L2" FT repeat_region 12604649..12604934 FT /rpt_family="Alu" FT repeat_region 12605999..12606080 FT /rpt_family="MIR" FT repeat_region 12606192..12606219 FT /rpt_family="AT_rich" FT repeat_region 12606480..12606601 FT /rpt_family="MIR" FT repeat_region 12606934..12607096 FT /rpt_family="MER1_type" FT repeat_region 12608886..12609123 FT /rpt_family="MIR" FT repeat_region 12609135..12609179 FT /rpt_family="MIR" FT repeat_region 12609774..12609871 FT /rpt_family="MIR" FT repeat_region 12611076..12611506 FT /rpt_family="ERV1" FT repeat_region 12612950..12613157 FT /rpt_family="L2" FT repeat_region 12613352..12613956 FT /rpt_family="L1" FT repeat_region 12613938..12613959 FT /rpt_family="AT_rich" FT repeat_region 12614161..12614293 FT /rpt_family="L2" FT repeat_region 12614552..12614891 FT /rpt_family="MaLR" FT repeat_region 12614966..12615007 FT /rpt_family="L2" FT repeat_region 12615434..12615548 FT /rpt_family="MIR" FT repeat_region 12615853..12616029 FT /rpt_family="(TTTC)n" FT repeat_region 12616030..12616083 FT /rpt_family="CT-rich" FT repeat_region 12616217..12616769 FT /rpt_family="ERV1" FT repeat_region 12617579..12617621 FT /rpt_family="L2" FT misc_feature 12617880..12618136 FT /note="match to EST T93247 (NID:g725160) ye28h05.r1" FT repeat_region 12618082..12618285 FT /rpt_family="ERVL" FT repeat_region 12618385..12618453 FT /rpt_family="ERVL" FT repeat_region 12618454..12618691 FT /rpt_family="MaLR" FT repeat_region 12618692..12618716 FT /rpt_family="(T)n" FT repeat_region 12618990..12619173 FT /rpt_family="MaLR" FT repeat_region 12619174..12619825 FT /rpt_family="ERVL" FT repeat_region 12619889..12620030 FT /rpt_family="ERVL" FT repeat_region 12621659..12621987 FT /rpt_family="ERVL" FT repeat_region 12624436..12624568 FT /rpt_family="Alu" FT repeat_region 12624593..12625177 FT /rpt_family="L1" FT repeat_region 12625240..12625354 FT /rpt_family="MIR" FT repeat_region 12625515..12625639 FT /rpt_family="MIR" FT repeat_region 12625748..12625919 FT /rpt_family="MIR" FT repeat_region 12626621..12626818 FT /rpt_family="ERVL" FT repeat_region 12626821..12627127 FT /rpt_family="Alu" FT repeat_region 12626824..12626847 FT /rpt_family="AT_rich" FT repeat_region 12627167..12627232 FT /rpt_family="ERVL" FT repeat_region 12627239..12627265 FT /rpt_family="AT_rich" FT repeat_region 12627261..12628101 FT /rpt_family="L1" FT repeat_region 12627933..12627958 FT /rpt_family="(T)n" FT repeat_region 12628102..12628263 FT /rpt_family="L1" FT repeat_region 12628264..12628497 FT /rpt_family="L1" FT repeat_region 12628498..12628526 FT /rpt_family="(T)n" FT repeat_region 12628806..12629318 FT /rpt_family="L1" FT repeat_region 12629328..12629362 FT /rpt_family="(T)n" FT repeat_region 12629333..12629653 FT /rpt_family="Alu" FT repeat_region 12629508..12629537 FT /rpt_family="AT_rich" FT repeat_region 12629668..12630031 FT /rpt_family="ERVL" FT repeat_region 12630032..12630151 FT /rpt_family="ERVL" FT repeat_region 12630203..12630225 FT /rpt_family="(CA)n" FT repeat_region 12631247..12631258 FT /rpt_family="ERVL" FT repeat_region 12631259..12631637 FT /rpt_family="MaLR" FT repeat_region 12631638..12631949 FT /rpt_family="ERVL" FT repeat_region 12633057..12633277 FT /rpt_family="MER1_type" FT repeat_region 12633374..12633482 FT /rpt_family="MIR" FT repeat_region 12634297..12634421 FT /rpt_family="L2" FT repeat_region 12635149..12635312 FT /rpt_family="L2" FT repeat_region 12635321..12635351 FT /rpt_family="(TAAA)n" FT repeat_region 12635453..12635492 FT /rpt_family="L2" FT repeat_region 12635585..12635605 FT /rpt_family="AT_rich" FT repeat_region 12635980..12636149 FT /rpt_family="MIR" FT repeat_region 12636202..12636339 FT /rpt_family="MER1_type" FT repeat_region 12636846..12636982 FT /rpt_family="L2" FT repeat_region 12636979..12637230 FT /rpt_family="MIR" FT repeat_region 12637295..12637571 FT /rpt_family="L2" FT repeat_region 12637611..12637677 FT /rpt_family="(TTCC)n" FT repeat_region 12638742..12638798 FT /rpt_family="MIR" FT repeat_region 12638799..12638822 FT /rpt_family="L1" FT repeat_region 12638823..12639208 FT /rpt_family="MaLR" FT repeat_region 12639209..12639748 FT /rpt_family="L1" FT repeat_region 12639749..12639847 FT /rpt_family="MIR" FT repeat_region 12640068..12640088 FT /rpt_family="AT_rich" FT repeat_region 12640233..12640356 FT /rpt_family="MIR" FT repeat_region 12640425..12640587 FT /rpt_family="Alu" FT misc_feature 12641918..12642053 FT /note="similar to Homo sapiens EST C18160 (NID:g1579762)" FT misc_feature 12641918..12642061 FT /note="match to EST AW577078 (NID:g7252127)" FT misc_feature 12641918..12642246 FT /note="similar to Homo sapiens EST BE618743 (NID:g9889681)" FT misc_feature 12641918..12642262 FT /note="similar to Homo sapiens EST BE618857 (NID:g9889795)" FT misc_feature 12641918..12642270 FT /note="similar to Homo sapiens EST BE870000 FT (NID:g10318776)" FT /note="match to EST AA468291 (NID:g2194825) nc76c07.r1" FT /note="match to EST BG876491 (NID:g14253581)" FT misc_feature 12641919..12642270 FT /note="similar to Homo sapiens EST BE259303 (NID:g9129803)" FT misc_feature 12641933..12642270 FT /note="similar to Homo sapiens EST BF316110 FT (NID:g11264406)" FT misc_feature 12642116..12642270 FT /note="similar to Homo sapiens EST AW935148 (NID:g8110554)" FT misc_feature 12642119..12642270 FT /note="match to EST AA090288 (NID:g1636781)" FT repeat_region 12643282..12643307 FT /rpt_family="(A)n" FT repeat_region 12643345..12643700 FT /rpt_family="MaLR" FT repeat_region 12644394..12644417 FT /rpt_family="AT_rich" FT repeat_region 12644962..12645028 FT /rpt_family="Mariner" FT repeat_region 12646536..12646895 FT /rpt_family="MaLR" FT repeat_region 12647086..12647450 FT /rpt_family="MaLR" FT repeat_region 12647471..12647498 FT /rpt_family="AT_rich" FT repeat_region 12647563..12647812 FT /rpt_family="MIR" FT repeat_region 12647907..12648341 FT /rpt_family="ERVL" FT repeat_region 12648803..12648942 FT /rpt_family="CR1" FT repeat_region 12649583..12649824 FT /rpt_family="MaLR" FT repeat_region 12649922..12650205 FT /rpt_family="(TA)n" FT repeat_region 12650247..12650547 FT /rpt_family="(TA)n" FT repeat_region 12650574..12650654 FT /rpt_family="(TATATG)n" FT repeat_region 12650860..12651044 FT /rpt_family="MIR" FT repeat_region 12651412..12651792 FT /rpt_family="MaLR" FT repeat_region 12652296..12652463 FT /rpt_family="Alu" FT repeat_region 12652452..12652475 FT /rpt_family="AT_rich" FT repeat_region 12652464..12652755 FT /rpt_family="Alu" FT repeat_region 12652756..12652846 FT /rpt_family="Alu" FT repeat_region 12652861..12653190 FT /rpt_family="ERV1" FT repeat_region 12653191..12653248 FT /rpt_family="Alu" FT repeat_region 12653423..12653767 FT /rpt_family="MaLR" FT repeat_region 12653907..12653931 FT /rpt_family="AT_rich" FT repeat_region 12654231..12654253 FT /rpt_family="AT_rich" FT repeat_region 12656814..12656847 FT /rpt_family="AT_rich" FT repeat_region 12657271..12657475 FT /rpt_family="MIR" FT repeat_region 12657619..12657679 FT /rpt_family="(TA)n" FT repeat_region 12657755..12657824 FT /rpt_family="AT_rich" FT repeat_region 12658212..12658686 FT /rpt_family="MaLR" FT repeat_region 12659011..12659102 FT /rpt_family="L2" FT repeat_region 12659297..12659715 FT /rpt_family="MaLR" FT repeat_region 12660870..12661105 FT /rpt_family="MaLR" FT repeat_region 12660935..12660958 FT /rpt_family="(T)n" FT repeat_region 12661106..12661449 FT /rpt_family="MaLR" FT repeat_region 12661450..12661544 FT /rpt_family="MaLR" FT repeat_region 12662065..12662225 FT /rpt_family="GA-rich" FT repeat_region 12662235..12662731 FT /rpt_family="L1" FT repeat_region 12663154..12663393 FT /rpt_family="L1" FT repeat_region 12663452..12663633 FT /rpt_family="ERV1" FT repeat_region 12663479..12663697 FT /rpt_family="ERVL" FT repeat_region 12663799..12663941 FT /rpt_family="MIR" FT repeat_region 12664220..12664584 FT /rpt_family="MaLR" FT repeat_region 12665554..12665597 FT /rpt_family="(T)n" FT repeat_region 12665568..12665896 FT /rpt_family="Alu" FT repeat_region 12666123..12666156 FT /rpt_family="AT_rich" FT repeat_region 12666151..12666424 FT /rpt_family="Alu" FT repeat_region 12666435..12666725 FT /rpt_family="Alu" FT repeat_region 12666789..12667211 FT /rpt_family="AcHobo" FT repeat_region 12667215..12667273 FT /rpt_family="AcHobo" FT repeat_region 12667273..12667554 FT /rpt_family="(TA)n" FT repeat_region 12667568..12668266 FT /rpt_family="(TA)n" FT repeat_region 12668271..12668450 FT /rpt_family="(TTATA)n" FT repeat_region 12668423..12668982 FT /rpt_family="(TA)n" FT repeat_region 12669049..12669229 FT /rpt_family="AcHobo" FT repeat_region 12669230..12669586 FT /rpt_family="MaLR" FT repeat_region 12669587..12669703 FT /rpt_family="AcHobo" FT repeat_region 12669704..12669994 FT /rpt_family="Alu" FT repeat_region 12669995..12670078 FT /rpt_family="AcHobo" FT repeat_region 12669998..12670029 FT /rpt_family="AT_rich" FT repeat_region 12670204..12670360 FT /rpt_family="MER1_type" FT repeat_region 12671036..12671076 FT /rpt_family="L1" FT repeat_region 12671077..12671333 FT /rpt_family="L1" FT repeat_region 12671313..12671333 FT /rpt_family="AT_rich" FT repeat_region 12671622..12671893 FT /rpt_family="MaLR" FT repeat_region 12671894..12672258 FT /rpt_family="MaLR" FT repeat_region 12672259..12672382 FT /rpt_family="MaLR" FT repeat_region 12672420..12672447 FT /rpt_family="AT_rich" FT repeat_region 12672449..12672712 FT /rpt_family="L2" FT repeat_region 12672726..12673150 FT /rpt_family="MER2_type" FT repeat_region 12673061..12673153 FT /rpt_family="GA-rich" FT repeat_region 12673121..12673247 FT /rpt_family="MER2_type" FT repeat_region 12673239..12673304 FT /rpt_family="MER2_type" FT repeat_region 12673411..12673637 FT /rpt_family="MIR" FT repeat_region 12673712..12673875 FT /rpt_family="MIR" FT repeat_region 12675243..12675340 FT /rpt_family="MaLR" FT repeat_region 12676150..12676384 FT /rpt_family="L1" FT repeat_region 12676168..12676264 FT /rpt_family="A-rich" FT repeat_region 12676392..12677035 FT /rpt_family="L1" FT repeat_region 12677323..12677619 FT /rpt_family="Alu" FT repeat_region 12677444..12677465 FT /rpt_family="AT_rich" FT repeat_region 12677633..12678166 FT /rpt_family="MER1_type" FT repeat_region 12677932..12677979 FT /rpt_family="AT_rich" FT repeat_region 12678182..12678231 FT /rpt_family="(CA)n" FT repeat_region 12678978..12679105 FT /rpt_family="MIR" FT repeat_region 12679459..12679656 FT /rpt_family="MER1_type" FT repeat_region 12679772..12680020 FT /rpt_family="MIR" FT repeat_region 12680537..12680709 FT /rpt_family="MIR" FT repeat_region 12680778..12680876 FT /rpt_family="MIR" FT repeat_region 12682404..12682526 FT /rpt_family="L1" FT repeat_region 12683692..12684048 FT /rpt_family="MaLR" FT repeat_region 12684403..12684562 FT /rpt_family="MIR" FT repeat_region 12684526..12684553 FT /rpt_family="AT_rich" FT repeat_region 12684563..12684936 FT /rpt_family="MaLR" FT repeat_region 12684937..12684992 FT /rpt_family="MIR" FT repeat_region 12685004..12685049 FT /rpt_family="AT_rich" FT misc_feature 12685203..12685505 FT /note="similar to EST AA192738 (NID:g1782135) zp93f11.r1" FT misc_feature 12685224..12685505 FT /note="similar to EST AA192826 (NID:g1782314) zp93f11.s1" FT repeat_region 12685666..12685724 FT /rpt_family="MIR" FT repeat_region 12685994..12686163 FT /rpt_family="MIR" FT repeat_region 12687111..12687213 FT /rpt_family="MER1_type" FT repeat_region 12687437..12687510 FT /rpt_family="ERV1" FT repeat_region 12687513..12687593 FT /rpt_family="ERV1" FT repeat_region 12687618..12687738 FT /rpt_family="L2" FT repeat_region 12688146..12688423 FT /rpt_family="Alu" FT repeat_region 12688417..12688439 FT /rpt_family="AT_rich" FT repeat_region 12688474..12688604 FT /rpt_family="MER1_type" FT repeat_region 12688611..12688858 FT /rpt_family="Alu" FT repeat_region 12688859..12689035 FT /rpt_family="Alu" FT repeat_region 12689009..12689035 FT /rpt_family="(A)n" FT repeat_region 12689442..12689486 FT /rpt_family="MaLR" FT repeat_region 12689765..12690060 FT /rpt_family="MaLR" FT repeat_region 12690094..12690155 FT /rpt_family="L2" FT repeat_region 12690312..12690547 FT /rpt_family="Alu" FT repeat_region 12690534..12690565 FT /rpt_family="AT_rich" FT repeat_region 12691497..12691517 FT /rpt_family="AT_rich" FT repeat_region 12694262..12695019 FT /rpt_family="L1" FT repeat_region 12695036..12695662 FT /rpt_family="L1" FT repeat_region 12695789..12696013 FT /rpt_family="ERVL" FT repeat_region 12696398..12697064 FT /rpt_family="ERVL" FT repeat_region 12698494..12699453 FT /rpt_family="L1" FT repeat_region 12699496..12699564 FT /rpt_family="L1" FT repeat_region 12699641..12699927 FT /rpt_family="ERV1" FT repeat_region 12699664..12699685 FT /rpt_family="AT_rich" FT repeat_region 12700176..12700210 FT /rpt_family="(T)n" FT repeat_region 12700180..12700485 FT /rpt_family="Alu" FT repeat_region 12700935..12701346 FT /rpt_family="MaLR" FT repeat_region 12703449..12703543 FT /rpt_family="MIR" FT repeat_region 12703579..12703746 FT /rpt_family="MER1_type" FT repeat_region 12703836..12703976 FT /rpt_family="MER1_type" FT repeat_region 12703840..12703990 FT /rpt_family="MER1_type" FT repeat_region 12703992..12704080 FT /rpt_family="MIR" FT repeat_region 12704114..12704454 FT /rpt_family="L1" FT repeat_region 12705096..12705267 FT /rpt_family="MIR" FT repeat_region 12706181..12706350 FT /rpt_family="MIR" FT repeat_region 12706379..12706400 FT /rpt_family="AT_rich" FT repeat_region 12707772..12707972 FT /rpt_family="L1" FT repeat_region 12708264..12708844 FT /rpt_family="ERVL" FT repeat_region 12709283..12709351 FT /rpt_family="L1" FT repeat_region 12709356..12709620 FT /rpt_family="L2" FT repeat_region 12709753..12710046 FT /rpt_family="Alu" FT repeat_region 12710158..12710530 FT /rpt_family="MaLR" FT repeat_region 12710554..12710580 FT /rpt_family="(CAAAA)n" FT repeat_region 12711884..12712036 FT /rpt_family="MaLR" FT repeat_region 12712139..12712224 FT /rpt_family="L2" FT repeat_region 12712229..12712261 FT /rpt_family="(TG)n" FT repeat_region 12712273..12712472 FT /rpt_family="MaLR" FT repeat_region 12712473..12712771 FT /rpt_family="Alu" FT repeat_region 12712772..12712975 FT /rpt_family="MaLR" FT repeat_region 12712976..12713160 FT /rpt_family="MER1_type" FT repeat_region 12713136..12713268 FT /rpt_family="MaLR" FT repeat_region 12713960..12714281 FT /rpt_family="Alu" FT repeat_region 12714258..12714309 FT /rpt_family="(CAAAAA)n" FT repeat_region 12714513..12714902 FT /rpt_family="MaLR" FT repeat_region 12715110..12715246 FT /rpt_family="(TA)n" FT repeat_region 12715267..12715569 FT /rpt_family="(TA)n" FT repeat_region 12715582..12716100 FT /rpt_family="(TA)n" FT repeat_region 12716143..12716312 FT /rpt_family="(TA)n" FT repeat_region 12716313..12716350 FT /rpt_family="AT_rich" FT repeat_region 12716351..12716513 FT /rpt_family="(TA)n" FT repeat_region 12716517..12716696 FT /rpt_family="(TTATA)n" FT repeat_region 12716698..12716748 FT /rpt_family="AT_rich" FT repeat_region 12716749..12716930 FT /rpt_family="(TTATA)n" FT repeat_region 12716935..12717039 FT /rpt_family="(TATAA)n" FT repeat_region 12717041..12717207 FT /rpt_family="(TA)n" FT repeat_region 12717195..12717249 FT /rpt_family="ERVL" FT repeat_region 12717423..12717585 FT /rpt_family="L1" FT repeat_region 12717585..12717745 FT /rpt_family="L1" FT repeat_region 12717775..12718315 FT /rpt_family="L1" FT repeat_region 12718614..12718795 FT /rpt_family="L2" FT repeat_region 12720129..12720557 FT /rpt_family="MaLR" FT repeat_region 12722163..12722315 FT /rpt_family="MIR" FT repeat_region 12722440..12722462 FT /rpt_family="AT_rich" FT misc_feature 12722824..12722970 FT /note="similar to EST BF333567 (NID:g11304315)" FT repeat_region 12723079..12723389 FT /rpt_family="Alu" FT repeat_region 12723392..12723416 FT /rpt_family="(TG)n" FT repeat_region 12723419..12723605 FT /rpt_family="L2" FT repeat_region 12723962..12724264 FT /rpt_family="Alu" FT repeat_region 12724244..12724264 FT /rpt_family="AT_rich" FT repeat_region 12724357..12724467 FT /rpt_family="MIR" FT repeat_region 12724978..12725145 FT /rpt_family="MIR" FT repeat_region 12725546..12725568 FT /rpt_family="AT_rich" FT repeat_region 12726774..12726801 FT /rpt_family="(TTCA)n" FT repeat_region 12726790..12726862 FT /rpt_family="L2" FT repeat_region 12727142..12727255 FT /rpt_family="MaLR" FT repeat_region 12727338..12727447 FT /rpt_family="MaLR" FT repeat_region 12727715..12728025 FT /rpt_family="Alu" FT repeat_region 12729357..12729490 FT /rpt_family="L1" FT repeat_region 12729467..12729580 FT /rpt_family="AT_rich" FT repeat_region 12729739..12729790 FT /rpt_family="(TAGA)n" FT repeat_region 12730379..12730402 FT /rpt_family="AT_rich" FT repeat_region 12730813..12730837 FT /rpt_family="AT_rich" FT repeat_region 12730888..12730974 FT /rpt_family="L2" FT repeat_region 12731134..12731161 FT /rpt_family="(A)n" FT repeat_region 12731360..12731501 FT /rpt_family="MIR" FT repeat_region 12731799..12732147 FT /rpt_family="MaLR" FT repeat_region 12732149..12732341 FT /rpt_family="MIR" FT repeat_region 12732343..12732415 FT /rpt_family="L2" FT repeat_region 12732440..12732583 FT /rpt_family="L2" FT repeat_region 12732781..12733087 FT /rpt_family="ERVL" FT repeat_region 12733244..12733288 FT /rpt_family="(CA)n" FT repeat_region 12733878..12734183 FT /rpt_family="Alu" FT repeat_region 12734360..12734510 FT /rpt_family="MIR" FT repeat_region 12734643..12734810 FT /rpt_family="MaLR" FT repeat_region 12734962..12734982 FT /rpt_family="AT_rich" FT repeat_region 12735159..12735221 FT /rpt_family="MER1_type" FT repeat_region 12735222..12735396 FT /rpt_family="AcHobo" FT repeat_region 12735397..12735498 FT /rpt_family="MER1_type" FT misc_feature 12735500..12736083 FT /note="similar to EST BE091223 (NID:g8481675)" FT repeat_region 12735617..12735676 FT /rpt_family="MIR" FT repeat_region 12735687..12735852 FT /rpt_family="MER1_type" FT repeat_region 12735865..12735919 FT /rpt_family="MIR" FT repeat_region 12736832..12737094 FT /rpt_family="Alu" FT repeat_region 12737104..12737987 FT /rpt_family="L1" FT repeat_region 12738021..12738069 FT /rpt_family="AT_rich" FT repeat_region 12738276..12738453 FT /rpt_family="L1" FT repeat_region 12738483..12738684 FT /rpt_family="MIR" FT repeat_region 12738710..12738862 FT /rpt_family="Alu" FT repeat_region 12739229..12739253 FT /rpt_family="(TG)n" FT repeat_region 12739274..12739378 FT /rpt_family="L1" FT repeat_region 12739379..12739747 FT /rpt_family="MaLR" FT repeat_region 12739748..12740185 FT /rpt_family="L1" FT repeat_region 12740293..12740314 FT /rpt_family="AT_rich" FT repeat_region 12740415..12740450 FT /rpt_family="AT_rich" FT repeat_region 12740810..12741124 FT /rpt_family="Alu" FT repeat_region 12741092..12741112 FT /rpt_family="AT_rich" FT repeat_region 12741166..12741550 FT /rpt_family="L1" FT repeat_region 12741646..12741754 FT /rpt_family="MaLR" FT repeat_region 12741994..12742022 FT /rpt_family="AT_rich" FT repeat_region 12742094..12742502 FT /rpt_family="L1" FT repeat_region 12742481..12742521 FT /rpt_family="A-rich" FT repeat_region 12742518..12742735 FT /rpt_family="MER1_type" FT repeat_region 12742737..12742805 FT /rpt_family="MER1_type?" FT repeat_region 12743005..12743027 FT /rpt_family="L2" FT repeat_region 12743027..12743056 FT /rpt_family="AT_rich" FT repeat_region 12743028..12743340 FT /rpt_family="Alu" FT repeat_region 12743341..12744448 FT /rpt_family="L2" FT repeat_region 12744453..12744865 FT /rpt_family="L2" FT repeat_region 12744920..12745645 FT /rpt_family="L1" FT repeat_region 12745720..12746133 FT /rpt_family="L2" FT repeat_region 12746138..12746178 FT /rpt_family="AT_rich" FT repeat_region 12746221..12746311 FT /rpt_family="MIR" FT repeat_region 12746388..12746464 FT /rpt_family="L2" FT repeat_region 12748274..12748440 FT /rpt_family="MIR" FT repeat_region 12748702..12749115 FT /rpt_family="L2" FT repeat_region 12749186..12749223 FT /rpt_family="(TG)n" FT repeat_region 12749386..12749487 FT /rpt_family="MIR" FT repeat_region 12749488..12749766 FT /rpt_family="Alu" FT repeat_region 12749767..12749874 FT /rpt_family="MIR" FT repeat_region 12756330..12756375 FT /rpt_family="T-rich" FT repeat_region 12756349..12756656 FT /rpt_family="Alu" FT repeat_region 12757173..12757518 FT /rpt_family="MaLR" FT repeat_region 12757644..12757811 FT /rpt_family="MIR" FT repeat_region 12757812..12758130 FT /rpt_family="Alu" FT repeat_region 12757924..12757968 FT /rpt_family="(TA)n" FT repeat_region 12758343..12758562 FT /rpt_family="L1" FT repeat_region 12758579..12758685 FT /rpt_family="MER1_type" FT repeat_region 12759097..12759128 FT /rpt_family="(TG)n" FT repeat_region 12759164..12759223 FT /rpt_family="(TA)n" FT repeat_region 12759223..12759430 FT /rpt_family="MER2_type" FT repeat_region 12759431..12759727 FT /rpt_family="Alu" FT repeat_region 12759728..12759807 FT /rpt_family="MER2_type" FT repeat_region 12759808..12760207 FT /rpt_family="MaLR" FT repeat_region 12760208..12760924 FT /rpt_family="MER2_type" FT repeat_region 12760925..12761291 FT /rpt_family="MaLR" FT repeat_region 12761292..12761465 FT /rpt_family="MER2_type" FT repeat_region 12761517..12761650 FT /rpt_family="L1" FT repeat_region 12761797..12761819 FT /rpt_family="AT_rich" FT repeat_region 12761918..12762724 FT /rpt_family="L1" FT repeat_region 12762745..12763112 FT /rpt_family="L1" FT repeat_region 12762827..12762893 FT /rpt_family="AT_rich" FT repeat_region 12763131..12763322 FT /rpt_family="MER1_type" FT repeat_region 12763323..12763686 FT /rpt_family="MaLR" FT repeat_region 12763687..12763717 FT /rpt_family="MER1_type" FT repeat_region 12763727..12764046 FT /rpt_family="L1" FT repeat_region 12764045..12764081 FT /rpt_family="(TAA)n" FT repeat_region 12764291..12764747 FT /rpt_family="L1" FT repeat_region 12764733..12764754 FT /rpt_family="AT_rich" FT repeat_region 12764790..12765111 FT /rpt_family="L1" FT repeat_region 12765112..12765405 FT /rpt_family="Alu" FT repeat_region 12765411..12765678 FT /rpt_family="Alu" FT repeat_region 12765679..12765793 FT /rpt_family="L1" FT repeat_region 12765950..12766067 FT /rpt_family="L1" FT repeat_region 12766379..12766408 FT /rpt_family="AT_rich" FT repeat_region 12766514..12766536 FT /rpt_family="AT_rich" FT repeat_region 12766774..12766838 FT /rpt_family="AT_rich" FT repeat_region 12766971..12767115 FT /rpt_family="(TA)n" FT repeat_region 12767183..12767608 FT /rpt_family="L1" FT repeat_region 12767888..12768030 FT /rpt_family="L1" FT repeat_region 12768228..12768574 FT /rpt_family="L1" FT repeat_region 12769369..12769503 FT /rpt_family="L1" FT repeat_region 12769632..12769673 FT /rpt_family="AT_rich" FT repeat_region 12769757..12769841 FT /rpt_family="GA-rich" FT repeat_region 12770550..12770625 FT /rpt_family="(TCTCC)n" FT repeat_region 12771062..12771219 FT /rpt_family="MIR" FT repeat_region 12771282..12771438 FT /rpt_family="MIR" FT misc_feature 12772103..12772476 FT /note="similar to EST BF406178 (NID:g11394153)" FT repeat_region 12772597..12772932 FT /rpt_family="Alu" FT repeat_region 12772761..12772815 FT /rpt_family="(T)n" FT repeat_region 12772935..12772973 FT /rpt_family="(T)n" FT repeat_region 12772944..12773254 FT /rpt_family="Alu" FT misc_feature 12772974..12773366 FT /note="similar to EST AA719726 (NID:g2732825) zh38a12.s1" FT repeat_region 12774173..12774922 FT /rpt_family="L1" FT repeat_region 12775314..12775447 FT /rpt_family="MIR" FT repeat_region 12775515..12775758 FT /rpt_family="MIR" FT repeat_region 12775733..12775786 FT /rpt_family="AT_rich" FT repeat_region 12776363..12777724 FT /rpt_family="L2" FT repeat_region 12777816..12777839 FT /rpt_family="(TAAA)n" FT repeat_region 12777910..12778854 FT /rpt_family="L2" FT repeat_region 12779158..12779277 FT /rpt_family="Alu" FT repeat_region 12779280..12779315 FT /rpt_family="AT_rich" FT repeat_region 12779416..12779859 FT /rpt_family="MaLR" FT repeat_region 12779850..12779887 FT /rpt_family="AT_rich" FT repeat_region 12779869..12779928 FT /rpt_family="L1" FT repeat_region 12779930..12780203 FT /rpt_family="L1" FT repeat_region 12780690..12780725 FT /rpt_family="AT_rich" FT repeat_region 12780862..12781254 FT /rpt_family="MaLR" FT repeat_region 12781258..12781638 FT /rpt_family="MaLR" FT misc_feature 12781580..12781736 FT /note="similar to EST H55874 (NID:g1004518) yq94f06.r1" FT repeat_region 12781888..12782187 FT /rpt_family="Alu" FT repeat_region 12782157..12782185 FT /rpt_family="(TAAAA)n" FT repeat_region 12783162..12783276 FT /rpt_family="L1" FT repeat_region 12783458..12783767 FT /rpt_family="Alu" FT repeat_region 12783740..12783777 FT /rpt_family="(TAAAAA)n" FT repeat_region 12783821..12783845 FT /rpt_family="AT_rich" FT repeat_region 12784487..12784514 FT /rpt_family="AT_rich" FT repeat_region 12784825..12785174 FT /rpt_family="L2" FT repeat_region 12785172..12785206 FT /rpt_family="(T)n" FT repeat_region 12785175..12785355 FT /rpt_family="Alu" FT repeat_region 12785355..12785385 FT /rpt_family="(T)n" FT repeat_region 12785356..12785666 FT /rpt_family="Alu" FT repeat_region 12785667..12785801 FT /rpt_family="Alu" FT repeat_region 12785802..12785927 FT /rpt_family="L2" FT repeat_region 12786065..12786199 FT /rpt_family="L2" FT repeat_region 12786189..12786226 FT /rpt_family="(TGAA)n" FT repeat_region 12786740..12786823 FT /rpt_family="MIR" FT repeat_region 12787236..12787879 FT /rpt_family="MER2_type" FT misc_feature 12787878..12788277 FT /note="similar to EST H64094 (NID:g1018895) yr57d02.r1" FT repeat_region 12788023..12788346 FT /rpt_family="MER2_type" FT repeat_region 12788501..12788588 FT /rpt_family="MIR" FT repeat_region 12788611..12788708 FT /rpt_family="Alu" FT repeat_region 12788712..12788823 FT /rpt_family="Alu" FT repeat_region 12789237..12789270 FT /rpt_family="AT_rich" FT repeat_region 12789301..12789339 FT /rpt_family="AT_rich" FT repeat_region 12789336..12789645 FT /rpt_family="Alu" FT repeat_region 12789754..12789789 FT /rpt_family="(A)n" FT repeat_region 12790162..12790212 FT /rpt_family="MaLR" FT repeat_region 12790213..12790515 FT /rpt_family="Alu" FT repeat_region 12790496..12790515 FT /rpt_family="(A)n" FT repeat_region 12790516..12790733 FT /rpt_family="MaLR" FT repeat_region 12791276..12791575 FT /rpt_family="MaLR" FT repeat_region 12791576..12792045 FT /rpt_family="ERVL" FT repeat_region 12791636..12791660 FT /rpt_family="(CATA)n" FT repeat_region 12792051..12792116 FT /rpt_family="MaLR" FT repeat_region 12792152..12792662 FT /rpt_family="L1" FT repeat_region 12792665..12792783 FT /rpt_family="L1" FT repeat_region 12793309..12793410 FT /rpt_family="L2" FT repeat_region 12793826..12794276 FT /rpt_family="L1" FT repeat_region 12794908..12794932 FT /rpt_family="AT_rich" FT repeat_region 12795498..12795695 FT /rpt_family="ERVL" FT repeat_region 12795851..12795968 FT /rpt_family="MIR" FT repeat_region 12795989..12796154 FT /rpt_family="(TA)n" FT repeat_region 12796195..12796238 FT /rpt_family="MIR" FT repeat_region 12796566..12796620 FT /rpt_family="(TTCA)n" FT repeat_region 12796594..12796741 FT /rpt_family="L2" FT repeat_region 12797121..12797819 FT /rpt_family="L2" FT repeat_region 12798026..12798360 FT /rpt_family="MaLR" FT repeat_region 12798411..12798525 FT /rpt_family="MaLR" FT repeat_region 12798711..12798789 FT /rpt_family="Mariner" FT repeat_region 12800020..12800101 FT /rpt_family="MIR" FT repeat_region 12800810..12800891 FT /rpt_family="MaLR" FT repeat_region 12800892..12801286 FT /rpt_family="MaLR" FT repeat_region 12801465..12801809 FT /rpt_family="L1" FT repeat_region 12804807..12805121 FT /rpt_family="Alu" FT repeat_region 12805096..12805121 FT /rpt_family="(A)n" FT repeat_region 12805133..12805337 FT /rpt_family="Alu" FT repeat_region 12805325..12805346 FT /rpt_family="AT_rich" FT repeat_region 12805667..12805754 FT /rpt_family="(TA)n" FT repeat_region 12806099..12806731 FT /rpt_family="L1" FT repeat_region 12807027..12807319 FT /rpt_family="Alu" FT repeat_region 12807462..12807581 FT /rpt_family="MIR" FT repeat_region 12807745..12807779 FT /rpt_family="AT_rich" FT repeat_region 12807902..12807927 FT /rpt_family="AT_rich" FT repeat_region 12808047..12808369 FT /rpt_family="ERVK" FT repeat_region 12808397..12808792 FT /rpt_family="MaLR" FT repeat_region 12808795..12809344 FT /rpt_family="L1" FT repeat_region 12809416..12809522 FT /rpt_family="L2" FT repeat_region 12809562..12809695 FT /rpt_family="MIR" FT repeat_region 12810172..12810396 FT /rpt_family="MIR" FT repeat_region 12810398..12810454 FT /rpt_family="MaLR" FT repeat_region 12810455..12810819 FT /rpt_family="L1" FT repeat_region 12810817..12810892 FT /rpt_family="(GAAA)n" FT repeat_region 12810895..12811309 FT /rpt_family="L1" FT repeat_region 12812005..12812167 FT /rpt_family="L1" FT repeat_region 12812215..12812323 FT /rpt_family="L1" FT repeat_region 12812317..12812337 FT /rpt_family="AT_rich" FT repeat_region 12812541..12812787 FT /rpt_family="Alu" FT repeat_region 12812828..12812985 FT /rpt_family="L1" FT repeat_region 12813003..12813769 FT /rpt_family="L1" FT repeat_region 12813764..12813869 FT /rpt_family="L1" FT repeat_region 12814249..12814955 FT /rpt_family="L1" FT repeat_region 12814953..12815623 FT /rpt_family="L1" FT repeat_region 12815651..12815839 FT /rpt_family="L1" FT repeat_region 12815831..12815931 FT /rpt_family="L1" FT repeat_region 12815947..12816202 FT /rpt_family="L1" FT repeat_region 12816555..12816635 FT /rpt_family="L1" FT repeat_region 12817145..12817197 FT /rpt_family="MIR" FT repeat_region 12818124..12818217 FT /rpt_family="MIR" FT repeat_region 12818229..12818533 FT /rpt_family="MER57B" FT repeat_region 12818534..12818814 FT /rpt_family="AluSg" FT repeat_region 12818815..12818858 FT /rpt_family="(CAAAA)n" FT repeat_region 12818859..12818876 FT /rpt_family="MER57B" FT repeat_region 12818889..12819788 FT /rpt_family="MER57-internal" FT repeat_region 12819961..12820062 FT /rpt_family="HERV23" FT repeat_region 12820332..12820618 FT /rpt_family="MER4B-internal" FT repeat_region complement(12820805..12821169) FT /rpt_family="MSTB" FT repeat_region 12821513..12821723 FT /rpt_family="HERV23" FT repeat_region 12821708..12823148 FT /rpt_family="MER57-internal" FT repeat_region 12823641..12823958 FT /rpt_family="MER57-internal" FT repeat_region 12824314..12825259 FT /rpt_family="MER57-internal" FT repeat_region 12825262..12825375 FT /rpt_family="LTR54" FT repeat_region 12825565..12825719 FT /rpt_family="MER57-internal" FT repeat_region 12825885..12825974 FT /rpt_family="MER57B" FT repeat_region 12826309..12826334 FT /rpt_family="AT_rich" FT repeat_region 12826814..12826867 FT /rpt_family="(TTTTA)n" FT repeat_region complement(12826869..12827130) FT /rpt_family="AluSx" FT repeat_region complement(12827935..12828221) FT /rpt_family="L1MC4" FT repeat_region complement(12828222..12828825) FT /rpt_family="L1MC4" FT repeat_region 12828826..12829175 FT /rpt_family="MLT1A1" FT repeat_region complement(12829176..12829567) FT /rpt_family="L1MC4" FT repeat_region 12830253..12830275 FT /rpt_family="THE1C" FT repeat_region 12830276..12830680 FT /rpt_family="MLT2B" FT repeat_region 12830681..12830997 FT /rpt_family="THE1C" FT repeat_region 12831815..12832027 FT /rpt_family="MER33" FT repeat_region 12832035..12832905 FT /rpt_family="L2" FT repeat_region complement(12832906..12833248) FT /rpt_family="THE1B" FT repeat_region complement(12833250..12834814) FT /rpt_family="THE1B-internal" FT repeat_region complement(12834817..12835158) FT /rpt_family="THE1B" FT repeat_region 12835159..12835710 FT /rpt_family="L2" FT repeat_region 12835888..12835998 FT /rpt_family="MER3" FT repeat_region 12835999..12836225 FT /rpt_family="Tigger2a" FT repeat_region complement(12836226..12836537) FT /rpt_family="AluSx" FT repeat_region 12836538..12836783 FT /rpt_family="Tigger2a" FT repeat_region 12836784..12836840 FT /rpt_family="MER3" FT repeat_region complement(12837006..12837155) FT /rpt_family="MLT1A1" FT repeat_region complement(12837156..12837409) FT /rpt_family="AluSc" FT repeat_region complement(12837410..12837615) FT /rpt_family="MLT1A1" FT repeat_region 12837672..12837851 FT /rpt_family="MIR" FT repeat_region complement(12839447..12839538) FT /rpt_family="Alu" FT repeat_region complement(12839706..12839998) FT /rpt_family="AluSg" FT repeat_region complement(12840006..12840259) FT /rpt_family="MLT1A1" FT repeat_region complement(12840262..12840331) FT /rpt_family="MIR" FT repeat_region 12840404..12840507 FT /rpt_family="MIR" FT repeat_region 12840517..12840736 FT /rpt_family="MIR" FT repeat_region 12841118..12841304 FT /rpt_family="MIR" FT repeat_region 12841441..12841469 FT /rpt_family="AT_rich" FT repeat_region complement(12841826..12842212) FT /rpt_family="L1P" FT repeat_region 12842213..12842958 FT /rpt_family="L1PA8" FT repeat_region complement(12843011..12843084) FT /rpt_family="L2" FT repeat_region 12843502..12843809 FT /rpt_family="AluSx" FT repeat_region 12843847..12844129 FT /rpt_family="AluJb" FT repeat_region 12844525..12844712 FT /rpt_family="LTR37A" FT repeat_region complement(12844713..12845067) FT /rpt_family="MLT1A1" FT repeat_region 12845068..12845174 FT /rpt_family="LTR37A" FT repeat_region complement(12845421..12845831) FT /rpt_family="MLT1B" FT repeat_region 12846086..12846271 FT /rpt_family="MER53" FT repeat_region 12846369..12846490 FT /rpt_family="MLT1B" FT repeat_region 12846491..12846797 FT /rpt_family="AluY" FT repeat_region 12846798..12847090 FT /rpt_family="MLT1B" FT repeat_region 12847108..12847169 FT /rpt_family="L2" FT repeat_region complement(12848263..12848408) FT /rpt_family="MIR" FT repeat_region 12849059..12849253 FT /rpt_family="MIR" FT repeat_region 12849803..12849823 FT /rpt_family="AT_rich" FT repeat_region complement(12850364..12850424) FT /rpt_family="MIR" FT repeat_region 12850686..12850819 FT /rpt_family="MIR" FT repeat_region 12851124..12851144 FT /rpt_family="AT_rich" FT repeat_region 12851900..12851940 FT /rpt_family="GA-rich" FT repeat_region 12852027..12852631 FT /rpt_family="HAL1" FT repeat_region 12852632..12852906 FT /rpt_family="AluJb" FT repeat_region 12852907..12853663 FT /rpt_family="HAL1" FT repeat_region complement(12854500..12854728) FT /rpt_family="MIR" FT repeat_region 12854908..12854977 FT /rpt_family="L2" FT repeat_region complement(12855628..12855772) FT /rpt_family="FRAM" FT repeat_region complement(12855798..12856105) FT /rpt_family="L1MD2" FT repeat_region complement(12856106..12856464) FT /rpt_family="THE1C" FT repeat_region complement(12856465..12857604) FT /rpt_family="L1MD2" FT repeat_region complement(12857640..12858383) FT /rpt_family="L1M4" FT repeat_region complement(12858395..12858620) FT /rpt_family="L1MA2" FT repeat_region complement(12858642..12859004) FT /rpt_family="L1M4" FT repeat_region 12858995..12859220 FT /rpt_family="L1MA9" FT repeat_region 12859221..12859503 FT /rpt_family="AluYa8" FT repeat_region 12859504..12859775 FT /rpt_family="L1MA9" FT repeat_region complement(12859776..12860106) FT /rpt_family="MER7A" FT repeat_region 12860107..12860287 FT /rpt_family="L1MA9" FT repeat_region complement(12860326..12860636) FT /rpt_family="AluSc" FT repeat_region complement(12860637..12861185) FT /rpt_family="L1M4" FT repeat_region complement(12861241..12861543) FT /rpt_family="L1M4c" FT repeat_region 12861544..12861578 FT /rpt_family="(TTTG)n" FT repeat_region complement(12861579..12862162) FT /rpt_family="L1M4c" FT repeat_region 12863067..12863193 FT /rpt_family="L2" FT repeat_region 12863277..12863372 FT /rpt_family="L2" FT repeat_region 12864091..12864210 FT /rpt_family="MLT1L" FT repeat_region complement(12864237..12864445) FT /rpt_family="L1MC5" FT repeat_region complement(12864459..12864579) FT /rpt_family="AluJb" FT repeat_region complement(12864779..12864938) FT /rpt_family="AluSg" FT repeat_region 12865113..12865307 FT /rpt_family="MIR" FT repeat_region 12865365..12865444 FT /rpt_family="MADE1" FT repeat_region 12865678..12866255 FT /rpt_family="L2" FT repeat_region 12866630..12867636 FT /rpt_family="L2" FT repeat_region complement(12867638..12868001) FT /rpt_family="L2" FT repeat_region 12868358..12868409 FT /rpt_family="L2" FT repeat_region 12868567..12868858 FT /rpt_family="AluSx" FT repeat_region 12869144..12869327 FT /rpt_family="(CATA)n" FT repeat_region 12869328..12869384 FT /rpt_family="(TA)n" FT repeat_region complement(12869385..12869677) FT /rpt_family="AluSg" FT repeat_region 12869678..12869704 FT /rpt_family="(TA)n" FT repeat_region complement(12870196..12871186) FT /rpt_family="L1MC5" FT repeat_region 12872015..12872041 FT /rpt_family="AT_rich" FT repeat_region complement(12872370..12872662) FT /rpt_family="AluSx" FT repeat_region 12874020..12874085 FT /rpt_family="(TA)n" FT repeat_region 12874115..12874156 FT /rpt_family="(TA)n" FT repeat_region 12874444..12874825 FT /rpt_family="L1" FT repeat_region 12874853..12874944 FT /rpt_family="(TA)n" FT repeat_region 12875368..12875501 FT /rpt_family="MIR" FT repeat_region 12875528..12875730 FT /rpt_family="MIR" FT repeat_region 12875744..12875861 FT /rpt_family="MIR" FT repeat_region 12876188..12876240 FT /rpt_family="(CA)n" FT repeat_region complement(12876357..12876450) FT /rpt_family="MIR" FT repeat_region 12876800..12876883 FT /rpt_family="MIR" FT repeat_region 12877048..12877389 FT /rpt_family="MLT1B" FT repeat_region complement(12877509..12878658) FT /rpt_family="LTR28" FT repeat_region complement(12877707..12877906) FT /rpt_family="LTR1B" FT repeat_region 12877907..12877939 FT /rpt_family="(TTTA)n" FT repeat_region complement(12877940..12878273) FT /rpt_family="L1PA2" FT repeat_region complement(12878274..12878820) FT /rpt_family="LTR1B" FT repeat_region 12878909..12879011 FT /rpt_family="MIR" FT repeat_region 12880001..12880113 FT /rpt_family="MIR" FT repeat_region complement(12880272..12880886) FT /rpt_family="MER73" FT repeat_region complement(12880997..12881261) FT /rpt_family="L2" FT repeat_region 12881672..12881714 FT /rpt_family="(TAGA)n" FT repeat_region 12881724..12881810 FT /rpt_family="(TA)n" FT repeat_region 12881811..12881849 FT /rpt_family="(CA)n" FT repeat_region 12882878..12883048 FT /rpt_family="L1ME3" FT repeat_region 12883049..12883353 FT /rpt_family="AluY" FT repeat_region 12883354..12883441 FT /rpt_family="L1ME3" FT repeat_region 12883642..12883815 FT /rpt_family="MER58A" FT repeat_region 12883881..12884093 FT /rpt_family="MER20" FT repeat_region 12884459..12884705 FT /rpt_family="(TA)n" FT repeat_region 12885199..12885313 FT /rpt_family="MIR" FT repeat_region complement(12885306..12885459) FT /rpt_family="MIR" FT repeat_region 12885572..12885999 FT /rpt_family="MSTB" FT repeat_region complement(12887781..12887852) FT /rpt_family="MIR" FT repeat_region 12888064..12888084 FT /rpt_family="(TTA)n" FT repeat_region complement(12888085..12888366) FT /rpt_family="AluSx" FT repeat_region 12888550..12888914 FT /rpt_family="THE1B" FT repeat_region 12889087..12889138 FT /rpt_family="(CA)n" FT repeat_region complement(12889215..12889606) FT /rpt_family="L2" FT repeat_region complement(12890060..12890129) FT /rpt_family="MIR" FT repeat_region complement(12890134..12890286) FT /rpt_family="MLT1F" FT repeat_region complement(12890386..12890511) FT /rpt_family="MLT1H" FT repeat_region complement(12890557..12890638) FT /rpt_family="MIR" FT repeat_region complement(12890734..12891007) FT /rpt_family="L2" FT repeat_region complement(12891059..12891128) FT /rpt_family="L2" FT repeat_region 12891210..12891258 FT /rpt_family="(CA)n" FT repeat_region 12891803..12891924 FT /rpt_family="AluSp" FT repeat_region 12891925..12891976 FT /rpt_family="(TAA)n" FT repeat_region 12891977..12892148 FT /rpt_family="AluSp" FT repeat_region 12892317..12892478 FT /rpt_family="MIR" FT repeat_region complement(12892537..12892909) FT /rpt_family="LTR16A1" FT repeat_region 12893081..12893171 FT /rpt_family="MIR" FT repeat_region 12893214..12893661 FT /rpt_family="MLT1C" FT repeat_region 12893667..12893743 FT /rpt_family="MIR" FT repeat_region 12895284..12895335 FT /rpt_family="(TTTA)n" FT repeat_region complement(12895336..12895618) FT /rpt_family="AluSx" FT repeat_region 12895971..12896064 FT /rpt_family="L2" FT repeat_region 12896715..12896890 FT /rpt_family="MIR" FT repeat_region complement(12897250..12897373) FT /rpt_family="MIR" FT repeat_region complement(12900411..12900577) FT /rpt_family="MIR" FT repeat_region 12900664..12900684 FT /rpt_family="AT_rich" FT repeat_region 12900868..12900911 FT /rpt_family="(CA)n" FT repeat_region complement(12900920..12901252) FT /rpt_family="MER2" FT repeat_region 12901254..12901358 FT /rpt_family="(TG)n" FT repeat_region 12901520..12901800 FT /rpt_family="MLT1K" FT repeat_region 12902362..12902810 FT /rpt_family="L1M4" FT repeat_region complement(12902984..12903070) FT /rpt_family="MIR" FT repeat_region 12903271..12903330 FT /rpt_family="(TTTC)n" FT repeat_region 12903636..12904057 FT /rpt_family="L2" FT repeat_region 12905056..12905829 FT /rpt_family="L1PA2" FT repeat_region 12905825..12911069 FT /rpt_family="L1PA2" FT repeat_region 12911103..12911572 FT /rpt_family="MLT1D" FT repeat_region 12911573..12911982 FT /rpt_family="MLT1D-internal" FT repeat_region complement(12912239..12912442) FT /rpt_family="L2" FT repeat_region 12912486..12912540 FT /rpt_family="(ATG)n" FT repeat_region 12912705..12912841 FT /rpt_family="(TATAA)n" FT repeat_region complement(12912874..12912979) FT /rpt_family="MIR" FT repeat_region 12913445..12913534 FT /rpt_family="MIR" FT repeat_region 12914332..12914528 FT /rpt_family="MIR" FT repeat_region 12915052..12915345 FT /rpt_family="LTR16C" FT repeat_region 12915381..12915685 FT /rpt_family="AluY" FT repeat_region 12915798..12915824 FT /rpt_family="(TTTTG)n" FT repeat_region complement(12916299..12916746) FT /rpt_family="MLT2CB" FT repeat_region complement(12917206..12917611) FT /rpt_family="L2" FT repeat_region 12917612..12917956 FT /rpt_family="THE1B" FT repeat_region complement(12917957..12917988) FT /rpt_family="L2" FT repeat_region complement(12919626..12919712) FT /rpt_family="MIR" FT repeat_region 12919952..12920179 FT /rpt_family="L2" FT repeat_region 12921202..12921325 FT /rpt_family="MER94" FT repeat_region 12921724..12921755 FT /rpt_family="(TTTTTG)n" FT repeat_region 12922022..12922100 FT /rpt_family="MIR" FT repeat_region 12922142..12922185 FT /rpt_family="AT_rich" FT repeat_region complement(12922796..12923089) FT /rpt_family="L1MA2" FT repeat_region 12923150..12923550 FT /rpt_family="MLT1B" FT repeat_region 12923945..12924188 FT /rpt_family="MIR" FT repeat_region complement(12925757..12926117) FT /rpt_family="L2" FT repeat_region complement(12926155..12926619) FT /rpt_family="L2" FT repeat_region 12926706..12927145 FT /rpt_family="MLT2CB" FT repeat_region 12927146..12927194 FT /rpt_family="(TAGA)n" FT repeat_region 12928868..12928911 FT /rpt_family="L2" FT repeat_region complement(12930093..12930209) FT /rpt_family="L2" FT repeat_region complement(12930268..12930574) FT /rpt_family="MLT1A1" FT repeat_region complement(12930575..12930992) FT /rpt_family="MLT1A1-internal" FT repeat_region complement(12931385..12931995) FT /rpt_family="MLT1A1-internal" FT repeat_region complement(12932010..12932359) FT /rpt_family="MLT1A1" FT repeat_region 12932431..12932499 FT /rpt_family="(TA)n" FT repeat_region complement(12932527..12932838) FT /rpt_family="AluSx" FT repeat_region 12933054..12933078 FT /rpt_family="AT_rich" FT repeat_region 12933421..12933489 FT /rpt_family="AT_rich" FT repeat_region 12934563..12934993 FT /rpt_family="L2" FT repeat_region complement(12936398..12936508) FT /rpt_family="MIR" FT repeat_region 12938138..12938611 FT /rpt_family="LTR33" FT repeat_region complement(12939045..12939176) FT /rpt_family="L2" FT repeat_region complement(12939215..12939248) FT /rpt_family="MER91" FT repeat_region 12939253..12939532 FT /rpt_family="L2" FT repeat_region 12940067..12940179 FT /rpt_family="L1ME3" FT repeat_region 12940180..12940209 FT /rpt_family="(TA)n" FT repeat_region 12940210..12940364 FT /rpt_family="L1ME3" FT repeat_region 12940374..12940406 FT /rpt_family="AT_rich" FT repeat_region 12940577..12940681 FT /rpt_family="(TA)n" FT repeat_region 12940915..12941053 FT /rpt_family="MIR" FT repeat_region 12941084..12941104 FT /rpt_family="AT_rich" FT repeat_region 12941487..12941708 FT /rpt_family="MIR" FT repeat_region 12942317..12942453 FT /rpt_family="MIR" FT repeat_region complement(12942985..12943316) FT /rpt_family="MLT1F" FT repeat_region 12943317..12943480 FT /rpt_family="MLT1B" FT repeat_region complement(12943517..12943706) FT /rpt_family="MLT1F" FT repeat_region 12945115..12945150 FT /rpt_family="(TTTTG)n" FT repeat_region 12945277..12945406 FT /rpt_family="MLT2H" FT repeat_region 12945409..12945433 FT /rpt_family="(TTTTA)n" FT repeat_region complement(12945434..12945962) FT /rpt_family="L1PA9" FT repeat_region 12946269..12946556 FT /rpt_family="AluSg" FT repeat_region 12946624..12946856 FT /rpt_family="MIR" FT repeat_region 12946888..12946912 FT /rpt_family="AT_rich" FT unsure 12947148..12947250 FT /note="Single-stranded coverage." FT repeat_region 12947187..12947250 FT /rpt_family="(TAAA)n" FT repeat_region 12947302..12947367 FT /rpt_family="L1MC3" FT repeat_region 12947368..12947541 FT /rpt_family="(GGAA)n" FT repeat_region 12947542..12947727 FT /rpt_family="L1MC3" FT repeat_region 12947728..12947761 FT /rpt_family="(TAAA)n" FT repeat_region 12947762..12948438 FT /rpt_family="L1MC3" FT repeat_region 12948964..12949023 FT /rpt_family="AT_rich" FT repeat_region complement(12949180..12949480) FT /rpt_family="AluSx" FT repeat_region complement(12949531..12949608) FT /rpt_family="MIR" FT repeat_region 12949682..12949790 FT /rpt_family="MIR" FT repeat_region 12949791..12950067 FT /rpt_family="AluSp" FT repeat_region 12951226..12951264 FT /rpt_family="AT_rich" FT repeat_region 12951789..12951830 FT /rpt_family="(A)n" FT repeat_region complement(12952675..12953124) FT /rpt_family="MLT1C" FT repeat_region 12953226..12953622 FT /rpt_family="Charlie1" FT repeat_region 12953637..12954036 FT /rpt_family="Charlie1" FT repeat_region 12954037..12954142 FT /rpt_family="FLAM_A" FT repeat_region 12954145..12954167 FT /rpt_family="(CAAA)n" FT repeat_region 12954168..12954380 FT /rpt_family="Charlie1" FT repeat_region 12954383..12954662 FT /rpt_family="AluSx" FT repeat_region 12954663..12954711 FT /rpt_family="(TAAAA)n" FT repeat_region 12954788..12955704 FT /rpt_family="Charlie1" FT repeat_region 12956342..12956427 FT /rpt_family="MIR" FT repeat_region 12957413..12957485 FT /rpt_family="MIR" FT repeat_region complement(12957486..12957609) FT /rpt_family="MLT1J" FT repeat_region complement(12957898..12958050) FT /rpt_family="MLT1J" FT repeat_region 12958051..12958100 FT /rpt_family="MIR" FT repeat_region 12958783..12958889 FT /rpt_family="MIR" FT repeat_region 12958993..12959242 FT /rpt_family="MIR" FT repeat_region 12959689..12959871 FT /rpt_family="L2" FT repeat_region 12960810..12960964 FT /rpt_family="MIR" FT repeat_region 12961401..12961436 FT /rpt_family="(TG)n" FT repeat_region complement(12963674..12963753) FT /rpt_family="MIR" FT repeat_region complement(12963806..12963936) FT /rpt_family="MER5B" FT repeat_region 12964645..12964779 FT /rpt_family="AT_rich" FT repeat_region 12964805..12964839 FT /rpt_family="(TG)n" FT repeat_region 12966130..12966175 FT /rpt_family="AT_rich" FT repeat_region complement(12966756..12966911) FT /rpt_family="L2" FT repeat_region complement(12966983..12967218) FT /rpt_family="MER74A" FT repeat_region complement(12969138..12969447) FT /rpt_family="AluSx" FT repeat_region complement(12970961..12971254) FT /rpt_family="AluY" FT repeat_region 12971464..12971558 FT /rpt_family="L2" FT repeat_region complement(12972367..12972591) FT /rpt_family="MIR" FT repeat_region 12973584..12973634 FT /rpt_family="(T)n" FT repeat_region 12974268..12974451 FT /rpt_family="MER20" FT repeat_region complement(12974457..12974517) FT /rpt_family="MIR" FT repeat_region 12974561..12974688 FT /rpt_family="FLAM_A" FT repeat_region 12974689..12974714 FT /rpt_family="(CATA)n" FT repeat_region 13056653..13056721 FT /rpt_family="L2" FT repeat_region 13058883..13059015 FT /rpt_family="L2" FT repeat_region 13059092..13059289 FT /rpt_family="CR1" FT repeat_region 13059301..13059374 FT /rpt_family="ERV1" FT repeat_region 13059673..13059978 FT /rpt_family="Alu" FT repeat_region 13060320..13060998 FT /rpt_family="L2" FT repeat_region 13060999..13063316 FT /rpt_family="L1" FT repeat_region 13063341..13063517 FT /rpt_family="(CATATA)n" FT repeat_region 13063525..13063854 FT /rpt_family="(CATA)n" FT repeat_region 13063820..13063929 FT /rpt_family="L1" FT repeat_region 13063862..13064282 FT /rpt_family="(TA)n" FT repeat_region 13063921..13064023 FT /rpt_family="L1" FT repeat_region 13064015..13064087 FT /rpt_family="L1" FT repeat_region 13064282..13067713 FT /rpt_family="L1" FT repeat_region 13066282..13066323 FT /rpt_family="(TAAA)n" FT repeat_region 13068780..13068971 FT /rpt_family="MIR" FT repeat_region 13069002..13069169 FT /rpt_family="MIR" FT repeat_region 13070775..13070889 FT /rpt_family="MIR" FT repeat_region 13071292..13071494 FT /rpt_family="MaLR" FT repeat_region 13071642..13071924 FT /rpt_family="Alu" FT repeat_region 13071942..13071996 FT /rpt_family="MaLR" FT repeat_region 13072284..13072398 FT /rpt_family="MIR" FT repeat_region 13073335..13073377 FT /rpt_family="(CACG)n" FT repeat_region 13073427..13073538 FT /rpt_family="MER103" FT repeat_region 13073676..13073702 FT /rpt_family="(T)n" FT repeat_region 13074078..13074175 FT /rpt_family="L2" FT repeat_region 13074612..13074719 FT /rpt_family="L2" FT repeat_region 13074720..13075028 FT /rpt_family="Alu" FT repeat_region 13075029..13075212 FT /rpt_family="L2" FT repeat_region 13075262..13075440 FT /rpt_family="L1" FT repeat_region 13075441..13075750 FT /rpt_family="Alu" FT repeat_region 13075725..13075767 FT /rpt_family="(TAAAAA)n" FT repeat_region 13075751..13076229 FT /rpt_family="L1" FT repeat_region 13076845..13076867 FT /rpt_family="AT_rich" FT repeat_region 13077526..13077598 FT /rpt_family="AT_rich" FT repeat_region 13077602..13077778 FT /rpt_family="MIR" FT repeat_region 13078317..13078336 FT /rpt_family="(T)n" FT repeat_region 13078632..13078805 FT /rpt_family="MIR" FT repeat_region 13078875..13078945 FT /rpt_family="L2" FT repeat_region 13079920..13080031 FT /rpt_family="MIR" FT repeat_region 13080378..13080465 FT /rpt_family="L2" FT repeat_region 13081490..13081914 FT /rpt_family="L2" FT repeat_region 13081936..13082277 FT /rpt_family="MaLR" FT repeat_region 13082483..13082952 FT /rpt_family="L2" FT repeat_region 13083104..13083167 FT /rpt_family="L1" FT repeat_region 13083180..13083485 FT /rpt_family="MaLR" FT repeat_region 13083493..13084625 FT /rpt_family="MaLR" FT repeat_region 13084626..13084994 FT /rpt_family="MaLR" FT repeat_region 13085224..13085365 FT /rpt_family="Alu" FT repeat_region 13085348..13085369 FT /rpt_family="AT_rich" FT repeat_region 13085856..13086387 FT /rpt_family="L2" FT repeat_region 13086817..13087000 FT /rpt_family="MER1_type" FT repeat_region 13087399..13087525 FT /rpt_family="MER2_type" FT repeat_region 13087522..13087735 FT /rpt_family="MER2_type" FT repeat_region 13089751..13089842 FT /rpt_family="L2" FT repeat_region 13089900..13090094 FT /rpt_family="MIR" FT repeat_region 13090095..13090652 FT /rpt_family="ERVL" FT repeat_region 13090653..13090664 FT /rpt_family="MIR" FT repeat_region 13091944..13092379 FT /rpt_family="MaLR" FT repeat_region 13092954..13093029 FT /rpt_family="L2" FT repeat_region 13093047..13093918 FT /rpt_family="L1" FT repeat_region 13093910..13093939 FT /rpt_family="AT_rich" FT repeat_region 13093942..13094067 FT /rpt_family="CR1" FT repeat_region 13094277..13094313 FT /rpt_family="(TG)n" FT repeat_region 13095529..13095964 FT /rpt_family="MaLR" FT repeat_region 13095977..13096117 FT /rpt_family="MIR" FT repeat_region 13096118..13096473 FT /rpt_family="MaLR" FT repeat_region 13096474..13096490 FT /rpt_family="MIR" FT repeat_region 13096625..13097031 FT /rpt_family="MaLR" FT repeat_region 13097103..13097197 FT /rpt_family="Alu" FT repeat_region 13097947..13098026 FT /rpt_family="Mariner" FT repeat_region 13098296..13098662 FT /rpt_family="MaLR" FT repeat_region 13098781..13098853 FT /rpt_family="L1" FT repeat_region 13098831..13098877 FT /rpt_family="A-rich" FT repeat_region 13099311..13099617 FT /rpt_family="Alu" FT repeat_region 13099629..13099811 FT /rpt_family="MaLR" FT repeat_region 13100743..13101112 FT /rpt_family="MaLR" FT repeat_region 13101467..13101717 FT /rpt_family="MIR" FT repeat_region 13101754..13101793 FT /rpt_family="L2" FT repeat_region 13101888..13102056 FT /rpt_family="L2" FT repeat_region 13102496..13103060 FT /rpt_family="AcHobo" FT repeat_region 13103357..13103429 FT /rpt_family="L2" FT repeat_region 13104620..13104790 FT /rpt_family="MIR" FT repeat_region 13105182..13105478 FT /rpt_family="ERVL" FT repeat_region 13105604..13105665 FT /rpt_family="AT_rich" FT repeat_region 13106276..13106755 FT /rpt_family="MaLR" FT repeat_region 13107010..13107040 FT /rpt_family="AT_rich" FT repeat_region 13107427..13107512 FT /rpt_family="L1" FT repeat_region 13107514..13107615 FT /rpt_family="MaLR" FT repeat_region 13107616..13107941 FT /rpt_family="Alu" FT repeat_region 13107942..13108131 FT /rpt_family="MaLR" FT repeat_region 13108134..13109780 FT /rpt_family="MaLR" FT repeat_region 13109783..13110172 FT /rpt_family="MaLR" FT repeat_region 13110179..13110570 FT /rpt_family="L1" FT repeat_region 13110623..13110765 FT /rpt_family="L1" FT repeat_region 13110776..13110894 FT /rpt_family="L1" FT repeat_region 13110895..13111428 FT /rpt_family="ERVL" FT repeat_region 13111429..13111780 FT /rpt_family="L1" FT repeat_region 13111818..13111926 FT /rpt_family="L1" FT repeat_region 13111998..13113813 FT /rpt_family="L1" FT repeat_region 13113833..13113898 FT /rpt_family="Mariner" FT repeat_region 13113900..13114072 FT /rpt_family="L1" FT repeat_region 13114074..13114126 FT /rpt_family="Mariner" FT repeat_region 13114127..13115897 FT /rpt_family="L1" FT repeat_region 13115763..13115793 FT /rpt_family="AT_rich" FT repeat_region 13115889..13115983 FT /rpt_family="(TATATG)n" FT repeat_region 13116017..13116038 FT /rpt_family="(CA)n" FT repeat_region 13116035..13116391 FT /rpt_family="L1" FT repeat_region 13116383..13116437 FT /rpt_family="AT_rich" FT repeat_region 13116573..13116639 FT /rpt_family="Mariner" FT repeat_region 13116693..13116887 FT /rpt_family="L1" FT repeat_region 13117785..13118077 FT /rpt_family="L2" FT repeat_region 13118058..13118112 FT /rpt_family="GA-rich" FT repeat_region 13118226..13118293 FT /rpt_family="MIR" FT repeat_region 13118405..13118711 FT /rpt_family="Alu" FT repeat_region 13119511..13119576 FT /rpt_family="L2" FT repeat_region 13119785..13119873 FT /rpt_family="ERVL" FT repeat_region 13119904..13120281 FT /rpt_family="L2" FT repeat_region 13120519..13120646 FT /rpt_family="L2" FT repeat_region 13122812..13122890 FT /rpt_family="L2" FT repeat_region 13123088..13123159 FT /rpt_family="L2" FT repeat_region 13123822..13124314 FT /rpt_family="L1" FT repeat_region 13124155..13124183 FT /rpt_family="AT_rich" FT repeat_region 13124558..13124578 FT /rpt_family="AT_rich" FT repeat_region 13125442..13125506 FT /rpt_family="L2" FT repeat_region 13126244..13126291 FT /rpt_family="L2" FT repeat_region 13126947..13127034 FT /rpt_family="(CA)n" FT repeat_region 13127405..13127523 FT /rpt_family="MIR" FT repeat_region 13127528..13127785 FT /rpt_family="MIR" FT repeat_region 13128682..13128771 FT /rpt_family="MIR" FT repeat_region 13128847..13128985 FT /rpt_family="MIR" FT repeat_region 13129043..13129183 FT /rpt_family="MIR" FT repeat_region 13129186..13129257 FT /rpt_family="ERVL" FT repeat_region 13129329..13129474 FT /rpt_family="ERVL" FT repeat_region 13129635..13129938 FT /rpt_family="Alu" FT repeat_region 13129914..13129940 FT /rpt_family="(CAAAA)n" FT repeat_region 13129950..13130166 FT /rpt_family="L1" FT repeat_region 13130173..13130426 FT /rpt_family="L2" FT repeat_region 13130898..13130950 FT /rpt_family="MIR" FT repeat_region 13131610..13131774 FT /rpt_family="MIR" FT repeat_region 13132051..13132183 FT /rpt_family="MIR" FT repeat_region 13132287..13132315 FT /rpt_family="AT_rich" FT repeat_region 13132800..13132828 FT /rpt_family="AT_rich" FT repeat_region 13138313..13138393 FT /rpt_family="L2" FT repeat_region 13138625..13138834 FT /rpt_family="MIR" FT repeat_region 13139290..13139382 FT /rpt_family="ERV1" FT repeat_region 13139303..13139376 FT /rpt_family="(TG)n" FT repeat_region 13139749..13139927 FT /rpt_family="MIR" FT repeat_region 13140080..13140160 FT /rpt_family="(TG)n" FT repeat_region 13140174..13140242 FT /rpt_family="ERV1" FT repeat_region 13140196..13140561 FT /rpt_family="(TG)n" FT repeat_region 13140383..13140455 FT /rpt_family="ERV1" FT repeat_region 13140606..13140987 FT /rpt_family="MaLR" FT repeat_region 13141564..13141645 FT /rpt_family="L2" FT repeat_region 13142046..13142282 FT /rpt_family="MER1_type" FT repeat_region 13142297..13142517 FT /rpt_family="MaLR" FT repeat_region 13142518..13142906 FT /rpt_family="MaLR" FT repeat_region 13142907..13142960 FT /rpt_family="ERV1" FT repeat_region 13142981..13143099 FT /rpt_family="MaLR" FT repeat_region 13143100..13143455 FT /rpt_family="MaLR" FT repeat_region 13143456..13143701 FT /rpt_family="MaLR" FT repeat_region 13143709..13143790 FT /rpt_family="MER1_type" FT repeat_region 13143758..13143847 FT /rpt_family="MER1_type" FT repeat_region 13143840..13143934 FT /rpt_family="GA-rich" FT repeat_region 13143984..13144197 FT /rpt_family="MIR" FT repeat_region 13144268..13144290 FT /rpt_family="(TTTG)n" FT repeat_region 13144642..13144675 FT /rpt_family="AT_rich" FT repeat_region 13146224..13146509 FT /rpt_family="Alu" FT repeat_region 13146585..13146620 FT /rpt_family="CR1" FT repeat_region 13146816..13146888 FT /rpt_family="MIR" FT repeat_region 13146907..13147203 FT /rpt_family="Alu" FT misc_feature 13147411..13147606 FT /note="similar to Homo sapiens EST BG433521 FT (NID:g13340027)" FT repeat_region 13147686..13148452 FT /rpt_family="MER2_type" FT repeat_region 13148459..13148503 FT /rpt_family="AT_rich" FT repeat_region 13148533..13148796 FT /rpt_family="MER2_type" FT repeat_region 13148808..13148860 FT /rpt_family="L2" FT repeat_region 13148943..13149182 FT /rpt_family="L2" FT repeat_region 13149323..13149590 FT /rpt_family="(TA)n" FT repeat_region 13150203..13150456 FT /rpt_family="L2" FT repeat_region 13150716..13151868 FT /rpt_family="L2" FT repeat_region 13152205..13152260 FT /rpt_family="L2" FT repeat_region 13152261..13152506 FT /rpt_family="MIR" FT misc_feature 13152822..13153254 FT /note="match to EST AI076651 (NID:g3405829) oz08f08.x1" FT repeat_region 13153274..13153370 FT /rpt_family="MIR" FT repeat_region 13153597..13153652 FT /rpt_family="L2" FT repeat_region 13153699..13154237 FT /rpt_family="L2" FT repeat_region 13154238..13154390 FT /rpt_family="MaLR" FT repeat_region 13155962..13156327 FT /rpt_family="MaLR" FT repeat_region 13156356..13156561 FT /rpt_family="MER2_type" FT repeat_region 13156562..13156870 FT /rpt_family="Alu" FT repeat_region 13156851..13156873 FT /rpt_family="AT_rich" FT repeat_region 13156871..13157420 FT /rpt_family="MER2_type" FT repeat_region 13157204..13157284 FT /rpt_family="AT_rich" FT repeat_region 13157337..13157364 FT /rpt_family="AT_rich" FT repeat_region 13157388..13157428 FT /rpt_family="AT_rich" FT repeat_region 13157421..13157714 FT /rpt_family="Alu" FT repeat_region 13157715..13157898 FT /rpt_family="MER2_type" FT repeat_region 13157718..13157738 FT /rpt_family="AT_rich" FT repeat_region 13157803..13157835 FT /rpt_family="(CTCA)n" FT repeat_region 13158280..13158482 FT /rpt_family="Alu" FT repeat_region 13158483..13158622 FT /rpt_family="(TA)n" FT repeat_region 13158724..13158855 FT /rpt_family="L1" FT repeat_region 13158864..13158969 FT /rpt_family="MER2_type" FT repeat_region 13158970..13159342 FT /rpt_family="MaLR" FT repeat_region 13159343..13159453 FT /rpt_family="MER2_type" FT repeat_region 13159477..13159620 FT /rpt_family="L2" FT repeat_region 13159912..13160116 FT /rpt_family="L2" FT repeat_region 13160125..13160418 FT /rpt_family="Alu" FT repeat_region 13160525..13161274 FT /rpt_family="L2" FT repeat_region 13161357..13161388 FT /rpt_family="(T)n" FT repeat_region 13161361..13161669 FT /rpt_family="Alu" FT repeat_region 13162091..13162214 FT /rpt_family="L2" FT repeat_region 13162370..13162619 FT /rpt_family="L2" FT repeat_region 13163274..13163373 FT /rpt_family="MIR" FT repeat_region 13163676..13163804 FT /rpt_family="L2" FT repeat_region 13164222..13164388 FT /rpt_family="MIR" FT repeat_region 13165189..13165257 FT /rpt_family="MIR" FT repeat_region 13165258..13165615 FT /rpt_family="MaLR" FT repeat_region 13165616..13165680 FT /rpt_family="MIR" FT repeat_region 13166286..13166458 FT /rpt_family="MIR" FT repeat_region 13166489..13166536 FT /rpt_family="L2" FT repeat_region 13166611..13166828 FT /rpt_family="CR1" FT repeat_region 13166863..13167048 FT /rpt_family="L2" FT repeat_region 13167153..13167201 FT /rpt_family="GA-rich" FT repeat_region 13167318..13167517 FT /rpt_family="MIR" FT repeat_region 13167545..13167653 FT /rpt_family="MIR" FT repeat_region 13168362..13168615 FT /rpt_family="MIR" FT repeat_region 13168753..13168931 FT /rpt_family="MIR" FT repeat_region 13169496..13169599 FT /rpt_family="L2" FT repeat_region 13169595..13169624 FT /rpt_family="(TGGA)n" FT repeat_region 13170750..13171039 FT /rpt_family="Alu" FT repeat_region 13171044..13171314 FT /rpt_family="L1" FT repeat_region 13172952..13173367 FT /rpt_family="L2" FT repeat_region 13173611..13173719 FT /rpt_family="MIR" FT repeat_region 13174914..13174985 FT /rpt_family="GA-rich" FT repeat_region 13175281..13175395 FT /rpt_family="MIR" FT repeat_region 13175482..13175519 FT /rpt_family="AT_rich" FT repeat_region 13176940..13177053 FT /rpt_family="L2" FT repeat_region 13177177..13177737 FT /rpt_family="L2" FT repeat_region 13179230..13179345 FT /rpt_family="L1" FT repeat_region 13179860..13179980 FT /rpt_family="MER1_type" FT repeat_region 13180168..13180310 FT /rpt_family="MER103" FT repeat_region 13180735..13181152 FT /rpt_family="ERVL" FT repeat_region 13180771..13180794 FT /rpt_family="(TA)n" FT repeat_region 13181271..13181493 FT /rpt_family="MER1_type" FT repeat_region 13181764..13182193 FT /rpt_family="MaLR" FT repeat_region 13183462..13183485 FT /rpt_family="AT_rich" FT repeat_region 13183882..13183990 FT /rpt_family="MaLR" FT repeat_region 13183991..13184420 FT /rpt_family="L1" FT repeat_region 13184081..13184114 FT /rpt_family="(ATATG)n" FT repeat_region 13184414..13184579 FT /rpt_family="(TATAA)n" FT repeat_region 13184574..13184714 FT /rpt_family="L1" FT repeat_region 13184954..13185070 FT /rpt_family="MER1_type" FT repeat_region 13185118..13185194 FT /rpt_family="MaLR" FT repeat_region 13185206..13185640 FT /rpt_family="ERVL" FT repeat_region 13185641..13185696 FT /rpt_family="(CA)n" FT repeat_region 13185643..13185687 FT /rpt_family="ERV1" FT repeat_region 13185689..13185735 FT /rpt_family="ERVL" FT repeat_region 13185788..13186051 FT /rpt_family="MaLR" FT repeat_region 13186052..13186130 FT /rpt_family="Mariner" FT repeat_region 13186944..13187889 FT /rpt_family="L1" FT repeat_region 13187902..13188106 FT /rpt_family="Alu" FT repeat_region 13188192..13188336 FT /rpt_family="MIR" FT repeat_region 13188716..13188753 FT /rpt_family="AT_rich" FT repeat_region 13189000..13189253 FT /rpt_family="L1" FT repeat_region 13189689..13190138 FT /rpt_family="MaLR" FT repeat_region 13190427..13190459 FT /rpt_family="AT_rich" FT repeat_region 13190439..13190769 FT /rpt_family="Alu" FT repeat_region 13190610..13190651 FT /rpt_family="(TTTA)n" FT repeat_region 13190961..13191261 FT /rpt_family="Alu" FT repeat_region 13192257..13192419 FT /rpt_family="MIR" FT repeat_region 13192839..13192937 FT /rpt_family="MaLR" FT repeat_region 13193012..13193043 FT /rpt_family="(CA)n" FT repeat_region 13193231..13193310 FT /rpt_family="MIR" FT repeat_region 13194073..13194171 FT /rpt_family="L2" FT repeat_region 13194172..13194472 FT /rpt_family="Alu" FT repeat_region 13194473..13194656 FT /rpt_family="L2" FT repeat_region 13194660..13195129 FT /rpt_family="ERVL" FT repeat_region 13195138..13195177 FT /rpt_family="(GA)n" FT repeat_region 13195770..13196727 FT /rpt_family="L1" FT repeat_region 13196714..13196734 FT /rpt_family="AT_rich" FT repeat_region 13197077..13197737 FT /rpt_family="L2" FT repeat_region 13197732..13197906 FT /rpt_family="(CA)n" FT repeat_region 13197883..13197954 FT /rpt_family="ERV1" FT repeat_region 13197926..13197950 FT /rpt_family="(CA)n" FT repeat_region 13198848..13198878 FT /rpt_family="L2" FT repeat_region 13198924..13199053 FT /rpt_family="AcHobo" FT repeat_region 13199058..13199120 FT /rpt_family="MIR" FT repeat_region 13199609..13199684 FT /rpt_family="MIR" FT repeat_region 13199714..13200102 FT /rpt_family="ERVL" FT repeat_region 13200346..13200648 FT /rpt_family="Alu" FT repeat_region 13200817..13200997 FT /rpt_family="MER2_type" FT repeat_region 13201123..13201408 FT /rpt_family="Alu" FT repeat_region 13202299..13202595 FT /rpt_family="L2" FT repeat_region 13202596..13203140 FT /rpt_family="MaLR" FT repeat_region 13203141..13203226 FT /rpt_family="L2" FT repeat_region 13203255..13203463 FT /rpt_family="MIR" FT repeat_region 13205626..13205777 FT /rpt_family="Alu" FT repeat_region 13205779..13205819 FT /rpt_family="(CA)n" FT repeat_region 13205902..13205940 FT /rpt_family="AT_rich" FT repeat_region 13206260..13206568 FT /rpt_family="L2" FT repeat_region 13206789..13206826 FT /rpt_family="MIR" FT repeat_region 13206827..13207158 FT /rpt_family="MaLR" FT repeat_region 13207159..13207323 FT /rpt_family="MIR" FT repeat_region 13208310..13208586 FT /rpt_family="L2" FT repeat_region 13208618..13208805 FT /rpt_family="L1" FT repeat_region 13208807..13208885 FT /rpt_family="CR1" FT repeat_region 13209164..13209209 FT /rpt_family="L2" FT repeat_region 13209225..13209999 FT /rpt_family="L2" FT repeat_region 13210004..13210085 FT /rpt_family="L2" FT repeat_region 13210263..13210415 FT /rpt_family="MIR" FT repeat_region 13210414..13210551 FT /rpt_family="MIR" FT repeat_region 13210543..13210567 FT /rpt_family="AT_rich" FT repeat_region 13212423..13212555 FT /rpt_family="MIR" FT repeat_region 13212556..13212855 FT /rpt_family="Alu" FT repeat_region 13212836..13212871 FT /rpt_family="AT_rich" FT repeat_region 13212856..13212928 FT /rpt_family="MIR" FT repeat_region 13213105..13213432 FT /rpt_family="MER2_type" FT repeat_region 13213441..13213782 FT /rpt_family="ERVL" FT repeat_region 13213776..13213860 FT /rpt_family="(TA)n" FT repeat_region 13213842..13213903 FT /rpt_family="ERVL" FT repeat_region 13213944..13214389 FT /rpt_family="ERVL" FT repeat_region 13215618..13215789 FT /rpt_family="MER53" FT misc_feature 13242407..13404755 FT /note="Quality: Phrap Quality >=40 99.6% of Sequence; FT Estimated Total Number of Errors is 3.9.; STS Content:; FT SHGC-24090 G33370; SHGC4-1509 G01868; WI-8585 G06947; FT SHGC-51607 G34139; SHGC-50666 G33708; WI-5925 G11927" FT repeat_region 13404751..13404973 FT /rpt_family="MER1_type" FT repeat_region 13404989..13405049 FT /rpt_family="L2" FT repeat_region 13405722..13406027 FT /rpt_family="Alu" FT repeat_region 13406005..13406027 FT /rpt_family="(TAAAA)n" FT repeat_region 13407506..13407557 FT /rpt_family="AT_rich" FT repeat_region 13410613..13410651 FT /rpt_family="AT_rich" FT repeat_region 13411034..13411461 FT /rpt_family="ERVL" FT repeat_region 13411482..13411867 FT /rpt_family="MaLR" FT repeat_region 13412156..13412179 FT /rpt_family="AT_rich" FT repeat_region 13413297..13413364 FT /rpt_family="AT_rich" FT repeat_region 13414602..13415112 FT /rpt_family="L1" FT repeat_region 13414900..13414921 FT /rpt_family="AT_rich" FT repeat_region 13415975..13416746 FT /rpt_family="L1" FT repeat_region 13416847..13417783 FT /rpt_family="ERV1" FT repeat_region 13417784..13417884 FT /rpt_family="ERV1" FT repeat_region 13417886..13418109 FT /rpt_family="ERV1" FT repeat_region 13418118..13418378 FT /rpt_family="L1" FT repeat_region 13424517..13424549 FT /rpt_family="AT_rich" FT repeat_region 13424784..13424877 FT /rpt_family="MER1_type" FT repeat_region 13424878..13425123 FT /rpt_family="Alu" FT repeat_region 13425124..13425354 FT /rpt_family="MER1_type" FT repeat_region 13425801..13426230 FT /rpt_family="MaLR" FT repeat_region 13426243..13426771 FT /rpt_family="L2" FT misc_feature 13427528..13427880 FT /note="similar to Homo sapiens EST AW886982 (NID:g8048903)" FT repeat_region 13428238..13428346 FT /rpt_family="L2" FT repeat_region 13428881..13429464 FT /rpt_family="L1" FT repeat_region 13429465..13429915 FT /rpt_family="ERV1" FT repeat_region 13429916..13429960 FT /rpt_family="L1" FT misc_feature 13430021..13430264 FT /note="match to EST AI940427 (NID:g5687408)" FT repeat_region 13430119..13430485 FT /rpt_family="L1" FT repeat_region 13430467..13430547 FT /rpt_family="L1" FT repeat_region 13430569..13430869 FT /rpt_family="Alu" FT repeat_region 13430891..13431503 FT /rpt_family="L1" FT repeat_region 13431558..13431822 FT /rpt_family="L1" FT repeat_region 13431785..13431808 FT /rpt_family="AT_rich" FT misc_feature 13432557..13433046 FT /note="match to EST AW812674 (NID:g7905681)" FT repeat_region 13433079..13433169 FT /rpt_family="L1" FT repeat_region 13433174..13435960 FT /rpt_family="L1" FT repeat_region 13434759..13434783 FT /rpt_family="(A)n" FT repeat_region 13436361..13436670 FT /rpt_family="Alu" FT repeat_region 13436642..13436682 FT /rpt_family="(A)n" FT repeat_region 13439897..13440980 FT /rpt_family="L1" FT repeat_region 13440981..13441256 FT /rpt_family="Alu" FT repeat_region 13441257..13441347 FT /rpt_family="L1" FT repeat_region 13441365..13441472 FT /rpt_family="L1" FT repeat_region 13442065..13442126 FT /rpt_family="AT_rich" FT repeat_region 13442177..13442262 FT /rpt_family="MIR" FT repeat_region 13442295..13442562 FT /rpt_family="MaLR" FT repeat_region 13444155..13444270 FT /rpt_family="AT_rich" FT repeat_region 13444332..13444570 FT /rpt_family="MIR" FT repeat_region 13444804..13445094 FT /rpt_family="Alu" FT repeat_region 13445157..13445642 FT /rpt_family="L1" FT repeat_region 13445638..13445666 FT /rpt_family="(T)n" FT repeat_region 13445643..13445949 FT /rpt_family="Alu" FT repeat_region 13445950..13446353 FT /rpt_family="L1" FT repeat_region 13446357..13446445 FT /rpt_family="L2" FT repeat_region 13446472..13448427 FT /rpt_family="L1" FT repeat_region 13448436..13449008 FT /rpt_family="L2" FT repeat_region 13449226..13449247 FT /rpt_family="AT_rich" FT repeat_region 13449299..13449345 FT /rpt_family="MIR" FT repeat_region 13449580..13449751 FT /rpt_family="MIR" FT repeat_region 13450537..13450558 FT /rpt_family="(CAG)n" FT repeat_region 13451649..13451698 FT /rpt_family="AT_rich" FT repeat_region 13452213..13452756 FT /rpt_family="L2" FT repeat_region 13452761..13453657 FT /rpt_family="L1" FT repeat_region 13453022..13453060 FT /rpt_family="(TTTTTG)n" FT repeat_region 13458013..13458255 FT /rpt_family="MIR" FT misc_feature 13458075..13458596 FT /note="match to EST AU157149 (NID:g11018670)" FT misc_feature 13458251..13458965 FT /note="match to EST BF977320 (NID:g12344535)" FT repeat_region 13458555..13458575 FT /rpt_family="AT_rich" FT repeat_region 13459223..13459248 FT /rpt_family="(A)n" FT misc_feature 13459610..13460170 FT /note="match to EST AU137380 (NID:g10997919)" FT repeat_region 13460002..13460218 FT /rpt_family="CR1" FT repeat_region 13460235..13460498 FT /rpt_family="MER2_type" FT repeat_region 13460499..13461027 FT /rpt_family="ERVL" FT repeat_region 13461030..13461111 FT /rpt_family="MER2_type" FT repeat_region 13461786..13462004 FT /rpt_family="MaLR" FT repeat_region 13462021..13462139 FT /rpt_family="Alu" FT repeat_region 13462146..13462279 FT /rpt_family="MaLR" FT misc_feature 13462316..13462452 FT /note="match to EST BF063310 (NID:g10822220)" FT /note="match to EST BG428449 (NID:g13334955)" FT /note="match to EST BE166892 (NID:g8629613)" FT misc_feature 13462316..13462465 FT /note="match to EST BF886672 (NID:g12277768)" FT repeat_region 13462752..13463177 FT /rpt_family="CR1" FT repeat_region 13463452..13463634 FT /rpt_family="MIR" FT repeat_region 13463850..13464191 FT /rpt_family="MER1_type" FT repeat_region 13464242..13464343 FT /rpt_family="MIR" FT repeat_region 13465000..13465217 FT /rpt_family="MER1_type" FT repeat_region 13465457..13465477 FT /rpt_family="AT_rich" FT repeat_region 13465506..13468945 FT /rpt_family="L1" FT repeat_region 13467379..13467413 FT /rpt_family="(CA)n" FT repeat_region 13468939..13468967 FT /rpt_family="AT_rich" FT repeat_region 13468976..13470636 FT /rpt_family="L1" FT repeat_region 13471326..13471611 FT /rpt_family="Alu" FT repeat_region 13473127..13473286 FT /rpt_family="Alu" FT repeat_region 13473712..13473770 FT /rpt_family="L1" FT repeat_region 13473755..13473790 FT /rpt_family="AT_rich" FT repeat_region 13473771..13473935 FT /rpt_family="Alu" FT repeat_region 13473936..13473993 FT /rpt_family="L1" FT repeat_region 13473986..13474055 FT /rpt_family="AT_rich" FT repeat_region 13474129..13474156 FT /rpt_family="AT_rich" FT repeat_region 13474451..13474473 FT /rpt_family="(TAAA)n" FT repeat_region 13475263..13475297 FT /rpt_family="AT_rich" FT misc_feature 13475942..13475965 FT /note="match to EST BE166892 (NID:g8629613)" FT misc_feature 13475942..13476005 FT /note="match to EST BF063310 (NID:g10822220)" FT misc_feature 13475955..13476037 FT /note="match to EST BF886672 (NID:g12277768)" FT repeat_region 13479173..13479212 FT /rpt_family="AT_rich" FT misc_feature complement(13479952..13654498) FT /note="Quality: Phrap Quality >=40 99.8% of Sequence; FT Estimated Total Number of Errors is 0.2.; STS Content:; FT SHGC-82934 G49133; WI-9979 G11673; SHGC-51764 G34399; FT WI-5603 G02817; SHGC-36204 G30106; SHGC-51185 G34259; FT SHGC-84481 G51720; WI-5328 G04881" FT repeat_region 13652499..13652908 FT /rpt_family="L1" FT repeat_region 13652916..13653276 FT /rpt_family="MaLR" FT repeat_region 13653302..13653412 FT /rpt_family="L2" FT repeat_region 13653519..13654036 FT /rpt_family="MER1_type" FT repeat_region 13654167..13654290 FT /rpt_family="MIR" FT repeat_region 13654317..13654537 FT /rpt_family="MIR" FT repeat_region 13654864..13655038 FT /rpt_family="MIR" FT repeat_region 13655057..13655659 FT /rpt_family="ERV1" FT repeat_region 13655683..13655754 FT /rpt_family="ERVL" FT repeat_region 13655755..13655782 FT /rpt_family="AT_rich" FT repeat_region 13656528..13656604 FT /rpt_family="ERVL" FT repeat_region 13656634..13656927 FT /rpt_family="ERVL" FT repeat_region 13657819..13657911 FT /rpt_family="L1" FT repeat_region 13658679..13658705 FT /rpt_family="(CAAA)n" FT repeat_region 13658864..13658964 FT /rpt_family="MIR" FT repeat_region 13659512..13659855 FT /rpt_family="MER1_type?" FT repeat_region 13659856..13660120 FT /rpt_family="Alu" FT repeat_region 13660121..13660189 FT /rpt_family="MER1_type?" FT repeat_region 13660214..13660514 FT /rpt_family="Alu" FT repeat_region 13660620..13660728 FT /rpt_family="MIR" FT repeat_region 13660753..13660801 FT /rpt_family="(TG)n" FT repeat_region 13661487..13661535 FT /rpt_family="L2" FT repeat_region 13661973..13662062 FT /rpt_family="MIR" FT repeat_region 13662118..13662186 FT /rpt_family="L2" FT repeat_region 13662631..13662775 FT /rpt_family="MIR" FT repeat_region 13662849..13662876 FT /rpt_family="(TTA)n" FT repeat_region 13666100..13666879 FT /rpt_family="L1" FT repeat_region 13666971..13667334 FT /rpt_family="MaLR" FT repeat_region 13667342..13667982 FT /rpt_family="MaLR" FT repeat_region 13667989..13668501 FT /rpt_family="ERVK" FT repeat_region 13668570..13669407 FT /rpt_family="MaLR" FT repeat_region 13669420..13669781 FT /rpt_family="MaLR" FT repeat_region 13669874..13669901 FT /rpt_family="AT_rich" FT repeat_region 13669904..13670039 FT /rpt_family="MIR" FT repeat_region 13670583..13670724 FT /rpt_family="L2" FT repeat_region 13670883..13670905 FT /rpt_family="AT_rich" FT repeat_region 13670886..13671188 FT /rpt_family="Alu" FT repeat_region 13671258..13671283 FT /rpt_family="MIR" FT repeat_region 13671284..13671641 FT /rpt_family="MaLR" FT repeat_region 13671642..13671840 FT /rpt_family="MIR" FT repeat_region 13671952..13672264 FT /rpt_family="MER1_type" FT repeat_region 13672348..13672751 FT /rpt_family="MaLR" FT repeat_region 13672809..13672908 FT /rpt_family="MIR" FT repeat_region 13672949..13674206 FT /rpt_family="L1" FT repeat_region 13674631..13675140 FT /rpt_family="MaLR" FT repeat_region 13676600..13676716 FT /rpt_family="MIR" FT repeat_region 13676719..13676996 FT /rpt_family="MIR" FT repeat_region 13677452..13677808 FT /rpt_family="L1" FT repeat_region 13677806..13677865 FT /rpt_family="(TATATG)n" FT repeat_region 13678045..13678123 FT /rpt_family="(CATATA)n" FT repeat_region 13678125..13678304 FT /rpt_family="(CATA)n" FT repeat_region 13678317..13678410 FT /rpt_family="L1" FT repeat_region 13678456..13678572 FT /rpt_family="MIR" FT repeat_region 13679409..13679484 FT /rpt_family="MIR" FT repeat_region 13679485..13679865 FT /rpt_family="ERV1" FT repeat_region 13679866..13679946 FT /rpt_family="Mariner" FT repeat_region 13679947..13680121 FT /rpt_family="ERV1" FT repeat_region 13680146..13680371 FT /rpt_family="MER1_type" FT repeat_region 13680539..13680563 FT /rpt_family="AT_rich" FT repeat_region 13680809..13681206 FT /rpt_family="MaLR" FT repeat_region 13681554..13681770 FT /rpt_family="MIR" FT repeat_region 13682469..13682610 FT /rpt_family="L2" FT repeat_region 13682516..13682540 FT /rpt_family="AT_rich" FT repeat_region 13682983..13683039 FT /rpt_family="MER1_type" FT repeat_region 13684028..13684218 FT /rpt_family="L1" FT repeat_region 13684391..13684427 FT /rpt_family="AT_rich" FT repeat_region 13684421..13685433 FT /rpt_family="L1" FT repeat_region 13685434..13685789 FT /rpt_family="MaLR" FT repeat_region 13685790..13686098 FT /rpt_family="L1" FT repeat_region 13686216..13686510 FT /rpt_family="L1" FT repeat_region 13686511..13686807 FT /rpt_family="Alu" FT repeat_region 13686808..13689410 FT /rpt_family="L1" FT misc_feature 13688913..13907610 FT /note="Quality: Phrap Quality >=40 99.9% of Sequence; FT Estimated Total Number of Errors is 0.2.; STS Content:; FT SHGC-50623 G34419; WI-5204 G04794" FT repeat_region 14000496..14000588 FT /rpt_family="MIR" FT repeat_region 14001115..14001180 FT /rpt_family="CT-rich" FT repeat_region 14001584..14001806 FT /rpt_family="MIR" FT repeat_region 14001962..14002177 FT /rpt_family="CR1" FT repeat_region 14002197..14002511 FT /rpt_family="CR1" FT repeat_region 14003068..14003424 FT /rpt_family="MaLR" FT misc_feature 14003096..14003554 FT /note="similar to EST AU124571 (NID:g10949287)" FT misc_feature 14003133..14003554 FT /note="similar to EST AA053727 (NID:g1544786) zf53g08.r1" FT misc_feature 14003237..14003554 FT /note="similar to EST AW983880 (NID:g8175474)" FT misc_feature 14003296..14003554 FT /note="similar to EST BF790483 (NID:g12095531)" FT /note="similar to EST BE275415 (NID:g9150369)" FT /note="similar to EST BE276179 (NID:g9151142)" FT misc_feature 14003297..14003554 FT /note="similar to EST BE408789 (NID:g9345239)" FT misc_feature 14003299..14003554 FT /note="similar to EST AA365362 (NID:g2017818)" FT misc_feature 14003316..14003554 FT /note="similar to EST AV694818 (NID:g10296681)" FT misc_feature 14003322..14003554 FT /note="similar to EST AW855220 (NID:g7950913)" FT misc_feature 14003376..14003554 FT /note="similar to EST R77166 (NID:g851798) yi65b06.r1" FT repeat_region 14003577..14005080 FT /rpt_family="MaLR" FT misc_feature 14003610..14003888 FT /note="similar to EST BE276179 (NID:g9151142)" FT /note="similar to EST BE275415 (NID:g9150369)" FT /note="similar to EST BE408789 (NID:g9345239)" FT misc_feature 14003610..14003840 FT /note="similar to EST AA053727 (NID:g1544786) zf53g08.r1" FT misc_feature 14003610..14003706 FT /note="similar to EST AW855220 (NID:g7950913)" FT misc_feature 14003610..14003711 FT /note="similar to EST AV694818 (NID:g10296681)" FT misc_feature 14003610..14003881 FT /note="similar to EST R77166 (NID:g851798) yi65b06.r1" FT /note="similar to EST AU124571 (NID:g10949287)" FT /note="similar to EST BF790483 (NID:g12095531)" FT misc_feature 14003610..14003688 FT /note="similar to EST AA365362 (NID:g2017818)" FT misc_feature 14003610..14003886 FT /note="similar to EST AW983880 (NID:g8175474)" FT misc_feature 14003918..14004009 FT /note="similar to EST BF790483 (NID:g12095531)" FT misc_feature 14003918..14004033 FT /note="similar to EST AU124571 (NID:g10949287)" FT misc_feature 14003918..14003980 FT /note="similar to EST R77166 (NID:g851798) yi65b06.r1" FT misc_feature 14003934..14003977 FT /note="similar to EST BE276179 (NID:g9151142)" FT misc_feature 14003934..14004040 FT /note="similar to EST BE275415 (NID:g9150369)" FT misc_feature 14003934..14004069 FT /note="similar to EST BE408789 (NID:g9345239)" FT repeat_region 14005081..14005436 FT /rpt_family="MaLR" FT repeat_region 14005692..14005993 FT /rpt_family="Alu" FT repeat_region 14006936..14007878 FT /rpt_family="L1" FT repeat_region 14008009..14008113 FT /rpt_family="L2" FT repeat_region 14008162..14008245 FT /rpt_family="MIR" FT repeat_region 14008590..14008708 FT /rpt_family="MIR" FT repeat_region 14008725..14008928 FT /rpt_family="MIR" FT repeat_region 14009040..14009132 FT /rpt_family="L2" FT repeat_region 14009246..14009288 FT /rpt_family="MER2_type" FT repeat_region 14009590..14009658 FT /rpt_family="MIR" FT repeat_region 14009883..14009950 FT /rpt_family="MER2_type" FT repeat_region 14010020..14010121 FT /rpt_family="MaLR" FT repeat_region 14010213..14010430 FT /rpt_family="ERVL" FT repeat_region 14010739..14011052 FT /rpt_family="ERVL" FT repeat_region 14017164..14017390 FT /rpt_family="ERVL" FT repeat_region 14017879..14018057 FT /rpt_family="ERVL" FT repeat_region 14018133..14018210 FT /rpt_family="Mariner" FT repeat_region 14018216..14018360 FT /rpt_family="ERVL" FT repeat_region 14018548..14018629 FT /rpt_family="L2" FT repeat_region 14018684..14018820 FT /rpt_family="Alu" FT repeat_region 14018852..14018924 FT /rpt_family="MIR" FT repeat_region 14020128..14020166 FT /rpt_family="Mariner" FT repeat_region 14021382..14021424 FT /rpt_family="(T)n" FT repeat_region 14022838..14023058 FT /rpt_family="MaLR" FT repeat_region 14023104..14023521 FT /rpt_family="MaLR" FT repeat_region 14023757..14024146 FT /rpt_family="ERVL" FT repeat_region 14025172..14025237 FT /rpt_family="MIR" FT repeat_region 14025260..14025430 FT /rpt_family="MaLR" FT repeat_region 14025441..14025515 FT /rpt_family="(TC)n" FT repeat_region 14025518..14025718 FT /rpt_family="MaLR" FT repeat_region 14025811..14025926 FT /rpt_family="GA-rich" FT repeat_region 14027688..14027786 FT /rpt_family="MIR" FT repeat_region 14027881..14028065 FT /rpt_family="MER1_type" FT repeat_region 14028069..14028223 FT /rpt_family="MIR" FT repeat_region 14029494..14029545 FT /rpt_family="L2" FT repeat_region 14029991..14030061 FT /rpt_family="L2" FT repeat_region 14031024..14031153 FT /rpt_family="(TCTCTG)n" FT repeat_region 14031208..14031353 FT /rpt_family="CT-rich" FT repeat_region 14031564..14031713 FT /rpt_family="MIR" FT repeat_region 14032483..14032686 FT /rpt_family="MER1_type" FT misc_feature 14032871..14033139 FT /note="similar to EST AA376616 (NID:g2028936)" FT repeat_region 14034539..14034650 FT /rpt_family="MIR" FT repeat_region 14034655..14035127 FT /rpt_family="L1" FT repeat_region 14035125..14035279 FT /rpt_family="L1" FT repeat_region 14035280..14035563 FT /rpt_family="Alu" FT repeat_region 14035564..14036481 FT /rpt_family="L1" FT repeat_region 14037696..14038066 FT /rpt_family="L2" FT repeat_region 14038115..14038135 FT /rpt_family="AT_rich" FT repeat_region 14039224..14039684 FT /rpt_family="ERVL" FT repeat_region 14039841..14040031 FT /rpt_family="MIR" FT repeat_region 14040481..14040603 FT /rpt_family="MIR" FT repeat_region 14040808..14040926 FT /rpt_family="CT-rich" FT repeat_region 14041136..14041950 FT /rpt_family="ERV1" FT repeat_region 14041951..14042056 FT /rpt_family="L2" FT repeat_region 14042149..14042417 FT /rpt_family="L2" FT repeat_region 14043006..14043118 FT /rpt_family="MIR" FT repeat_region 14043948..14044100 FT /rpt_family="MIR" FT repeat_region 14045638..14045794 FT /rpt_family="MaLR" FT repeat_region 14045800..14046080 FT /rpt_family="L2" FT repeat_region 14046144..14046366 FT /rpt_family="MIR" FT repeat_region 14046773..14046799 FT /rpt_family="(CACCAT)n" FT repeat_region 14047282..14047796 FT /rpt_family="MaLR" FT repeat_region 14048340..14048442 FT /rpt_family="MIR" FT repeat_region 14048901..14049132 FT /rpt_family="CR1" FT repeat_region 14049443..14049822 FT /rpt_family="ERVL" FT repeat_region 14049823..14049868 FT /rpt_family="(TCTA)n" FT repeat_region 14049869..14049911 FT /rpt_family="ERVL" FT repeat_region 14051162..14051273 FT /rpt_family="L2" FT repeat_region 14052248..14052637 FT /rpt_family="ERVL" FT repeat_region 14054277..14054572 FT /rpt_family="L1" FT repeat_region 14055489..14055523 FT /rpt_family="(CA)n" FT repeat_region 14055651..14055789 FT /rpt_family="L1" FT repeat_region 14057428..14057966 FT /rpt_family="L1" FT repeat_region 14058314..14059049 FT /rpt_family="L1" FT repeat_region 14059442..14059478 FT /rpt_family="(CA)n" FT repeat_region 14059480..14059653 FT /rpt_family="L1" FT repeat_region 14059654..14059771 FT /rpt_family="Alu" FT repeat_region 14059772..14060099 FT /rpt_family="L1" FT repeat_region 14060738..14061033 FT /rpt_family="ERVL" FT repeat_region 14061074..14061117 FT /rpt_family="L2" FT repeat_region 14061396..14061812 FT /rpt_family="MaLR" FT repeat_region 14061939..14062214 FT /rpt_family="L2" FT repeat_region 14063377..14063402 FT /rpt_family="AT_rich" FT repeat_region 14063791..14064073 FT /rpt_family="MaLR" FT repeat_region 14064095..14064348 FT /rpt_family="L1" FT repeat_region 14064815..14064907 FT /rpt_family="L1" FT repeat_region 14064908..14065205 FT /rpt_family="Alu" FT repeat_region 14065206..14065508 FT /rpt_family="L1" FT repeat_region 14065574..14065808 FT /rpt_family="L1" FT repeat_region 14065809..14066095 FT /rpt_family="Alu" FT repeat_region 14066096..14066148 FT /rpt_family="L1" FT repeat_region 14066441..14066510 FT /rpt_family="(CATATA)n" FT repeat_region 14066690..14067010 FT /rpt_family="L1" FT repeat_region 14067283..14067643 FT /rpt_family="L2" FT repeat_region 14069771..14069819 FT /rpt_family="MIR" FT repeat_region 14070181..14070308 FT /rpt_family="MIR" FT repeat_region 14072454..14072806 FT /rpt_family="MaLR" FT repeat_region 14073800..14073879 FT /rpt_family="MIR" FT repeat_region 14073881..14074095 FT /rpt_family="ERV1" FT repeat_region 14074480..14074991 FT /rpt_family="ERV1" FT repeat_region 14075073..14075451 FT /rpt_family="MaLR" FT repeat_region 14075728..14076037 FT /rpt_family="Alu" FT repeat_region 14076696..14076762 FT /rpt_family="CT-rich" FT repeat_region 14077507..14077790 FT /rpt_family="Alu" FT repeat_region 14077947..14078076 FT /rpt_family="L2" FT repeat_region 14078536..14078698 FT /rpt_family="ERVL" FT repeat_region 14078952..14079061 FT /rpt_family="ERVL" FT repeat_region 14079199..14080224 FT /rpt_family="ERVL" FT repeat_region 14080392..14081192 FT /rpt_family="ERVL" FT repeat_region 14081192..14081991 FT /rpt_family="ERVL" FT repeat_region 14082056..14083485 FT /rpt_family="ERVL" FT repeat_region 14083489..14083782 FT /rpt_family="ERVL" FT repeat_region 14084140..14084253 FT /rpt_family="MIR" FT repeat_region 14084304..14084375 FT /rpt_family="MIR" FT repeat_region 14085233..14085464 FT /rpt_family="MIR" FT repeat_region 14085619..14085689 FT /rpt_family="(CA)n" FT repeat_region 14085757..14086071 FT /rpt_family="MaLR" FT repeat_region 14086099..14086567 FT /rpt_family="ERV1" FT repeat_region 14086583..14086639 FT /rpt_family="MaLR" FT repeat_region 14086675..14089053 FT /rpt_family="L1" FT repeat_region 14089080..14089476 FT /rpt_family="ERV1" FT repeat_region 14089523..14089639 FT /rpt_family="MaLR" FT repeat_region 14089886..14090006 FT /rpt_family="MIR" FT repeat_region 14090750..14090854 FT /rpt_family="AcHobo" FT repeat_region 14092018..14092056 FT /rpt_family="L2" FT repeat_region 14092090..14092259 FT /rpt_family="MIR" FT repeat_region 14092270..14092472 FT /rpt_family="MaLR" FT repeat_region 14092613..14092800 FT /rpt_family="MaLR" FT repeat_region 14092952..14093518 FT /rpt_family="MaLR" FT repeat_region 14093844..14093940 FT /rpt_family="MIR" FT repeat_region 14093941..14094331 FT /rpt_family="MaLR" FT repeat_region 14094332..14094399 FT /rpt_family="MIR" FT repeat_region 14095001..14095148 FT /rpt_family="MIR" FT repeat_region 14095166..14095381 FT /rpt_family="MIR" FT repeat_region 14095430..14095586 FT /rpt_family="MIR" FT repeat_region 14095728..14095837 FT /rpt_family="MIR" FT repeat_region 14096795..14096930 FT /rpt_family="MIR" FT repeat_region 14097229..14097388 FT /rpt_family="MIR" FT repeat_region 14097516..14097616 FT /rpt_family="MIR" FT repeat_region 14098014..14098079 FT /rpt_family="MIR" FT repeat_region 14098492..14098786 FT /rpt_family="ERVL" FT repeat_region 14099070..14099446 FT /rpt_family="MaLR" FT repeat_region 14099479..14099715 FT /rpt_family="L2" FT repeat_region 14099716..14099750 FT /rpt_family="(CA)n" FT repeat_region 14099751..14099864 FT /rpt_family="L2" FT repeat_region 14101125..14101226 FT /rpt_family="MIR" FT repeat_region 14101693..14101767 FT /rpt_family="ERVL" FT repeat_region 14101768..14101805 FT /rpt_family="(TG)n" FT repeat_region 14101806..14101838 FT /rpt_family="ERVL" FT repeat_region 14101886..14102063 FT /rpt_family="MaLR" FT repeat_region 14102229..14102647 FT /rpt_family="MaLR" FT repeat_region 14102954..14103028 FT /rpt_family="L2" FT repeat_region 14103075..14103196 FT /rpt_family="MER1_type" FT repeat_region 14103433..14103650 FT /rpt_family="MIR" FT repeat_region 14105257..14105484 FT /rpt_family="Alu" FT repeat_region 14106206..14106750 FT /rpt_family="ERVL" FT repeat_region 14108501..14109091 FT /rpt_family="L1" FT repeat_region 14109466..14109551 FT /rpt_family="MIR" FT repeat_region 14109725..14109839 FT /rpt_family="CR1" FT repeat_region 14110266..14110481 FT /rpt_family="MIR" FT repeat_region 14111350..14111515 FT /rpt_family="MIR" FT misc_feature 14112360..14113012 FT /note="similar to EST BF725290 (NID:g12041201) bx14c04.y1" FT repeat_region 14112878..14112939 FT /rpt_family="L2" FT repeat_region 14112995..14113086 FT /rpt_family="L2" FT repeat_region 14113099..14113205 FT /rpt_family="MER94" FT misc_feature 14113467..14113911 FT /note="similar to EST BF725289 (NID:g12041200) bx14c04.x1" FT repeat_region 14113573..14113611 FT /rpt_family="GA-rich" FT repeat_region 14114258..14114726 FT /rpt_family="L1" FT repeat_region 14114793..14114815 FT /rpt_family="(TAAA)n" FT repeat_region 14115144..14115180 FT /rpt_family="(TG)n" FT repeat_region 14115261..14115396 FT /rpt_family="(TATG)n" FT repeat_region 14115397..14115485 FT /rpt_family="(TG)n" FT repeat_region 14115508..14115628 FT /rpt_family="CR1" FT repeat_region 14115694..14116005 FT /rpt_family="L2" FT repeat_region 14116006..14116619 FT /rpt_family="MER2_type" FT repeat_region 14116620..14116888 FT /rpt_family="L2" FT repeat_region 14117006..14117108 FT /rpt_family="MIR" FT repeat_region 14117354..14117442 FT /rpt_family="MIR" FT repeat_region 14117445..14117733 FT /rpt_family="ERV1" FT repeat_region 14117745..14118026 FT /rpt_family="MER1_type" FT repeat_region 14118038..14118348 FT /rpt_family="ERV1" FT repeat_region 14118806..14118929 FT /rpt_family="MIR" FT repeat_region 14119394..14119529 FT /rpt_family="MIR" FT misc_feature 14119769..14120263 FT /note="similar to EST AA782810 (NID:g2842141) aj09b04.s1" FT repeat_region 14119912..14120158 FT /rpt_family="MIR" FT repeat_region 14120475..14120567 FT /rpt_family="MaLR" FT repeat_region 14121015..14121359 FT /rpt_family="MaLR" FT repeat_region 14122024..14122055 FT /rpt_family="AT_rich" FT repeat_region 14122097..14122289 FT /rpt_family="MIR" FT repeat_region 14122353..14122873 FT /rpt_family="MaLR" FT repeat_region 14123473..14123747 FT /rpt_family="MaLR" FT repeat_region 14123855..14124506 FT /rpt_family="L1" FT repeat_region 14124532..14124976 FT /rpt_family="L2" FT repeat_region 14125658..14125818 FT /rpt_family="MER1_type" FT misc_feature 14126002..14126312 FT /note="similar to EST AI075949 (NID:g3405127) oo14b09.x1" FT repeat_region 14126068..14126160 FT /rpt_family="MaLR" FT repeat_region 14127467..14127853 FT /rpt_family="MER1_type" FT repeat_region 14128608..14128718 FT /rpt_family="MIR" FT repeat_region 14129739..14129904 FT /rpt_family="L2" FT misc_feature 14130477..14130833 FT /note="similar to EST AA508129 (NID:g2244568) ng91h06.s1" FT repeat_region 14130750..14130933 FT /rpt_family="L2" FT repeat_region 14131039..14131102 FT /rpt_family="MIR" FT repeat_region 14131150..14131352 FT /rpt_family="L2" FT repeat_region 14132029..14132195 FT /rpt_family="MIR" FT misc_feature 14133143..14133685 FT /note="similar to EST AA393620 (NID:g2046653) zt70g07.r1" FT repeat_region 14133391..14133423 FT /rpt_family="AT_rich" FT repeat_region 14134074..14134197 FT /rpt_family="MIR" FT misc_feature 14134528..14134656 FT /note="similar to EST AA398699 (NID:g2051812) zt70g07.s1" FT repeat_region 14135397..14135476 FT /rpt_family="MIR" FT repeat_region 14135477..14135775 FT /rpt_family="Alu" FT repeat_region 14135776..14135933 FT /rpt_family="MIR" FT misc_feature 14136560..14136617 FT /note="similar to EST BF060793 (NID:g10819703)" FT repeat_region 14136619..14137120 FT /rpt_family="MaLR" FT repeat_region 14137682..14137864 FT /rpt_family="MIR" FT repeat_region 14137924..14138139 FT /rpt_family="MIR" FT repeat_region 14138265..14138296 FT /rpt_family="(CAAA)n" FT repeat_region 14138845..14139235 FT /rpt_family="MaLR" FT misc_feature 14140434..14140859 FT /note="similar to EST AI025851 (NID:g3241464) ow12c07.s1" FT misc_feature 14140471..14141242 FT /note="similar to EST BF215439 (NID:g11109025)" FT misc_feature 14141164..14141672 FT /note="similar to EST AI031657 (NID:g3249869) ow48e07.x1" FT misc_feature 14141232..14141672 FT /note="similar to EST AI125377 (NID:g3593891) qd88f09.x1" FT misc_feature 14141316..14141676 FT /note="similar to EST AI472966 (NID:g4326011) tj75h08.x1" FT repeat_region 14141897..14142004 FT /rpt_family="L2" FT repeat_region 14142020..14142605 FT /rpt_family="L1" FT repeat_region 14142606..14142637 FT /rpt_family="AT_rich" FT repeat_region 14143042..14143431 FT /rpt_family="ERVL" FT repeat_region 14143468..14143806 FT /rpt_family="ERV1" FT repeat_region 14143807..14144139 FT /rpt_family="Alu" FT misc_feature 14144023..14144120 FT /note="similar to EST BF060793 (NID:g10819703)" FT repeat_region 14144140..14144261 FT /rpt_family="ERV1" FT misc_feature 14144916..14145216 FT /note="similar to EST BF060793 (NID:g10819703)" FT misc_feature 14145817..14146166 FT /note="similar to EST AA854914 (NID:g2942452) aj78g11.s1" FT repeat_region 14147060..14147461 FT /rpt_family="ERVL" FT repeat_region 14147614..14147813 FT /rpt_family="MIR" FT repeat_region 14148063..14148170 FT /rpt_family="L2" FT repeat_region 14148752..14148797 FT /rpt_family="L2" FT repeat_region 14149086..14149120 FT /rpt_family="AT_rich" FT repeat_region 14149199..14149448 FT /rpt_family="MIR" FT repeat_region 14150605..14150687 FT /rpt_family="AcHobo" FT repeat_region 14151194..14151421 FT /rpt_family="L2" FT repeat_region 14152288..14152445 FT /rpt_family="MER1_type" FT repeat_region 14153267..14153663 FT /rpt_family="L2" FT repeat_region 14153695..14153772 FT /rpt_family="MIR" FT repeat_region 14153863..14153883 FT /rpt_family="(TG)n" FT repeat_region 14155104..14155265 FT /rpt_family="MER1_type" FT repeat_region 14155567..14155664 FT /rpt_family="MER1_type" FT repeat_region 14155728..14156099 FT /rpt_family="L2" FT misc_feature 14156100..14156191 FT /note="similar to EST AA508129 (NID:g2244568) ng91h06.s1" FT repeat_region 14156100..14156414 FT /rpt_family="Alu" FT repeat_region 14156415..14156651 FT /rpt_family="L2" FT repeat_region 14156778..14156805 FT /rpt_family="(CAGAGA)n" FT repeat_region 14156943..14157138 FT /rpt_family="MIR" FT repeat_region 14158229..14158373 FT /rpt_family="MIR" FT repeat_region 14158554..14158593 FT /rpt_family="(TTCA)n" FT repeat_region 14158645..14158847 FT /rpt_family="MIR" FT repeat_region 14159808..14159930 FT /rpt_family="MIR" FT repeat_region 14160044..14160364 FT /rpt_family="Alu" FT repeat_region 14160547..14160626 FT /rpt_family="L1" FT repeat_region 14160626..14161607 FT /rpt_family="L1" FT repeat_region 14161406..14161607 FT /rpt_family="L1" FT repeat_region 14161626..14162092 FT /rpt_family="L1" FT repeat_region 14162099..14162207 FT /rpt_family="MIR" FT repeat_region 14162243..14163221 FT /rpt_family="L1" FT repeat_region 14162761..14162780 FT /rpt_family="(T)n" FT repeat_region 14163217..14163359 FT /rpt_family="L1" FT repeat_region 14163422..14163772 FT /rpt_family="L1" FT repeat_region 14164184..14164310 FT /rpt_family="L2" FT repeat_region 14164468..14164623 FT /rpt_family="MIR" FT repeat_region 14165782..14165861 FT /rpt_family="L2" FT misc_feature 14166079..14166227 FT /note="similar to EST BG460647 (NID:g13749153)" FT repeat_region 14166396..14166708 FT /rpt_family="MER1_type" FT repeat_region 14167832..14167901 FT /rpt_family="(T)n" FT repeat_region 14167874..14168159 FT /rpt_family="Alu" FT repeat_region 14168650..14169118 FT /rpt_family="L1" FT repeat_region 14171217..14171353 FT /rpt_family="MIR" FT repeat_region 14171572..14172023 FT /rpt_family="ERV1" FT repeat_region 14172024..14172406 FT /rpt_family="ERV1" FT repeat_region 14172407..14172618 FT /rpt_family="ERV1" FT repeat_region 14172620..14173776 FT /rpt_family="ERV1" FT repeat_region 14173840..14174344 FT /rpt_family="ERV1" FT repeat_region 14174335..14174481 FT /rpt_family="ERV1" FT repeat_region 14176994..14177147 FT /rpt_family="ERV1" FT repeat_region 14177150..14177600 FT /rpt_family="ERV1" FT repeat_region 14177784..14177992 FT /rpt_family="MIR" FT misc_feature 14178275..14178612 FT /note="similar to EST BE049365 (NID:g8366420) xw85a01.x1" FT repeat_region 14178455..14178670 FT /rpt_family="MER1_type" FT repeat_region 14179548..14179759 FT /rpt_family="MER1_type" FT repeat_region 14182472..14182558 FT /rpt_family="MIR" FT repeat_region 14183404..14183462 FT /rpt_family="MIR" FT repeat_region 14183463..14183763 FT /rpt_family="Alu" FT repeat_region 14183764..14183890 FT /rpt_family="MIR" FT repeat_region 14184278..14184361 FT /rpt_family="L2" FT repeat_region 14184402..14184570 FT /rpt_family="MIR" FT repeat_region 14184819..14185374 FT /rpt_family="ERVL" FT repeat_region 14185291..14185339 FT /rpt_family="(CA)n" FT repeat_region 14185718..14185833 FT /rpt_family="MIR" FT repeat_region 14186219..14186287 FT /rpt_family="CT-rich" FT repeat_region 14186832..14186895 FT /rpt_family="(TA)n" FT repeat_region 14186931..14187223 FT /rpt_family="Alu" FT repeat_region 14188665..14188884 FT /rpt_family="ERVL" FT repeat_region 14188923..14189062 FT /rpt_family="MIR" FT repeat_region 14189432..14189525 FT /rpt_family="MIR" FT repeat_region 14190104..14190132 FT /rpt_family="(TTTTC)n" FT repeat_region 14190585..14190621 FT /rpt_family="(TG)n" FT repeat_region 14190641..14190939 FT /rpt_family="Alu" FT repeat_region 14191558..14191680 FT /rpt_family="MIR" FT repeat_region 14191924..14191969 FT /rpt_family="(AATAG)n" FT repeat_region 14192197..14192568 FT /rpt_family="MaLR" FT repeat_region 14192661..14193308 FT /rpt_family="L1" FT repeat_region 14193791..14194133 FT /rpt_family="Alu" FT repeat_region 14193795..14193817 FT /rpt_family="(TTTTA)n" FT repeat_region 14193977..14194003 FT /rpt_family="(TA)n" FT repeat_region 14195509..14195530 FT /rpt_family="(A)n" FT repeat_region 14195671..14195707 FT /rpt_family="(CA)n" FT repeat_region 14195743..14195777 FT /rpt_family="AT_rich" FT repeat_region 14196422..14196464 FT /rpt_family="(CA)n" FT repeat_region 14196540..14196752 FT /rpt_family="L2" FT repeat_region 14196560..14196617 FT /rpt_family="AT_rich" FT repeat_region 14196956..14196988 FT /rpt_family="(CAAA)n" FT repeat_region 14196991..14197111 FT /rpt_family="L2" FT repeat_region 14198142..14198167 FT /rpt_family="AT_rich" FT repeat_region 14198310..14198350 FT /rpt_family="(GA)n" FT repeat_region 14198461..14198500 FT /rpt_family="AT_rich" FT repeat_region 14198515..14198658 FT /rpt_family="MIR" FT repeat_region 14198922..14199025 FT /rpt_family="L2" FT repeat_region 14199121..14199211 FT /rpt_family="MER1_type?" FT repeat_region 14199479..14199765 FT /rpt_family="ERVL" FT repeat_region 14200168..14200407 FT /rpt_family="MaLR" FT repeat_region 14200410..14200684 FT /rpt_family="Alu" FT repeat_region 14200682..14200726 FT /rpt_family="(CAA)n" FT repeat_region 14200730..14200854 FT /rpt_family="MaLR" FT repeat_region 14200867..14201121 FT /rpt_family="ERVL" FT repeat_region 14202560..14202842 FT /rpt_family="L1" FT repeat_region 14203140..14203690 FT /rpt_family="L1" FT repeat_region 14203764..14204059 FT /rpt_family="Alu" FT repeat_region 14204300..14204320 FT /rpt_family="AT_rich" FT repeat_region 14204456..14204668 FT /rpt_family="MIR" FT repeat_region 14205878..14205990 FT /rpt_family="MIR" FT repeat_region 14206325..14206441 FT /rpt_family="(TTTC)n" FT repeat_region 14206412..14206721 FT /rpt_family="Alu" FT repeat_region 14206932..14207163 FT /rpt_family="L2" FT repeat_region 14208277..14208400 FT /rpt_family="L2" FT repeat_region 14208447..14208549 FT /rpt_family="MaLR" FT repeat_region 14208714..14208739 FT /rpt_family="AT_rich" FT repeat_region 14215295..14215390 FT /rpt_family="L1" FT repeat_region 14215442..14215801 FT /rpt_family="L1" FT repeat_region 14215840..14216590 FT /rpt_family="AcHobo" FT repeat_region 14216807..14216863 FT /rpt_family="(CA)n" FT repeat_region 14217322..14217978 FT /rpt_family="L2" FT repeat_region 14217976..14218210 FT /rpt_family="MIR" FT repeat_region 14218147..14218255 FT /rpt_family="L2" FT repeat_region 14218275..14218331 FT /rpt_family="MIR" FT repeat_region 14218331..14218358 FT /rpt_family="AT_rich" FT repeat_region 14218332..14218623 FT /rpt_family="Alu" FT repeat_region 14218624..14218768 FT /rpt_family="MIR" FT repeat_region 14219021..14219167 FT /rpt_family="MaLR" FT repeat_region 14219168..14219502 FT /rpt_family="ERV1" FT repeat_region 14219503..14219754 FT /rpt_family="MaLR" FT repeat_region 14219758..14219863 FT /rpt_family="(TTATA)n" FT repeat_region 14219895..14219971 FT /rpt_family="L2" FT repeat_region 14220164..14220241 FT /rpt_family="MIR" FT repeat_region 14220897..14220938 FT /rpt_family="L2" FT repeat_region 14220967..14220996 FT /rpt_family="(A)n" FT repeat_region 14221346..14221523 FT /rpt_family="MIR" FT repeat_region 14221647..14221855 FT /rpt_family="MER1_type" FT repeat_region 14221856..14222027 FT /rpt_family="Alu" FT repeat_region 14222007..14222026 FT /rpt_family="(TAAA)n" FT repeat_region 14222702..14223048 FT /rpt_family="MaLR" FT repeat_region 14223102..14223232 FT /rpt_family="L2" FT repeat_region 14223486..14223616 FT /rpt_family="L2" FT repeat_region 14223680..14223839 FT /rpt_family="ERVL" FT repeat_region 14223844..14224028 FT /rpt_family="MaLR" FT repeat_region 14224144..14224255 FT /rpt_family="(CATATA)n" FT repeat_region 14224329..14224382 FT /rpt_family="L2" FT repeat_region 14225570..14225770 FT /rpt_family="MaLR" FT repeat_region 14226223..14226292 FT /rpt_family="MIR" FT repeat_region 14226445..14226539 FT /rpt_family="(TA)n" FT repeat_region 14226537..14226782 FT /rpt_family="MIR" FT repeat_region 14226897..14227200 FT /rpt_family="Alu" FT repeat_region 14227170..14227208 FT /rpt_family="(A)n" FT repeat_region 14227779..14227801 FT /rpt_family="(TAAAA)n" FT repeat_region 14228076..14228197 FT /rpt_family="MIR" FT repeat_region 14228261..14228767 FT /rpt_family="ERVL" FT repeat_region 14228768..14229066 FT /rpt_family="Alu" FT repeat_region 14229053..14229092 FT /rpt_family="AT_rich" FT repeat_region 14230072..14230214 FT /rpt_family="MaLR" FT repeat_region 14230835..14231202 FT /rpt_family="MaLR" FT repeat_region 14231459..14231845 FT /rpt_family="MaLR" FT repeat_region 14232207..14232382 FT /rpt_family="MaLR" FT repeat_region 14232398..14232756 FT /rpt_family="MaLR" FT repeat_region 14232763..14232827 FT /rpt_family="MaLR" FT repeat_region 14232840..14232963 FT /rpt_family="MER1_type" FT repeat_region 14232964..14232991 FT /rpt_family="(T)n" FT repeat_region 14233273..14233371 FT /rpt_family="MER1_type" FT repeat_region 14233405..14233757 FT /rpt_family="MaLR" FT repeat_region 14234144..14234331 FT /rpt_family="MIR" FT repeat_region 14234725..14234888 FT /rpt_family="MIR" FT repeat_region 14235036..14235196 FT /rpt_family="MIR" FT repeat_region 14235354..14235711 FT /rpt_family="MaLR" FT repeat_region 14236314..14236367 FT /rpt_family="AT_rich" FT misc_feature 14236906..14237021 FT /note="similar to EST BE550427 (NID:g9792119)" FT misc_feature 14236921..14237021 FT /note="similar to EST AI655011 (NID:g4738990) wb66a06.x1" FT misc_feature 14237139..14237321 FT /note="similar to EST AI655011 (NID:g4738990) wb66a06.x1" FT /note="similar to EST BF059241 (NID:g10813137)" FT /note="similar to EST BE550427 (NID:g9792119)" FT repeat_region 14237473..14237752 FT /rpt_family="L1" FT repeat_region 14238225..14238252 FT /rpt_family="AT_rich" FT repeat_region 14238640..14238670 FT /rpt_family="(CA)n" FT repeat_region 14238681..14239414 FT /rpt_family="MER2_type" FT misc_feature 14239543..14240098 FT /note="similar to EST BF059580 (NID:g10813476)" FT misc_feature 14239768..14240098 FT /note="similar to EST BF059646 (NID:g10813542)" FT repeat_region 14239897..14240282 FT /rpt_family="L1" FT repeat_region 14240993..14241186 FT /rpt_family="L1" FT repeat_region 14241360..14241447 FT /rpt_family="AT_rich" FT repeat_region 14241780..14242690 FT /rpt_family="L1" FT repeat_region 14242062..14242088 FT /rpt_family="AT_rich" FT repeat_region 14242691..14242802 FT /rpt_family="L1" FT repeat_region 14242803..14242871 FT /rpt_family="L1" FT repeat_region 14243028..14243146 FT /rpt_family="L2" FT repeat_region 14243413..14243557 FT /rpt_family="ERVL" FT repeat_region 14243650..14243771 FT /rpt_family="MIR" FT misc_feature 14244270..14244435 FT /note="similar to EST BE550427 (NID:g9792119)" FT /note="similar to EST AI655011 (NID:g4738990) wb66a06.x1" FT misc_feature 14244270..14244434 FT /note="similar to EST BF059241 (NID:g10813137)" FT misc_feature 14244270..14244437 FT /note="similar to EST BG460647 (NID:g13749153)" FT repeat_region 14244842..14244880 FT /rpt_family="AT_rich" FT repeat_region 14245615..14245972 FT /rpt_family="MaLR" FT repeat_region 14246470..14246571 FT /rpt_family="L1" FT repeat_region 14246573..14246613 FT /rpt_family="(TG)n" FT repeat_region 14246794..14247410 FT /rpt_family="MaLR" FT repeat_region 14247000..14247023 FT /rpt_family="AT_rich" FT repeat_region 14247611..14247631 FT /rpt_family="AT_rich" FT repeat_region 14248729..14248975 FT /rpt_family="MIR" FT repeat_region 14249998..14250220 FT /rpt_family="MIR" FT repeat_region 14250539..14251014 FT /rpt_family="ERVL" FT repeat_region 14251097..14251136 FT /rpt_family="(TGAA)n" FT repeat_region 14251191..14251305 FT /rpt_family="MIR" FT repeat_region 14251317..14251395 FT /rpt_family="(TA)n" FT repeat_region 14251958..14252023 FT /rpt_family="MaLR" FT repeat_region 14252268..14252643 FT /rpt_family="L2" FT repeat_region 14253053..14253216 FT /rpt_family="MIR" FT repeat_region 14253229..14253358 FT /rpt_family="MIR" FT repeat_region 14253944..14254147 FT /rpt_family="MIR" FT repeat_region 14254125..14254161 FT /rpt_family="AT_rich" FT repeat_region 14254326..14254746 FT /rpt_family="MaLR" FT repeat_region 14254972..14255284 FT /rpt_family="L2" FT repeat_region 14255420..14255635 FT /rpt_family="MER1_type" FT repeat_region 14255757..14255777 FT /rpt_family="AT_rich" FT repeat_region 14255814..14256279 FT /rpt_family="ERVL" FT repeat_region 14257172..14257298 FT /rpt_family="MaLR" FT repeat_region 14257336..14257444 FT /rpt_family="L2" FT repeat_region 14257525..14258451 FT /rpt_family="L2" FT repeat_region 14258477..14258671 FT /rpt_family="L2" FT repeat_region 14259242..14259389 FT /rpt_family="MaLR" FT repeat_region 14259496..14259592 FT /rpt_family="MaLR" FT repeat_region 14259638..14259690 FT /rpt_family="T-rich" FT repeat_region 14260343..14260488 FT /rpt_family="MIR" FT repeat_region 14260554..14260574 FT /rpt_family="AT_rich" FT repeat_region 14260582..14260602 FT /rpt_family="MIR" FT repeat_region 14260603..14260806 FT /rpt_family="MER1_type" FT repeat_region 14260807..14260962 FT /rpt_family="MIR" FT repeat_region 14261806..14262670 FT /rpt_family="L2" FT repeat_region 14262671..14262691 FT /rpt_family="(T)n" FT repeat_region 14262974..14263623 FT /rpt_family="L2" FT repeat_region 14264116..14264598 FT /rpt_family="Mariner" FT repeat_region 14264598..14264711 FT /rpt_family="Mariner" FT repeat_region 14264717..14264787 FT /rpt_family="Mariner" FT repeat_region 14264887..14265004 FT /rpt_family="Alu" FT repeat_region 14265012..14265775 FT /rpt_family="Mariner" FT repeat_region 14265865..14266163 FT /rpt_family="Alu" FT repeat_region 14266538..14266880 FT /rpt_family="MaLR" FT repeat_region 14267041..14267291 FT /rpt_family="MIR" FT repeat_region 14268265..14268643 FT /rpt_family="L2" FT repeat_region 14268627..14268768 FT /rpt_family="L2" FT repeat_region 14268919..14268954 FT /rpt_family="MIR" FT repeat_region 14270262..14270315 FT /rpt_family="L2" FT repeat_region 14270709..14270773 FT /rpt_family="MIR" FT repeat_region 14271164..14271297 FT /rpt_family="MIR" FT repeat_region 14271453..14271554 FT /rpt_family="ERVL" FT repeat_region 14271557..14271760 FT /rpt_family="ERVL" FT repeat_region 14271893..14272035 FT /rpt_family="MIR" FT repeat_region 14272081..14272154 FT /rpt_family="(TA)n" FT repeat_region 14272208..14272286 FT /rpt_family="MIR" FT repeat_region 14273113..14273293 FT /rpt_family="MIR" FT repeat_region 14276789..14277223 FT /rpt_family="L1" FT repeat_region 14277244..14278126 FT /rpt_family="L1" FT repeat_region 14278119..14278158 FT /rpt_family="(TA)n" FT repeat_region 14278174..14278459 FT /rpt_family="Alu" FT misc_feature 14278376..14472305 FT /note="Quality: Phrap Quality >=40 99.9% of Sequence; FT Estimated Total Number of Errors is 0.; STS Content:; FT SHGC-24209 G33317; HUM4STS292 L00781; SHGC-50583 G33648" FT repeat_region 14470556..14470693 FT /rpt_family="MIR" FT repeat_region 14470750..14471155 FT /rpt_family="MaLR" FT repeat_region 14471485..14471717 FT /rpt_family="MIR" FT misc_feature 14472262..14473035 FT /note="similar to EST BE896206 (NID:g10360376)" FT repeat_region 14472693..14472818 FT /rpt_family="MIR" FT repeat_region 14472805..14472828 FT /rpt_family="(TTA)n" FT repeat_region 14476166..14476274 FT /rpt_family="MIR" FT repeat_region 14476491..14476948 FT /rpt_family="MaLR" FT repeat_region 14477470..14477505 FT /rpt_family="AT_rich" FT repeat_region 14477511..14477654 FT /rpt_family="Alu" FT repeat_region 14477694..14477835 FT /rpt_family="MIR" FT repeat_region 14477852..14478572 FT /rpt_family="L2" FT repeat_region 14479183..14479246 FT /rpt_family="L2" FT repeat_region 14479433..14479525 FT /rpt_family="AT_rich" FT repeat_region 14479674..14479855 FT /rpt_family="L1" FT repeat_region 14479848..14482374 FT /rpt_family="L1" FT repeat_region 14486589..14488451 FT /rpt_family="L1" FT repeat_region 14488504..14488807 FT /rpt_family="Alu" FT repeat_region 14488780..14488807 FT /rpt_family="(A)n" FT repeat_region 14492313..14492336 FT /rpt_family="AT_rich" FT repeat_region 14492810..14493123 FT /rpt_family="Alu" FT repeat_region 14493208..14493480 FT /rpt_family="(TA)n" FT repeat_region 14493691..14493718 FT /rpt_family="AT_rich" FT repeat_region 14494079..14494160 FT /rpt_family="AT_rich" FT repeat_region 14494272..14494634 FT /rpt_family="L1" FT repeat_region 14494994..14495018 FT /rpt_family="ERVL" FT repeat_region 14495019..14495379 FT /rpt_family="MaLR" FT repeat_region 14495380..14495619 FT /rpt_family="ERVL" FT repeat_region 14495749..14496101 FT /rpt_family="L1" FT repeat_region 14496655..14496756 FT /rpt_family="MaLR" FT repeat_region 14496953..14497662 FT /rpt_family="L2" FT repeat_region 14497770..14498048 FT /rpt_family="L2" FT repeat_region 14499071..14499348 FT /rpt_family="L1" FT repeat_region 14499203..14499241 FT /rpt_family="(CA)n" FT repeat_region 14499413..14500035 FT /rpt_family="L1" FT repeat_region 14500337..14500428 FT /rpt_family="MIR" FT repeat_region 14500730..14500951 FT /rpt_family="MER1_type" FT repeat_region 14500993..14501046 FT /rpt_family="MIR" FT repeat_region 14501617..14502707 FT /rpt_family="MER2_type" FT repeat_region 14502715..14502884 FT /rpt_family="L2" FT repeat_region 14503284..14505330 FT /rpt_family="L1" FT repeat_region 14504404..14504462 FT /rpt_family="AT_rich" FT repeat_region 14504780..14504804 FT /rpt_family="AT_rich" FT repeat_region 14505330..14505466 FT /rpt_family="L1" FT repeat_region 14505471..14507497 FT /rpt_family="L1" FT repeat_region 14505787..14505817 FT /rpt_family="(T)n" FT misc_feature 14507475..14508104 FT /note="similar to EST BE879833 (NID:g10328609)" FT misc_feature 14507489..14508010 FT /note="similar to EST BG876680 (NID:g14253770)" FT misc_feature 14507489..14507900 FT /note="similar to EST BE878375 (NID:g10327151)" FT misc_feature 14507499..14508104 FT /note="similar to EST BG611653 (NID:g13663024)" FT misc_feature 14507501..14507977 FT /note="similar to EST BG613776 (NID:g13665147)" FT misc_feature 14507540..14508104 FT /note="similar to EST AI064699 (NID:g6358971)" FT misc_feature 14507549..14508104 FT /note="similar to EST BE877484 (NID:g10326260)" FT misc_feature 14507577..14508071 FT /note="similar to EST BG877588 (NID:g14254678)" FT misc_feature 14507794..14508104 FT /note="similar to EST BF378275 (NID:g11367452)" FT repeat_region 14508103..14509490 FT /rpt_family="L1" FT repeat_region 14509493..14509614 FT /rpt_family="Alu" FT repeat_region 14509998..14510106 FT /rpt_family="AcHobo" FT repeat_region 14510840..14510891 FT /rpt_family="AT_rich" FT repeat_region 14511109..14511210 FT /rpt_family="MIR" FT repeat_region 14511626..14511671 FT /rpt_family="L2" FT repeat_region 14512516..14512671 FT /rpt_family="Alu" FT repeat_region 14513044..14513067 FT /rpt_family="(T)n" FT repeat_region 14513369..14513464 FT /rpt_family="L2" FT repeat_region 14513520..14513558 FT /rpt_family="L2" FT repeat_region 14513872..14515157 FT /rpt_family="Mariner" FT repeat_region 14514422..14514446 FT /rpt_family="(A)n" FT repeat_region 14515196..14515347 FT /rpt_family="Alu" FT repeat_region 14515621..14515672 FT /rpt_family="L2" FT repeat_region 14516895..14517065 FT /rpt_family="MIR" FT repeat_region 14517813..14519332 FT /rpt_family="L1" FT repeat_region 14519415..14519542 FT /rpt_family="L1" FT repeat_region 14519777..14519797 FT /rpt_family="AT_rich" FT repeat_region 14523114..14523168 FT /rpt_family="(TCTA)n" FT repeat_region 14523230..14523443 FT /rpt_family="MIR" FT repeat_region 14523446..14523553 FT /rpt_family="MIR" FT repeat_region 14523984..14524120 FT /rpt_family="(TA)n" FT repeat_region 14524112..14524226 FT /rpt_family="MIR" FT repeat_region 14524228..14524750 FT /rpt_family="MaLR" FT repeat_region 14524810..14524891 FT /rpt_family="L2" FT repeat_region 14524933..14525010 FT /rpt_family="T-rich" FT repeat_region 14526302..14526577 FT /rpt_family="MER2_type" FT repeat_region 14526589..14526679 FT /rpt_family="MIR" FT repeat_region 14527341..14527512 FT /rpt_family="L2" FT repeat_region 14527605..14529201 FT /rpt_family="L1" FT repeat_region 14529194..14529215 FT /rpt_family="(CAAAT)n" FT repeat_region 14529581..14529658 FT /rpt_family="Ricksha" FT repeat_region 14529662..14530119 FT /rpt_family="Ricksha" FT repeat_region 14530123..14530967 FT /rpt_family="Ricksha" FT repeat_region 14530970..14531090 FT /rpt_family="Ricksha" FT repeat_region 14531362..14531594 FT /rpt_family="L2" FT repeat_region 14531877..14531983 FT /rpt_family="MIR" FT repeat_region 14532354..14532662 FT /rpt_family="Alu" FT repeat_region 14532638..14532661 FT /rpt_family="(GAAAA)n" FT repeat_region 14533756..14533807 FT /rpt_family="CT-rich" FT repeat_region 14533802..14533863 FT /rpt_family="L2" FT repeat_region 14534220..14534406 FT /rpt_family="L2" FT repeat_region 14534690..14534793 FT /rpt_family="L2" FT repeat_region 14535133..14536026 FT /rpt_family="ERVL" FT repeat_region 14536057..14536604 FT /rpt_family="ERVL" FT repeat_region 14536876..14536912 FT /rpt_family="AT_rich" FT repeat_region 14536941..14537131 FT /rpt_family="ERVL" FT repeat_region 14537564..14537819 FT /rpt_family="MaLR" FT repeat_region 14537820..14538142 FT /rpt_family="Alu" FT repeat_region 14537936..14537972 FT /rpt_family="(A)n" FT repeat_region 14538143..14538178 FT /rpt_family="MaLR" FT repeat_region 14538192..14538307 FT /rpt_family="MIR" FT repeat_region 14538405..14538514 FT /rpt_family="CR1" FT repeat_region 14538960..14539116 FT /rpt_family="MIR" FT repeat_region 14539464..14539571 FT /rpt_family="MIR" FT repeat_region 14539615..14539742 FT /rpt_family="MER1_type" FT repeat_region 14539822..14540162 FT /rpt_family="MaLR" FT repeat_region 14540615..14540656 FT /rpt_family="AT_rich" FT repeat_region 14540739..14540759 FT /rpt_family="AT_rich" FT repeat_region 14540841..14540985 FT /rpt_family="MaLR" FT repeat_region 14546187..14546374 FT /rpt_family="L1" FT repeat_region 14546393..14546869 FT /rpt_family="L1" FT repeat_region 14546884..14546915 FT /rpt_family="(TG)n" FT repeat_region 14546913..14546969 FT /rpt_family="MaLR" FT repeat_region 14547225..14547306 FT /rpt_family="L2" FT repeat_region 14547466..14547496 FT /rpt_family="(CA)n" FT repeat_region 14547561..14547671 FT /rpt_family="Alu" FT repeat_region 14547685..14548409 FT /rpt_family="L1" FT repeat_region 14548404..14548451 FT /rpt_family="AT_rich" FT repeat_region 14549052..14549383 FT /rpt_family="L2" FT repeat_region 14549393..14549467 FT /rpt_family="MIR" FT repeat_region 14549586..14549691 FT /rpt_family="L1" FT repeat_region 14549707..14550737 FT /rpt_family="L1" FT repeat_region 14550748..14551519 FT /rpt_family="L1" FT repeat_region 14551556..14551655 FT /rpt_family="L2" FT repeat_region 14551662..14551856 FT /rpt_family="MIR" FT repeat_region 14552529..14552651 FT /rpt_family="MIR" FT repeat_region 14554308..14554402 FT /rpt_family="MIR" FT repeat_region 14554403..14554700 FT /rpt_family="Alu" FT repeat_region 14554701..14554823 FT /rpt_family="MIR" FT repeat_region 14555124..14555209 FT /rpt_family="L2" FT repeat_region 14555251..14555371 FT /rpt_family="L2" FT repeat_region 14555451..14555633 FT /rpt_family="MIR" FT repeat_region 14555992..14556291 FT /rpt_family="Alu" FT repeat_region 14556434..14556598 FT /rpt_family="ERVL" FT repeat_region 14556599..14556793 FT /rpt_family="L1" FT repeat_region 14556794..14557095 FT /rpt_family="ERVL" FT repeat_region 14558424..14558540 FT /rpt_family="L2" FT repeat_region 14558530..14558561 FT /rpt_family="(TGAA)n" FT repeat_region 14558801..14558844 FT /rpt_family="(TG)n" FT repeat_region 14559286..14560130 FT /rpt_family="L1" FT repeat_region 14560301..14560321 FT /rpt_family="AT_rich" FT repeat_region 14560781..14560909 FT /rpt_family="MIR" FT repeat_region 14561590..14561610 FT /rpt_family="AT_rich" FT repeat_region 14562470..14562579 FT /rpt_family="GA-rich" FT repeat_region 14562635..14562779 FT /rpt_family="MIR" FT repeat_region 14562925..14563221 FT /rpt_family="Alu" FT repeat_region 14563425..14563559 FT /rpt_family="L2" FT repeat_region 14563595..14563700 FT /rpt_family="MaLR" FT repeat_region 14563716..14563752 FT /rpt_family="(CA)n" FT repeat_region 14563780..14564038 FT /rpt_family="MaLR" FT repeat_region 14564140..14564428 FT /rpt_family="L2" FT repeat_region 14565008..14565090 FT /rpt_family="MIR" FT repeat_region 14566978..14567107 FT /rpt_family="L1" FT repeat_region 14567170..14567532 FT /rpt_family="MaLR" FT repeat_region 14567533..14567606 FT /rpt_family="CT-rich" FT repeat_region 14567632..14567722 FT /rpt_family="L1" FT repeat_region 14567864..14568009 FT /rpt_family="MER2_type" FT repeat_region 14568076..14568198 FT /rpt_family="MaLR" FT repeat_region 14568359..14568534 FT /rpt_family="MaLR" FT repeat_region 14568479..14568503 FT /rpt_family="AT_rich" FT repeat_region 14568591..14568816 FT /rpt_family="MIR" FT repeat_region 14568943..14569056 FT /rpt_family="L1" FT repeat_region 14570130..14570171 FT /rpt_family="Alu" FT repeat_region 14570392..14570478 FT /rpt_family="L2" FT repeat_region 14570566..14570667 FT /rpt_family="(TAGA)n" FT repeat_region 14570982..14571121 FT /rpt_family="MaLR" FT repeat_region 14571122..14571459 FT /rpt_family="L1" FT repeat_region 14571460..14571530 FT /rpt_family="MaLR" FT repeat_region 14571533..14571621 FT /rpt_family="L2" FT repeat_region 14572552..14572691 FT /rpt_family="L1" FT repeat_region 14572692..14573109 FT /rpt_family="L1" FT repeat_region 14572777..14572798 FT /rpt_family="(A)n" FT repeat_region 14574437..14574523 FT /rpt_family="MaLR" FT repeat_region 14574561..14574674 FT /rpt_family="ERVL" FT repeat_region 14574770..14574793 FT /rpt_family="MaLR" FT repeat_region 14574794..14575207 FT /rpt_family="MaLR" FT repeat_region 14575208..14575451 FT /rpt_family="MaLR" FT repeat_region 14575539..14575788 FT /rpt_family="MIR" FT repeat_region 14576601..14576915 FT /rpt_family="Alu" FT repeat_region 14577261..14577303 FT /rpt_family="L2" FT repeat_region 14577601..14577671 FT /rpt_family="L2" FT repeat_region 14577977..14578015 FT /rpt_family="(TG)n" FT repeat_region 14578932..14579157 FT /rpt_family="MIR" FT repeat_region 14579307..14579629 FT /rpt_family="L1" FT repeat_region 14579735..14579785 FT /rpt_family="MIR" FT repeat_region 14580285..14580343 FT /rpt_family="L2" FT repeat_region 14580935..14581506 FT /rpt_family="ERVL" FT repeat_region 14581833..14581853 FT /rpt_family="(A)n" FT repeat_region 14582445..14582558 FT /rpt_family="L2" FT repeat_region 14582672..14582796 FT /rpt_family="L2" FT repeat_region 14584257..14584345 FT /rpt_family="L2" FT repeat_region 14585227..14585353 FT /rpt_family="L2" FT repeat_region 14585529..14585865 FT /rpt_family="CR1" FT repeat_region 14585986..14586156 FT /rpt_family="MIR" FT repeat_region 14586386..14586507 FT /rpt_family="MIR" FT repeat_region 14586516..14586851 FT /rpt_family="MaLR" FT repeat_region 14587267..14587854 FT /rpt_family="L1" FT repeat_region 14587843..14587896 FT /rpt_family="A-rich" FT repeat_region 14589062..14589319 FT /rpt_family="L1" FT repeat_region 14589362..14589488 FT /rpt_family="L1" FT repeat_region 14589574..14589673 FT /rpt_family="T-rich" FT repeat_region 14589884..14590048 FT /rpt_family="L1" FT repeat_region 14589954..14589985 FT /rpt_family="AT_rich" FT repeat_region 14590049..14590070 FT /rpt_family="(T)n" FT repeat_region 14590352..14590410 FT /rpt_family="L1" FT repeat_region 14590676..14590769 FT /rpt_family="L1" FT repeat_region 14590862..14591284 FT /rpt_family="L1" FT repeat_region 14591285..14591519 FT /rpt_family="Alu" FT repeat_region 14591441..14591470 FT /rpt_family="(T)n" FT repeat_region 14591520..14591807 FT /rpt_family="L1" FT repeat_region 14591816..14592012 FT /rpt_family="L1" FT repeat_region 14592125..14592351 FT /rpt_family="L1" FT repeat_region 14592439..14593309 FT /rpt_family="L1" FT repeat_region 14593304..14593323 FT /rpt_family="(TTTA)n" FT repeat_region 14593357..14593637 FT /rpt_family="Alu" FT repeat_region 14593639..14594137 FT /rpt_family="L1" FT repeat_region 14594148..14594645 FT /rpt_family="L1" FT repeat_region 14594685..14594923 FT /rpt_family="L2" FT repeat_region 14595166..14595279 FT /rpt_family="L2" FT misc_feature 14597317..14597707 FT /note="similar to EST BE093374 (NID:g8483826)" FT repeat_region 14598606..14598725 FT /rpt_family="MIR" FT repeat_region 14599296..14599361 FT /rpt_family="(TA)n" FT repeat_region 14599439..14599637 FT /rpt_family="MIR" FT repeat_region 14599821..14600285 FT /rpt_family="L1" FT repeat_region 14599864..14599884 FT /rpt_family="AT_rich" FT repeat_region 14600196..14600219 FT /rpt_family="AT_rich" FT repeat_region 14600313..14600661 FT /rpt_family="MER2_type" FT repeat_region 14600662..14601076 FT /rpt_family="MaLR" FT repeat_region 14601110..14601577 FT /rpt_family="L1" FT repeat_region 14601892..14601933 FT /rpt_family="(ATG)n" FT repeat_region 14601922..14602132 FT /rpt_family="MIR" FT repeat_region 14719006..14719143 FT /rpt_family="L2" FT repeat_region 14719316..14719623 FT /rpt_family="Alu" FT repeat_region 14719894..14720284 FT /rpt_family="L2" FT repeat_region 14726515..14726869 FT /rpt_family="L2" FT repeat_region 14727218..14727566 FT /rpt_family="MaLR" FT repeat_region 14728152..14728347 FT /rpt_family="L2" FT repeat_region 14729035..14729976 FT /rpt_family="L1" FT repeat_region 14729977..14729998 FT /rpt_family="AT_rich" FT repeat_region 14730165..14730254 FT /rpt_family="L1" FT repeat_region 14730255..14730502 FT /rpt_family="L1" FT repeat_region 14730503..14730537 FT /rpt_family="AT_rich" FT repeat_region 14730565..14730663 FT /rpt_family="MIR" FT repeat_region 14730777..14730801 FT /rpt_family="(TG)n" FT repeat_region 14730885..14731046 FT /rpt_family="MIR" FT repeat_region 14732103..14732123 FT /rpt_family="AT_rich" FT repeat_region 14732687..14732848 FT /rpt_family="MIR" FT repeat_region 14732888..14732933 FT /rpt_family="L2" FT repeat_region 14732939..14733215 FT /rpt_family="Alu" FT repeat_region 14733340..14733951 FT /rpt_family="L1" FT repeat_region 14733952..14734301 FT /rpt_family="L2" FT repeat_region 14734304..14734426 FT /rpt_family="L2" FT repeat_region 14734495..14734672 FT /rpt_family="L2" FT repeat_region 14734673..14735011 FT /rpt_family="MaLR" FT repeat_region 14736588..14736943 FT /rpt_family="MaLR" FT repeat_region 14736944..14737380 FT /rpt_family="L2" FT repeat_region 14737514..14737547 FT /rpt_family="MaLR" FT repeat_region 14737548..14737608 FT /rpt_family="L2" FT repeat_region 14737615..14738166 FT /rpt_family="L2" FT repeat_region 14738168..14738991 FT /rpt_family="L1" FT repeat_region 14738992..14739157 FT /rpt_family="Alu" FT repeat_region 14739158..14739242 FT /rpt_family="L1" FT repeat_region 14739243..14739308 FT /rpt_family="L1" FT repeat_region 14739521..14739612 FT /rpt_family="L2" FT repeat_region 14739598..14740283 FT /rpt_family="L2" FT repeat_region 14740284..14740604 FT /rpt_family="MER2_type" FT repeat_region 14740605..14740823 FT /rpt_family="L2" FT repeat_region 14740824..14741235 FT /rpt_family="MaLR" FT repeat_region 14741236..14741680 FT /rpt_family="L2" FT repeat_region 14741686..14741887 FT /rpt_family="L2" FT repeat_region 14741914..14742020 FT /rpt_family="MIR" FT repeat_region 14742313..14742619 FT /rpt_family="Alu" FT repeat_region 14742812..14743146 FT /rpt_family="MaLR" FT repeat_region 14743694..14743777 FT /rpt_family="L2" FT repeat_region 14743821..14743880 FT /rpt_family="L2" FT repeat_region 14744048..14744202 FT /rpt_family="MIR" FT repeat_region 14744476..14744608 FT /rpt_family="L2" FT repeat_region 14744671..14745122 FT /rpt_family="MaLR" FT repeat_region 14746905..14746962 FT /rpt_family="AT_rich" FT repeat_region 14747153..14747733 FT /rpt_family="L1" FT repeat_region 14748028..14748431 FT /rpt_family="ERVL" FT repeat_region 14748640..14748676 FT /rpt_family="(TATATG)n" FT repeat_region 14749745..14750001 FT /rpt_family="MIR" FT repeat_region 14750168..14750387 FT /rpt_family="MIR" FT repeat_region 14750582..14751027 FT /rpt_family="MaLR" FT repeat_region 14751290..14751427 FT /rpt_family="MIR" FT repeat_region 14751778..14751978 FT /rpt_family="MIR" FT repeat_region 14752176..14752582 FT /rpt_family="MaLR" FT repeat_region 14752701..14752860 FT /rpt_family="MER1_type" FT repeat_region 14753191..14753559 FT /rpt_family="MaLR" FT repeat_region 14755100..14755457 FT /rpt_family="MaLR" FT repeat_region 14755704..14755949 FT /rpt_family="L2" FT repeat_region 14755999..14756200 FT /rpt_family="MaLR" FT repeat_region 14756261..14756307 FT /rpt_family="(CA)n" FT repeat_region 14762813..14762891 FT /rpt_family="L2" FT repeat_region 14762949..14763058 FT /rpt_family="L2" FT repeat_region 14763241..14763263 FT /rpt_family="AT_rich" FT repeat_region 14763344..14763483 FT /rpt_family="MIR" FT repeat_region 14764581..14764701 FT /rpt_family="MIR" FT repeat_region 14765260..14765669 FT /rpt_family="MER1_type" FT repeat_region 14765698..14765785 FT /rpt_family="MER1_type" FT repeat_region 14765857..14766185 FT /rpt_family="MaLR" FT repeat_region 14766436..14766946 FT /rpt_family="MaLR" FT repeat_region 14767722..14768010 FT /rpt_family="Alu" FT repeat_region 14768292..14768690 FT /rpt_family="MaLR" FT repeat_region 14768994..14769169 FT /rpt_family="MIR" FT repeat_region 14769785..14770024 FT /rpt_family="ERVL" FT repeat_region 14770035..14770274 FT /rpt_family="MaLR" FT repeat_region 14770293..14770497 FT /rpt_family="ERVL" FT repeat_region 14770612..14770708 FT /rpt_family="(CA)n" FT repeat_region 14771161..14771222 FT /rpt_family="(TGGA)n" FT repeat_region 14772071..14772221 FT /rpt_family="MIR" FT repeat_region 14772261..14772477 FT /rpt_family="MIR" FT repeat_region 14772789..14773112 FT /rpt_family="MaLR" FT repeat_region 14773670..14773883 FT /rpt_family="MIR" FT repeat_region 14774582..14774828 FT /rpt_family="MaLR" FT repeat_region 14774874..14774929 FT /rpt_family="AT_rich" FT repeat_region 14774931..14775057 FT /rpt_family="L1" FT repeat_region 14775055..14776836 FT /rpt_family="L1" FT repeat_region 14776842..14777013 FT /rpt_family="MaLR" FT repeat_region 14778448..14778537 FT /rpt_family="AcHobo" FT repeat_region 14778717..14778749 FT /rpt_family="ERVL" FT repeat_region 14778750..14779108 FT /rpt_family="MaLR" FT repeat_region 14779109..14779522 FT /rpt_family="ERVL" FT repeat_region 14779945..14780063 FT /rpt_family="MIR" FT repeat_region 14780121..14780189 FT /rpt_family="MER1_type" FT repeat_region 14780189..14780280 FT /rpt_family="MIR" FT repeat_region 14780545..14780713 FT /rpt_family="MIR" FT repeat_region 14782086..14782489 FT /rpt_family="MaLR" FT repeat_region 14782713..14782844 FT /rpt_family="MIR" FT repeat_region 14783217..14783433 FT /rpt_family="MER121" FT repeat_region 14783785..14783808 FT /rpt_family="(GGAA)n" FT repeat_region 14783834..14783941 FT /rpt_family="(TAGA)n" FT repeat_region 14783953..14784000 FT /rpt_family="(TAGA)n" FT repeat_region 14784076..14784122 FT /rpt_family="(TGGA)n" FT repeat_region 14784338..14784433 FT /rpt_family="MIR" FT repeat_region 14784554..14784741 FT /rpt_family="MIR" FT repeat_region 14785189..14785276 FT /rpt_family="MIR" FT repeat_region 14785328..14785500 FT /rpt_family="MIR" FT repeat_region 14786552..14786663 FT /rpt_family="L2" FT repeat_region 14786719..14787462 FT /rpt_family="L1" FT repeat_region 14788385..14788704 FT /rpt_family="(TATAA)n" FT repeat_region 14788709..14788749 FT /rpt_family="MIR" FT repeat_region 14793855..14793896 FT /rpt_family="MaLR" FT repeat_region 14793916..14798159 FT /rpt_family="L1" FT repeat_region 14798160..14798391 FT /rpt_family="L1" FT repeat_region 14798392..14798412 FT /rpt_family="(TA)n" FT repeat_region 14798413..14798771 FT /rpt_family="L1" FT repeat_region 14798774..14799136 FT /rpt_family="MaLR" FT repeat_region 14799168..14799615 FT /rpt_family="MaLR" FT repeat_region 14799618..14799967 FT /rpt_family="MaLR" FT repeat_region 14799968..14801027 FT /rpt_family="MaLR" FT repeat_region 14801028..14801317 FT /rpt_family="Alu" FT repeat_region 14801318..14801688 FT /rpt_family="MaLR" FT repeat_region 14801690..14802070 FT /rpt_family="MaLR" FT repeat_region 14802079..14802264 FT /rpt_family="L1" FT repeat_region 14802265..14802538 FT /rpt_family="Alu" FT repeat_region 14802539..14803553 FT /rpt_family="L1" FT repeat_region 14803754..14803796 FT /rpt_family="L1" FT repeat_region 14804052..14804249 FT /rpt_family="MIR" FT repeat_region 14804834..14804949 FT /rpt_family="L1" FT repeat_region 14804950..14805278 FT /rpt_family="MER2_type" FT repeat_region 14805279..14805418 FT /rpt_family="L1" FT repeat_region 14805662..14805854 FT /rpt_family="L2" FT repeat_region 14806705..14806903 FT /rpt_family="MIR" FT repeat_region 14807925..14808254 FT /rpt_family="MER2_type" FT repeat_region 14808351..14808433 FT /rpt_family="(TATATG)n" FT repeat_region 14808537..14808613 FT /rpt_family="AcHobo" FT repeat_region 14809131..14809159 FT /rpt_family="AT_rich" FT repeat_region 14809288..14809411 FT /rpt_family="MER1_type" FT repeat_region 14809412..14809775 FT /rpt_family="MaLR" FT repeat_region 14809776..14809852 FT /rpt_family="MER1_type" FT repeat_region 14809860..14810042 FT /rpt_family="MIR" FT repeat_region 14810313..14810739 FT /rpt_family="ERVL" FT repeat_region 14810801..14810969 FT /rpt_family="G-rich" FT repeat_region 14812597..14812810 FT /rpt_family="MIR" FT repeat_region 14813828..14813852 FT /rpt_family="(T)n" FT repeat_region 14814126..14814254 FT /rpt_family="L2" FT repeat_region 14814255..14814619 FT /rpt_family="MaLR" FT repeat_region 14814620..14815001 FT /rpt_family="L2" FT repeat_region 14815167..14815186 FT /rpt_family="(T)n" FT repeat_region 14815187..14815557 FT /rpt_family="Alu" FT repeat_region 14815730..14815765 FT /rpt_family="MaLR" FT repeat_region 14816056..14816173 FT /rpt_family="MIR" FT repeat_region 14816371..14816835 FT /rpt_family="MaLR" FT repeat_region 14817481..14817695 FT /rpt_family="MIR" FT repeat_region 14817759..14818000 FT /rpt_family="MIR" FT repeat_region 14818465..14818527 FT /rpt_family="MaLR" FT repeat_region 14818529..14818703 FT /rpt_family="L1" FT repeat_region 14818704..14818937 FT /rpt_family="L1" FT repeat_region 14818945..14818996 FT /rpt_family="MaLR" FT repeat_region 14818997..14819284 FT /rpt_family="L1" FT repeat_region 14819285..14819552 FT /rpt_family="MaLR" FT repeat_region 14819640..14819800 FT /rpt_family="MER1_type" FT repeat_region 14819820..14819870 FT /rpt_family="MIR" FT repeat_region 14820173..14820577 FT /rpt_family="MaLR" FT repeat_region 14820578..14820890 FT /rpt_family="Alu" FT repeat_region 14820891..14820957 FT /rpt_family="MaLR" FT repeat_region 14820960..14821229 FT /rpt_family="MIR" FT repeat_region 14821456..14821709 FT /rpt_family="ERVL" FT repeat_region 14821710..14821922 FT /rpt_family="MER1_type" FT repeat_region 14821923..14822077 FT /rpt_family="ERVL" FT repeat_region 14822093..14822161 FT /rpt_family="L2" FT repeat_region 14822888..14823349 FT /rpt_family="ERVL" FT repeat_region 14824366..14824439 FT /rpt_family="L2" FT repeat_region 14824620..14824686 FT /rpt_family="MIR" FT repeat_region 14824849..14824989 FT /rpt_family="MIR" FT repeat_region 14825833..14826157 FT /rpt_family="L2" FT repeat_region 14826431..14826612 FT /rpt_family="L2" FT repeat_region 14826678..14826812 FT /rpt_family="MIR" FT repeat_region 14827498..14827647 FT /rpt_family="MIR" FT repeat_region 14827721..14828030 FT /rpt_family="Alu" FT repeat_region 14828235..14828331 FT /rpt_family="MIR" FT repeat_region 14828396..14828524 FT /rpt_family="MIR" FT repeat_region 14828581..14828614 FT /rpt_family="(TG)n" FT repeat_region 14828622..14828751 FT /rpt_family="MIR" FT repeat_region 14829039..14829353 FT /rpt_family="Alu" FT repeat_region 14829981..14830285 FT /rpt_family="Alu" FT repeat_region 14830311..14830600 FT /rpt_family="Alu" FT repeat_region 14830829..14831013 FT /rpt_family="MER1_type" FT repeat_region 14831017..14831159 FT /rpt_family="MIR" FT repeat_region 14831356..14831466 FT /rpt_family="MIR" FT repeat_region 14831715..14831838 FT /rpt_family="MIR" FT repeat_region 14831880..14831922 FT /rpt_family="AT_rich" FT repeat_region 14832031..14832062 FT /rpt_family="(TG)n" FT repeat_region 14832063..14832333 FT /rpt_family="Alu" FT repeat_region 14832630..14832859 FT /rpt_family="MIR" FT repeat_region 14833926..14834010 FT /rpt_family="MIR" FT repeat_region 14834025..14834095 FT /rpt_family="L2" FT repeat_region 14834096..14834404 FT /rpt_family="Alu" FT repeat_region 14834405..14834562 FT /rpt_family="L2" FT repeat_region 14835345..14835510 FT /rpt_family="L1" FT repeat_region 14835560..14835852 FT /rpt_family="Alu" FT repeat_region 14836551..14836578 FT /rpt_family="AT_rich" FT repeat_region 14836639..14836662 FT /rpt_family="AT_rich" FT repeat_region 14837080..14837636 FT /rpt_family="ERV1" FT repeat_region 14837992..14838136 FT /rpt_family="(TA)n" FT repeat_region 14838176..14838335 FT /rpt_family="(TA)n" FT repeat_region 14838368..14838527 FT /rpt_family="(TA)n" FT repeat_region 14838530..14838605 FT /rpt_family="(TATAA)n" FT repeat_region 14838607..14838774 FT /rpt_family="(TA)n" FT repeat_region 14838789..14839112 FT /rpt_family="(TA)n" FT repeat_region 14839500..14839623 FT /rpt_family="MIR" FT repeat_region 14839913..14840262 FT /rpt_family="MaLR" FT repeat_region 14840276..14840628 FT /rpt_family="MaLR" FT repeat_region 14840629..14840851 FT /rpt_family="MIR" FT repeat_region 14841135..14841194 FT /rpt_family="MaLR" FT repeat_region 14841195..14842654 FT /rpt_family="L1" FT repeat_region 14842655..14842980 FT /rpt_family="MaLR" FT repeat_region 14842981..14844544 FT /rpt_family="MaLR" FT repeat_region 14844545..14844666 FT /rpt_family="MaLR" FT repeat_region 14844655..14844728 FT /rpt_family="MaLR" FT repeat_region 14845416..14845677 FT /rpt_family="L2" FT repeat_region 14845791..14846224 FT /rpt_family="ERVL" FT repeat_region 14846250..14846615 FT /rpt_family="MaLR" FT repeat_region 14846663..14846790 FT /rpt_family="G-rich" FT repeat_region 14846793..14846998 FT /rpt_family="MIR" FT repeat_region 14847621..14847725 FT /rpt_family="MIR" FT repeat_region 14847785..14847926 FT /rpt_family="AcHobo" FT repeat_region 14847928..14848029 FT /rpt_family="MIR" FT repeat_region 14848467..14848496 FT /rpt_family="AT_rich" FT repeat_region 14848505..14848793 FT /rpt_family="Alu" FT repeat_region 14849445..14849538 FT /rpt_family="MER1_type" FT repeat_region 14849951..14850116 FT /rpt_family="MER103" FT repeat_region 14850280..14850380 FT /rpt_family="L1" FT repeat_region 14850571..14850844 FT /rpt_family="MaLR" FT repeat_region 14851829..14851932 FT /rpt_family="MIR" FT repeat_region 14852011..14852082 FT /rpt_family="(TTATA)n" FT repeat_region 14852094..14852115 FT /rpt_family="AT_rich" FT repeat_region 14852826..14853122 FT /rpt_family="Alu" FT repeat_region 14853150..14853280 FT /rpt_family="MIR" FT repeat_region 14853428..14853508 FT /rpt_family="MIR" FT repeat_region 14853719..14853799 FT /rpt_family="L2" FT repeat_region 14853993..14854366 FT /rpt_family="L2" FT repeat_region 14854405..14854467 FT /rpt_family="MaLR" FT repeat_region 14854469..14854636 FT /rpt_family="ERV1" FT repeat_region 14854637..14854767 FT /rpt_family="MaLR" FT repeat_region 14854815..14854914 FT /rpt_family="MaLR" FT repeat_region 14854915..14855276 FT /rpt_family="ERV1" FT repeat_region 14855268..14855651 FT /rpt_family="MaLR" FT repeat_region 14855881..14856027 FT /rpt_family="L2" FT repeat_region 14856174..14856500 FT /rpt_family="MER2_type" FT repeat_region 14858521..14858544 FT /rpt_family="AT_rich" FT repeat_region 14858609..14858695 FT /rpt_family="MIR" FT repeat_region 14858701..14858778 FT /rpt_family="MIR" FT repeat_region 14858793..14858868 FT /rpt_family="MIR" FT repeat_region 14859473..14859686 FT /rpt_family="L1" FT repeat_region 14859697..14859899 FT /rpt_family="L1" FT repeat_region 14860040..14860098 FT /rpt_family="(TA)n" FT repeat_region 14860099..14860135 FT /rpt_family="(CA)n" FT repeat_region 14860318..14860446 FT /rpt_family="MIR" FT repeat_region 14860758..14860789 FT /rpt_family="(TCC)n" FT repeat_region 14860882..14861100 FT /rpt_family="MIR" FT repeat_region 14861121..14861244 FT /rpt_family="MIR" FT repeat_region 14861322..14861443 FT /rpt_family="L2" FT repeat_region 14861641..14861762 FT /rpt_family="L1" FT repeat_region 14861763..14862151 FT /rpt_family="L1" FT repeat_region 14862520..14862633 FT /rpt_family="MIR" FT repeat_region 14862913..14863058 FT /rpt_family="MIR" FT repeat_region 14863058..14863171 FT /rpt_family="CR1" FT repeat_region 14863229..14863329 FT /rpt_family="MIR" FT repeat_region 14863376..14863495 FT /rpt_family="MER1_type" FT repeat_region 14863496..14863956 FT /rpt_family="MaLR" FT repeat_region 14863957..14863980 FT /rpt_family="MER1_type" FT repeat_region 14863996..14864126 FT /rpt_family="MER1_type" FT repeat_region 14864670..14864705 FT /rpt_family="GC_rich" FT repeat_region 14865739..14865893 FT /rpt_family="MIR" FT repeat_region 14865927..14866046 FT /rpt_family="MIR" FT repeat_region 14866290..14866399 FT /rpt_family="MIR" FT repeat_region 14866516..14866673 FT /rpt_family="MIR" FT repeat_region 14867524..14867610 FT /rpt_family="L1" FT repeat_region 14867636..14867816 FT /rpt_family="L1" FT repeat_region 14868002..14868067 FT /rpt_family="L1" FT repeat_region 14868078..14868170 FT /rpt_family="(TA)n" FT repeat_region 14868201..14868226 FT /rpt_family="AT_rich" FT repeat_region 14868514..14868823 FT /rpt_family="Alu" FT repeat_region 14869097..14869207 FT /rpt_family="MIR" FT repeat_region 14870154..14870320 FT /rpt_family="MER1_type" FT repeat_region 14870454..14870556 FT /rpt_family="MER103" FT repeat_region 14871279..14871430 FT /rpt_family="MIR" FT repeat_region 14871442..14871573 FT /rpt_family="L1" FT repeat_region 14871594..14871686 FT /rpt_family="L1" FT repeat_region 14872180..14872459 FT /rpt_family="L2" FT repeat_region 14872525..14872733 FT /rpt_family="L2" FT repeat_region 14872799..14872840 FT /rpt_family="MIR" FT repeat_region 14873124..14873215 FT /rpt_family="L2" FT repeat_region 14874393..14874636 FT /rpt_family="MIR" FT repeat_region 14874685..14874990 FT /rpt_family="L2" FT repeat_region 14875047..14875085 FT /rpt_family="L2" FT repeat_region 14875407..14875700 FT /rpt_family="Alu" FT repeat_region 14875789..14876105 FT /rpt_family="Alu" FT repeat_region 14876669..14876882 FT /rpt_family="MIR" FT repeat_region 14877225..14878577 FT /rpt_family="L1" FT repeat_region 14878990..14879304 FT /rpt_family="L2" FT repeat_region 14879998..14880152 FT /rpt_family="MER1_type" FT repeat_region 14880852..14880963 FT /rpt_family="L2" FT repeat_region 14881073..14881204 FT /rpt_family="MER1_type" FT repeat_region 14881770..14881917 FT /rpt_family="MIR" FT repeat_region 14882707..14883044 FT /rpt_family="L2" FT repeat_region 14883258..14884272 FT /rpt_family="L2" FT repeat_region 14884273..14884563 FT /rpt_family="Alu" FT repeat_region 14884564..14884633 FT /rpt_family="L2" FT repeat_region 14884622..14884697 FT /rpt_family="L2" FT repeat_region 14884951..14885041 FT /rpt_family="CR1" FT repeat_region 14885651..14885736 FT /rpt_family="L2" FT repeat_region 14885817..14885863 FT /rpt_family="(TG)n" FT repeat_region 14885931..14886696 FT /rpt_family="L2" FT repeat_region 14886994..14887306 FT /rpt_family="Alu" FT repeat_region 14887307..14887478 FT /rpt_family="Alu" FT repeat_region 14887609..14887987 FT /rpt_family="ERVL" FT repeat_region 14888777..14888859 FT /rpt_family="L2" FT repeat_region 14889282..14889455 FT /rpt_family="AcHobo" FT repeat_region 14889645..14890013 FT /rpt_family="MaLR" FT repeat_region 14890147..14890337 FT /rpt_family="MIR" FT repeat_region 14891368..14891496 FT /rpt_family="L2" FT repeat_region 14891795..14892044 FT /rpt_family="MIR" FT repeat_region 14892117..14892167 FT /rpt_family="MIR" FT repeat_region 14892173..14892239 FT /rpt_family="CR1" FT repeat_region 14892255..14892552 FT /rpt_family="L1" FT repeat_region 14892685..14892709 FT /rpt_family="AT_rich" FT repeat_region 14892728..14893113 FT /rpt_family="MaLR" FT repeat_region 14893199..14893358 FT /rpt_family="L2" FT repeat_region 14893371..14893413 FT /rpt_family="(CA)n" FT repeat_region 14894154..14894394 FT /rpt_family="MaLR" FT repeat_region 14894701..14894822 FT /rpt_family="MIR" FT repeat_region 14895074..14895101 FT /rpt_family="(TG)n" FT repeat_region 14895429..14895563 FT /rpt_family="MIR" FT repeat_region 14895798..14895934 FT /rpt_family="MIR" FT repeat_region 14896679..14896825 FT /rpt_family="MaLR" FT repeat_region 14897456..14897627 FT /rpt_family="MIR" FT repeat_region 14898817..14898959 FT /rpt_family="MIR" FT repeat_region 14899363..14899469 FT /rpt_family="L2" FT repeat_region 14899470..14899896 FT /rpt_family="MaLR" FT repeat_region 14899897..14900349 FT /rpt_family="L2" FT repeat_region 14900579..14900677 FT /rpt_family="GA-rich" FT repeat_region 14901225..14901403 FT /rpt_family="MER1_type" FT repeat_region 14901905..14902269 FT /rpt_family="L2" FT repeat_region 14903151..14903459 FT /rpt_family="MaLR" FT repeat_region 14904728..14904805 FT /rpt_family="MIR" FT repeat_region 14904956..14905138 FT /rpt_family="MER1_type" FT repeat_region 14905249..14905395 FT /rpt_family="L2" FT repeat_region 14905396..14905425 FT /rpt_family="(TC)n" FT repeat_region 14905425..14905452 FT /rpt_family="(CA)n" FT repeat_region 14905426..14906047 FT /rpt_family="L2" FT repeat_region 14906048..14906283 FT /rpt_family="MIR" FT repeat_region 14906644..14906677 FT /rpt_family="(GA)n" FT repeat_region 14906851..14906972 FT /rpt_family="L2" FT repeat_region 14907403..14907518 FT /rpt_family="L2" FT repeat_region 14907810..14908019 FT /rpt_family="L1" FT repeat_region 14908025..14908384 FT /rpt_family="MaLR" FT repeat_region 14908386..14908440 FT /rpt_family="L1" FT repeat_region 14908624..14908804 FT /rpt_family="ERVL" FT repeat_region 14909413..14909502 FT /rpt_family="MIR" FT repeat_region 14909725..14910617 FT /rpt_family="L1" FT repeat_region 14911175..14911224 FT /rpt_family="(CA)n" FT repeat_region 14911322..14911377 FT /rpt_family="(TC)n" FT repeat_region 14911476..14911519 FT /rpt_family="GA-rich" FT repeat_region 14911856..14911912 FT /rpt_family="L2" FT repeat_region 14912830..14913027 FT /rpt_family="MaLR" FT repeat_region 14914119..14914316 FT /rpt_family="MIR" FT repeat_region 14914535..14915066 FT /rpt_family="L1" FT repeat_region 14915275..14915400 FT /rpt_family="MIR" FT repeat_region 14915401..14915853 FT /rpt_family="MaLR" FT repeat_region 14915854..14915984 FT /rpt_family="MIR" FT repeat_region 14916022..14916054 FT /rpt_family="(TA)n" FT repeat_region 14916054..14916077 FT /rpt_family="(GA)n" FT repeat_region 14916085..14916153 FT /rpt_family="(TA)n" FT repeat_region 14916180..14916365 FT /rpt_family="(TA)n" FT repeat_region 14916402..14916582 FT /rpt_family="(TA)n" FT repeat_region 14916958..14917086 FT /rpt_family="MIR" FT repeat_region 14917373..14917563 FT /rpt_family="Alu" FT repeat_region 14917564..14917642 FT /rpt_family="Mariner" FT repeat_region 14917667..14917802 FT /rpt_family="Alu" FT repeat_region 14917829..14918036 FT /rpt_family="L2" FT repeat_region 14918327..14918546 FT /rpt_family="MER1_type" FT repeat_region 14919027..14919246 FT /rpt_family="MIR" FT repeat_region 14919441..14919515 FT /rpt_family="(CATATA)n" FT repeat_region 14919529..14919743 FT /rpt_family="MIR" FT repeat_region 14919744..14919787 FT /rpt_family="AT_rich" FT repeat_region 14920509..14920536 FT /rpt_family="AT_rich" FT repeat_region 14920909..14921188 FT /rpt_family="Alu" FT repeat_region 14922220..14922240 FT /rpt_family="(TGGA)n" FT repeat_region 14922300..14922595 FT /rpt_family="Alu" FT repeat_region 14922956..14923047 FT /rpt_family="(TTATA)n" FT repeat_region 14923052..14923332 FT /rpt_family="MER2_type" FT repeat_region 14923362..14923407 FT /rpt_family="AT_rich" FT repeat_region 14923408..14923759 FT /rpt_family="MER2_type" FT repeat_region 14923781..14924054 FT /rpt_family="(TA)n" FT repeat_region 14924059..14924239 FT /rpt_family="(TATAA)n" FT repeat_region 14924215..14924916 FT /rpt_family="(TA)n" FT repeat_region 14924934..14925504 FT /rpt_family="(TA)n" FT repeat_region 14925479..14925647 FT /rpt_family="(TTATA)n" FT repeat_region 14925668..14925714 FT /rpt_family="(CATATA)n" FT repeat_region 14925735..14926097 FT /rpt_family="MER2_type" FT repeat_region 14926118..14926504 FT /rpt_family="ERVL" FT repeat_region 14928009..14928708 FT /rpt_family="L2" FT repeat_region 14928790..14929248 FT /rpt_family="L1" FT repeat_region 14929963..14930006 FT /rpt_family="L2" FT repeat_region 14930167..14931038 FT /rpt_family="L2" FT repeat_region 14931069..14931210 FT /rpt_family="MIR" FT repeat_region 14931316..14931436 FT /rpt_family="MIR" FT repeat_region 14931470..14931647 FT /rpt_family="MER1_type" FT repeat_region 14932364..14932715 FT /rpt_family="MaLR" FT repeat_region 14933109..14933290 FT /rpt_family="L2" FT repeat_region 14933600..14933759 FT /rpt_family="(TA)n" FT repeat_region 14933759..14933786 FT /rpt_family="(CA)n" FT repeat_region 14933899..14934341 FT /rpt_family="MaLR" FT repeat_region 14934961..14934983 FT /rpt_family="AT_rich" FT repeat_region 14934999..14935125 FT /rpt_family="(TATAA)n" FT repeat_region 14935246..14935408 FT /rpt_family="Alu" FT repeat_region 14935478..14935560 FT /rpt_family="MIR" FT repeat_region 14935607..14935692 FT /rpt_family="MIR" FT repeat_region 14935719..14935817 FT /rpt_family="(TA)n" FT repeat_region 14935818..14936265 FT /rpt_family="MER2_type" FT repeat_region 14936330..14936439 FT /rpt_family="MIR" FT repeat_region 14936484..14936616 FT /rpt_family="L2" FT repeat_region 14937509..14937804 FT /rpt_family="Alu" FT repeat_region 14938346..14939661 FT /rpt_family="L1" FT repeat_region 14939662..14939869 FT /rpt_family="L1" FT repeat_region 14939870..14940576 FT /rpt_family="L1" FT repeat_region 14940812..14940839 FT /rpt_family="AT_rich" FT repeat_region 14940937..14941110 FT /rpt_family="L1" FT repeat_region 14941392..14941846 FT /rpt_family="MaLR" FT repeat_region 14945049..14945188 FT /rpt_family="L2" FT repeat_region 14945900..14946325 FT /rpt_family="MaLR" FT repeat_region 14946445..14946737 FT /rpt_family="Alu" FT repeat_region 14947191..14947479 FT /rpt_family="L1" FT repeat_region 14947575..14948137 FT /rpt_family="L1" FT repeat_region 14948570..14948919 FT /rpt_family="L2" FT repeat_region 14949015..14949150 FT /rpt_family="L2" FT repeat_region 14949421..14949583 FT /rpt_family="MIR" FT repeat_region 14949621..14950041 FT /rpt_family="L1" FT repeat_region 14950042..14950185 FT /rpt_family="L1" FT repeat_region 14950266..14950295 FT /rpt_family="AT_rich" FT repeat_region 14950442..14950521 FT /rpt_family="(TC)n" FT repeat_region 14950523..14950784 FT /rpt_family="Alu" FT repeat_region 14950983..14951136 FT /rpt_family="L1" FT repeat_region 14951210..14951251 FT /rpt_family="AT_rich" FT repeat_region 14951474..14952122 FT /rpt_family="MER2_type" FT repeat_region 14952128..14952633 FT /rpt_family="L1" FT repeat_region 14952719..14952767 FT /rpt_family="(CA)n" FT repeat_region 14952837..14953090 FT /rpt_family="L1" FT repeat_region 14953119..14953304 FT /rpt_family="Tc2" FT repeat_region 14953483..14953774 FT /rpt_family="CR1" FT repeat_region 14954331..14954458 FT /rpt_family="MER1_type" FT repeat_region 14954767..14956688 FT /rpt_family="L1" FT repeat_region 14956723..14956901 FT /rpt_family="MaLR" FT repeat_region 14957689..14958006 FT /rpt_family="Alu" FT repeat_region 14958723..14958888 FT /rpt_family="L2" FT repeat_region 14958904..14959294 FT /rpt_family="MaLR" FT repeat_region 14960539..14960657 FT /rpt_family="MIR" FT repeat_region 14960706..14961312 FT /rpt_family="L2" FT repeat_region 14961382..14961430 FT /rpt_family="AT_rich" FT repeat_region 14961592..14961664 FT /rpt_family="CR1" FT repeat_region 14961837..14961960 FT /rpt_family="(TA)n" FT repeat_region 14961966..14962022 FT /rpt_family="AT_rich" FT repeat_region 14962132..14962640 FT /rpt_family="L2" FT repeat_region 14962684..14963205 FT /rpt_family="MaLR" FT repeat_region 14963206..14963254 FT /rpt_family="ERVL" FT repeat_region 14963255..14963585 FT /rpt_family="Alu" FT repeat_region 14963586..14963997 FT /rpt_family="ERVL" FT repeat_region 14963998..14964077 FT /rpt_family="MaLR" FT repeat_region 14964115..14964417 FT /rpt_family="Alu" FT repeat_region 14964690..14964785 FT /rpt_family="MIR" FT repeat_region 14964786..14965085 FT /rpt_family="Alu" FT repeat_region 14965086..14965204 FT /rpt_family="MIR" FT repeat_region 14965494..14965552 FT /rpt_family="MaLR" FT repeat_region 14965551..14965643 FT /rpt_family="MaLR" FT repeat_region 14965772..14965925 FT /rpt_family="(TA)n" FT repeat_region 14966193..14966380 FT /rpt_family="MIR" FT repeat_region 14966549..14967011 FT /rpt_family="ERVL" FT repeat_region 14968260..14968584 FT /rpt_family="MaLR" FT repeat_region 14968616..14968754 FT /rpt_family="MIR" FT repeat_region 14968870..14969297 FT /rpt_family="L1" FT repeat_region 14969572..14969805 FT /rpt_family="MaLR" FT repeat_region 14969989..14970079 FT /rpt_family="L1" FT repeat_region 14970125..14970252 FT /rpt_family="L2" FT repeat_region 14971473..14971594 FT /rpt_family="MIR" FT repeat_region 14971675..14972497 FT /rpt_family="L1" FT repeat_region 14972482..14972903 FT /rpt_family="L1" FT repeat_region 14972915..14974329 FT /rpt_family="L1" FT repeat_region 14974331..14974701 FT /rpt_family="MaLR" FT repeat_region 14974712..14975500 FT /rpt_family="L1" FT repeat_region 14975614..14976973 FT /rpt_family="L1" FT repeat_region 14976974..14977001 FT /rpt_family="(TTTG)n" FT repeat_region 14977002..14977288 FT /rpt_family="L1" FT repeat_region 14978045..14978100 FT /rpt_family="L2" FT repeat_region 14978212..14978341 FT /rpt_family="MIR" FT repeat_region 14978771..14978968 FT /rpt_family="L1" FT repeat_region 14978970..14979091 FT /rpt_family="MIR" FT repeat_region 14979141..14979194 FT /rpt_family="L2" FT repeat_region 14979304..14979396 FT /rpt_family="(TA)n" FT repeat_region 14980122..14980532 FT /rpt_family="L2" FT repeat_region 14980785..14981750 FT /rpt_family="L2" FT repeat_region 14982080..14982146 FT /rpt_family="AT_rich" FT repeat_region 14982330..14982509 FT /rpt_family="MIR" FT repeat_region 14982515..14982661 FT /rpt_family="MER1_type" FT repeat_region 14982662..14982970 FT /rpt_family="Alu" FT repeat_region 14982971..14983033 FT /rpt_family="MER1_type" FT repeat_region 14983220..14983396 FT /rpt_family="MIR" FT repeat_region 14983427..14984040 FT /rpt_family="L1" FT repeat_region 14984448..14984716 FT /rpt_family="L2" FT repeat_region 14984764..14985046 FT /rpt_family="Alu" FT repeat_region 14985081..14985108 FT /rpt_family="(TTTA)n" FT repeat_region 14985471..14985614 FT /rpt_family="Alu" FT repeat_region 14985733..14985936 FT /rpt_family="MIR" FT repeat_region 14985939..14985977 FT /rpt_family="AT_rich" FT repeat_region 14987065..14987185 FT /rpt_family="MIR" FT repeat_region 14987259..14987471 FT /rpt_family="MIR" FT repeat_region 14988454..14988515 FT /rpt_family="Mariner" FT repeat_region 14988601..14988686 FT /rpt_family="L2" FT repeat_region 14989177..14989421 FT /rpt_family="MER1_type" FT repeat_region 14989436..14989605 FT /rpt_family="MER1_type" FT repeat_region 14989606..14989907 FT /rpt_family="Alu" FT repeat_region 14989908..14990078 FT /rpt_family="MER1_type" FT repeat_region 14990132..14991242 FT /rpt_family="L1" FT repeat_region 14991249..14991342 FT /rpt_family="Alu" FT repeat_region 14991343..14991385 FT /rpt_family="AT_rich" FT repeat_region 14991386..14991938 FT /rpt_family="L1" FT repeat_region 14991953..14992057 FT /rpt_family="MER1_type" FT repeat_region 14992063..14992328 FT /rpt_family="Alu" FT repeat_region 14992329..14992399 FT /rpt_family="MER1_type" FT repeat_region 14992939..14993169 FT /rpt_family="MIR" FT repeat_region 14994071..14994192 FT /rpt_family="L1" FT repeat_region 14994196..14994597 FT /rpt_family="L1" FT repeat_region 14994710..14994803 FT /rpt_family="MIR" FT repeat_region 14995121..14995257 FT /rpt_family="L2" FT repeat_region 14995805..14995877 FT /rpt_family="CT-rich" FT repeat_region 14996026..14996496 FT /rpt_family="L2" FT repeat_region 14997103..14997801 FT /rpt_family="L2" FT repeat_region 14999178..14999438 FT /rpt_family="Alu" FT repeat_region 15000539..15000767 FT /rpt_family="L2" FT repeat_region 15000773..15001230 FT /rpt_family="L2" FT repeat_region 15002604..15002628 FT /rpt_family="AT_rich" FT misc_feature 15003060..15006761 FT /note="CpG_island (%GC=72.2, o/e=0.80, #CpGs=424)" FT repeat_region 15004089..15004125 FT /rpt_family="(CGG)n" FT repeat_region 15004504..15004536 FT /rpt_family="GC_rich" FT repeat_region 15004551..15004736 FT /rpt_family="L1" FT repeat_region 15004737..15004760 FT /rpt_family="(TCC)n" FT repeat_region 15004761..15005347 FT /rpt_family="L1" FT repeat_region 15005348..15005373 FT /rpt_family="(CGG)n" FT repeat_region 15005374..15005738 FT /rpt_family="L1" FT repeat_region 15005739..15005767 FT /rpt_family="(CGG)n" FT repeat_region 15005768..15006079 FT /rpt_family="L1" FT repeat_region 15006279..15006309 FT /rpt_family="GC_rich" FT repeat_region 15006370..15006433 FT /rpt_family="GC_rich" FT repeat_region 15007685..15007776 FT /rpt_family="MIR" FT repeat_region 15011828..15011925 FT /rpt_family="MIR" FT repeat_region 15012590..15012621 FT /rpt_family="AT_rich" FT repeat_region 15012717..15013023 FT /rpt_family="Alu" FT repeat_region 15013170..15013269 FT /rpt_family="Alu" FT repeat_region 15016616..15016695 FT /rpt_family="MIR" FT repeat_region 15016713..15016890 FT /rpt_family="MER1_type" FT repeat_region 15017340..15017632 FT /rpt_family="MER2_type" FT repeat_region 15018912..15018940 FT /rpt_family="AT_rich" FT repeat_region 15019529..15019556 FT /rpt_family="AT_rich" FT repeat_region 15019618..15019763 FT /rpt_family="MaLR" FT repeat_region 15020561..15020629 FT /rpt_family="(TA)n" FT repeat_region 15021442..15021923 FT /rpt_family="MaLR" FT repeat_region 15022553..15022681 FT /rpt_family="L2" FT repeat_region 15025008..15025168 FT /rpt_family="L1" FT repeat_region 15025223..15025263 FT /rpt_family="AT_rich" FT repeat_region 15025538..15026367 FT /rpt_family="L1" FT repeat_region 15026368..15026665 FT /rpt_family="Alu" FT repeat_region 15026666..15027700 FT /rpt_family="L1" FT repeat_region 15027841..15028147 FT /rpt_family="Alu" FT repeat_region 15028180..15028300 FT /rpt_family="L2" FT repeat_region 15028302..15028440 FT /rpt_family="L1" FT repeat_region 15029402..15029620 FT /rpt_family="MIR" FT repeat_region 15030071..15030458 FT /rpt_family="L2" FT repeat_region 15030599..15030953 FT /rpt_family="MER2_type" FT repeat_region 15031048..15031086 FT /rpt_family="AT_rich" FT repeat_region 15031252..15031737 FT /rpt_family="MaLR" FT repeat_region 15031917..15032162 FT /rpt_family="MIR" FT repeat_region 15033722..15033885 FT /rpt_family="Alu" FT repeat_region 15034179..15034284 FT /rpt_family="AT_rich" FT repeat_region 15035028..15035231 FT /rpt_family="MIR" FT repeat_region 15036856..15037108 FT /rpt_family="MIR" FT repeat_region 15037117..15037349 FT /rpt_family="CR1" FT repeat_region 15037381..15037457 FT /rpt_family="MER1_type" FT repeat_region 15037851..15037878 FT /rpt_family="AT_rich" FT repeat_region 15038647..15038946 FT /rpt_family="Alu" FT repeat_region 15040207..15040501 FT /rpt_family="Alu" FT misc_feature 15042382..15042632 FT /note="match to EST AW265727 (NID:g6642543) xq75h03.x1" FT misc_feature 15042984..15043449 FT /note="similar to Homo sapiens EST BF819902 FT (NID:g12158038)" FT repeat_region 15043030..15043316 FT /rpt_family="Alu" FT repeat_region 15045314..15045354 FT /rpt_family="AT_rich" FT repeat_region 15045780..15045998 FT /rpt_family="MER1_type" FT misc_feature 15045869..15046283 FT /note="match to EST AV724199 (NID:g10828348)" FT repeat_region 15046996..15047043 FT /rpt_family="(TA)n" FT repeat_region 15047434..15047484 FT /rpt_family="AT_rich" FT repeat_region 15047553..15047852 FT /rpt_family="L1" FT repeat_region 15047853..15048148 FT /rpt_family="Alu" FT repeat_region 15048149..15048347 FT /rpt_family="L1" FT repeat_region 15048533..15050396 FT /rpt_family="L1" FT repeat_region 15051722..15052028 FT /rpt_family="MER1_type" FT misc_feature 15052917..15053301 FT /note="match to EST BF380355 (NID:g11369480)" FT misc_feature 15054032..15054208 FT /note="match to EST BG748532 (NID:g14059185)" FT /note="match to EST BE383195 (NID:g9328560)" FT misc_feature 15054252..15054713 FT /note="match to EST AA425966 (NID:g2107842) zw17a06.r1" FT repeat_region 15054620..15054658 FT /rpt_family="(TTTTTA)n" FT repeat_region 15054630..15054938 FT /rpt_family="Alu" FT misc_feature 15054934..15055303 FT /note="match to EST R56316 (NID:g826422) yg90d08.r1" FT misc_feature 15055744..15055841 FT /note="similar to Bos taurus EST AW653337 (NID:g7419163)" FT misc_feature 15055749..15055841 FT /note="similar to Mus musculus EST BB612073 FT (NID:g16453152)" FT misc_feature 15055752..15055841 FT /note="match to EST BE383195 (NID:g9328560)" FT /note="match to EST BG748532 (NID:g14059185)" FT misc_feature 15055757..15055841 FT /note="match to EST BE302536 (NID:g9186284) ba67b01.y1" FT misc_feature 15055778..15055841 FT /note="similar to Homo sapiens EST H71225 (NID:g1043041) FT ys12e09.r1" FT repeat_region 15057147..15057556 FT /rpt_family="L2" FT repeat_region 15058615..15058643 FT /rpt_family="AT_rich" FT misc_feature 15059464..15059679 FT /note="match to EST AA441884 (NID:g2153762) zw62f06.r1" FT misc_feature 15059464..15059934 FT /note="match to EST AA463845 (NID:g2188729) zx67f11.r1" FT repeat_region 15059656..15059839 FT /rpt_family="MIR" FT misc_feature 15060040..15060126 FT /note="similar to Homo sapiens EST BF903366 FT (NID:g12294825)" FT misc_feature 15060043..15060163 FT /note="similar to Sus scrofa EST BI359798 (NID:g15055826)" FT /note="similar to Bos taurus EST AW430013 (NID:g6961320)" FT misc_feature 15060045..15060163 FT /note="similar to Mus musculus EST BB612073 FT (NID:g16453152)" FT /note="similar to Bos taurus EST AW653337 (NID:g7419163)" FT /note="match to EST BE302536 (NID:g9186284) ba67b01.y1" FT /note="match to EST BE383195 (NID:g9328560)" FT misc_feature 15060045..15060121 FT /note="match to EST BG748532 (NID:g14059185)" FT misc_feature 15060045..15060144 FT /note="similar to Homo sapiens EST H71225 (NID:g1043041) FT ys12e09.r1" FT misc_feature 15060089..15060163 FT /note="similar to Mus musculus EST BG068252 FT (NID:g12550821)" FT misc_feature 15060098..15060163 FT /note="similar to Mus musculus EST BI648114 FT (NID:g15562350)" FT misc_feature 15060099..15060163 FT /note="match to EST R38137 (NID:g795593) yh94e03.r1" FT repeat_region 15060302..15060641 FT /rpt_family="MER1_type" FT misc_feature 15060811..15060925 FT /note="similar to Mus musculus EST BB612073 FT (NID:g16453152)" FT /note="similar to Bos taurus EST AW430013 (NID:g6961320)" FT /note="similar to Sus scrofa EST BI359798 (NID:g15055826)" FT /note="similar to Mus musculus EST BB612415 FT (NID:g15394771)" FT /note="match to EST R38137 (NID:g795593) yh94e03.r1" FT /note="match to EST BE302536 (NID:g9186284) ba67b01.y1" FT /note="similar to Mus musculus EST BI648114 FT (NID:g15562350)" FT /note="similar to Mus musculus EST BG068252 FT (NID:g12550821)" FT misc_feature 15060811..15060894 FT /note="similar to Bos taurus EST AW653337 (NID:g7419163)" FT misc_feature 15060811..15060929 FT /note="match to EST BE383195 (NID:g9328560)" FT misc_feature 15060892..15060909 FT /note="similar to Homo sapiens EST BF903366 FT (NID:g12294825)" FT misc_feature 15060909..15060925 FT /note="match to EST BE814304 (NID:g10246538)" FT repeat_region 15061663..15062337 FT /rpt_family="L2" FT misc_feature 15061711..15061712 FT /note="match to EST BE383195 (NID:g9328560)" FT repeat_region 15062369..15063517 FT /rpt_family="L2" FT misc_feature 15063702..15063884 FT /note="similar to Silurana tropicalis EST BG512578 FT (NID:g13483235)" FT misc_feature 15063703..15063884 FT /note="match to EST BE302536 (NID:g9186284) ba67b01.y1" FT /note="similar to Sus scrofa EST BI359798 (NID:g15055826)" FT /note="similar to Mus musculus EST BG068252 FT (NID:g12550821)" FT /note="similar to Mus musculus EST BB612073 FT (NID:g16453152)" FT /note="similar to Mus musculus EST BI648114 FT (NID:g15562350)" FT /note="similar to Mus musculus EST BB612415 FT (NID:g15394771)" FT misc_feature 15063703..15063768 FT /note="match to EST R38137 (NID:g795593) yh94e03.r1" FT misc_feature 15063703..15063807 FT /note="similar to Bos taurus EST AW430013 (NID:g6961320)" FT misc_feature 15063703..15063882 FT /note="match to EST BE814304 (NID:g10246538)" FT misc_feature 15063732..15063884 FT /note="match to EST AI670817 (NID:g4850548) wa04e12.x1" FT misc_feature 15063738..15063884 FT /note="similar to EST AL656185 (NID:g17668412)" FT misc_feature 15063768..15063829 FT /note="similar to Homo sapiens EST BF903366 FT (NID:g12294825)" FT misc_feature 15063786..15063882 FT /note="similar to EST BM288652 (NID:g17997678)" FT repeat_region 15064165..15064376 FT /rpt_family="MIR" FT misc_feature 15064491..15064992 FT /note="match to EST AA883978 (NID:g2993508) am27a09.s1" FT repeat_region 15064626..15064661 FT /rpt_family="AT_rich" FT misc_feature 15064709..15064989 FT /note="match to EST AA936590 (NID:g3094508) on78h04.s1" FT repeat_region 15065090..15065182 FT /rpt_family="MER1_type" FT repeat_region 15065118..15065200 FT /rpt_family="MER1_type" FT misc_feature 15065333..15065335 FT /note="match to EST R38137 (NID:g795593) yh94e03.r1" FT misc_feature 15065362..15065495 FT /note="match to EST BE302536 (NID:g9186284) ba67b01.y1" FT misc_feature 15065562..15066201 FT /note="match to EST AW978821 (NID:g8170097)" FT misc_feature 15065826..15066201 FT /note="match to EST AA019730 (NID:g1483040) ze62c01.s1" FT repeat_region 15066260..15066379 FT /rpt_family="L2" FT repeat_region 15066545..15066726 FT /rpt_family="L1" FT repeat_region 15066741..15066874 FT /rpt_family="L1" FT repeat_region 15067057..15067200 FT /rpt_family="MIR" FT misc_feature 15067777..15068008 FT /note="similar to Mus musculus EST BG068252 FT (NID:g12550821)" FT /note="similar to Mus musculus EST BI648114 FT (NID:g15562350)" FT misc_feature 15067777..15068005 FT /note="similar to Silurana tropicalis EST BG512578 FT (NID:g13483235)" FT misc_feature 15067777..15068299 FT /note="similar to EST AL656185 (NID:g17668412)" FT misc_feature 15067777..15068249 FT /note="match to EST AI670817 (NID:g4850548) wa04e12.x1" FT misc_feature 15067777..15067922 FT /note="similar to EST BM288652 (NID:g17997678)" FT /note="similar to Sus scrofa EST BI359798 (NID:g15055826)" FT misc_feature 15067777..15067914 FT /note="similar to Mus musculus EST BB612073 FT (NID:g16453152)" FT misc_feature 15067777..15068062 FT /note="similar to Mus musculus EST BB612415 FT (NID:g15394771)" FT misc_feature 15067783..15068249 FT /note="match to EST AI335022 (NID:g4071949) tb21g06.x1" FT misc_feature 15067888..15068489 FT /note="similar to Silurana tropicalis EST BG817022 FT (NID:g14188002)" FT misc_feature 15068018..15068255 FT /note="match to EST AI701687 (NID:g4989587) we81b12.x1" FT misc_feature 15068031..15068234 FT /note="match to EST AA429688 (NID:g2112871) zw75b12.r1" FT misc_feature 15068257..15068479 FT /note="similar to Mus musculus EST BE955923 FT (NID:g10599950)" FT misc_feature 15068380..15068912 FT /note="similar to Xenopus laevis EST BF232460 FT (NID:g11175125) de06a10.x1" FT misc_feature 15068410..15069085 FT /note="similar to Mus musculus EST BB353025 FT (NID:g16405508)" FT misc_feature 15068484..15068796 FT /note="match to EST AA093192 (NID:g1638709)" FT misc_feature 15068501..15069128 FT /note="similar to Xenopus laevis EST AW635095 FT (NID:g7392176)" FT misc_feature 15068530..15069091 FT /note="similar to Xenopus laevis EST AW644640 FT (NID:g7402034)" FT misc_feature 15068623..15069402 FT /note="match to EST BI857384 (NID:g15998131)" FT misc_feature 15068768..15069091 FT /note="similar to Rattus norvegicus EST AI111622 FT (NID:g3511349)" FT misc_feature 15068773..15069083 FT /note="match to EST AL600653 (NID:g15164159)" FT misc_feature 15068799..15068800 FT /note="match to EST BF671034 (NID:g11944929)" FT misc_feature 15068874..15068877 FT /note="match to EST AI335022 (NID:g4071949) tb21g06.x1" FT misc_feature 15069418..15069909 FT /note="similar to Mus musculus EST AI182245 (NID:g3732883) FT uc68e08.r1" FT misc_feature 15069522..15070188 FT /note="match to EST BF671034 (NID:g11944929)" FT misc_feature 15069681..15069835 FT /note="match to EST BF372433 (NID:g11334458)" FT misc_feature 15069781..15070304 FT /note="similar to Rattus norvegicus EST BG665906 FT (NID:g13887828)" FT misc_feature 15069801..15070525 FT /note="match to EST BG388881 (NID:g13282327)" FT misc_feature 15070018..15070519 FT /note="similar to Mus musculus EST BF452600 FT (NID:g11518769)" FT misc_feature 15070159..15070429 FT /note="match to EST AV656584 (NID:g9877598)" FT repeat_region 15070320..15070341 FT /rpt_family="AT_rich" FT misc_feature 15070332..15070505 FT /note="match to EST AA377165 (NID:g2029546)" FT misc_feature 15070333..15071029 FT /note="match to EST AW964015 (NID:g8153851)" FT misc_feature 15070430..15070889 FT /note="similar to Bos taurus EST BG358395 (NID:g13271240)" FT misc_feature 15070456..15070898 FT /note="similar to Homo sapiens EST BG777824 FT (NID:g14048141)" FT misc_feature 15070485..15070581 FT /note="match to EST AV656584 (NID:g9877598)" FT misc_feature 15070559..15070959 FT /note="similar to Xenopus laevis EST AW635879 FT (NID:g7392960)" FT misc_feature 15070571..15071146 FT /note="match to EST BF031353 (NID:g10739065)" FT misc_feature 15070693..15071398 FT /note="match to EST AI908407 (NID:g6499087)" FT misc_feature 15070910..15071389 FT /note="similar to Bos taurus EST BF774307 (NID:g12122207)" FT misc_feature 15070955..15071512 FT /note="match to EST AW299792 (NID:g6709469) xs43d03.x1" FT misc_feature 15071020..15071619 FT /note="similar to Xenopus laevis EST AW635913 FT (NID:g7392994)" FT misc_feature 15071100..15071774 FT /note="similar to Mus musculus EST AV231491 FT (NID:g15404986)" FT misc_feature 15071158..15071735 FT /note="similar to Xenopus laevis EST BI350009 FT (NID:g15044455)" FT misc_feature 15071177..15071777 FT /note="similar to Rattus sp. EST AI010275 (NID:g4133215)" FT misc_feature 15071195..15071532 FT /note="match to EST D62743 (NID:g966517)" FT misc_feature 15071280..15071775 FT /note="similar to Silurana tropicalis EST AL645326 FT (NID:g16797451)" FT misc_feature 15071341..15071776 FT /note="similar to Bos taurus EST BI776181 (NID:g15777158)" FT misc_feature 15071387..15071775 FT /note="similar to Rattus norvegicus EST BI276719 FT (NID:g14921887)" FT misc_feature 15071552..15071777 FT /note="match to EST AW265341 (NID:g6642157) xq50g04.x1" FT repeat_region 15071705..15071741 FT /rpt_family="AT_rich" FT repeat_region 15073095..15073195 FT /rpt_family="L1" FT repeat_region 15073459..15073520 FT /rpt_family="AT_rich" FT repeat_region 15073519..15073767 FT /rpt_family="L1" FT repeat_region 15073772..15073855 FT /rpt_family="L1" FT repeat_region 15073846..15073866 FT /rpt_family="AT_rich" FT repeat_region 15074100..15074530 FT /rpt_family="L1" FT repeat_region 15074699..15074820 FT /rpt_family="L2" FT repeat_region 15075595..15075691 FT /rpt_family="MaLR" FT repeat_region 15075726..15075760 FT /rpt_family="MIR" FT repeat_region 15075804..15075935 FT /rpt_family="MER1_type" FT repeat_region 15076218..15076330 FT /rpt_family="MIR" FT repeat_region 15076435..15079648 FT /rpt_family="L1" FT repeat_region 15078189..15078323 FT /rpt_family="A-rich" FT repeat_region 15078405..15078429 FT /rpt_family="AT_rich" FT repeat_region 15079270..15079449 FT /rpt_family="A-rich" FT repeat_region 15079737..15079993 FT /rpt_family="L1" FT repeat_region 15080090..15080126 FT /rpt_family="AT_rich" FT repeat_region 15080117..15080222 FT /rpt_family="L1" FT repeat_region 15080231..15080606 FT /rpt_family="L1" FT repeat_region 15080736..15081326 FT /rpt_family="MaLR" FT repeat_region 15081560..15081624 FT /rpt_family="T-rich" FT repeat_region 15081724..15081847 FT /rpt_family="MIR" FT repeat_region 15082127..15082529 FT /rpt_family="L2" FT repeat_region 15082796..15083002 FT /rpt_family="Alu" FT repeat_region 15083365..15083402 FT /rpt_family="(T)n" FT repeat_region 15083373..15083683 FT /rpt_family="Alu" FT repeat_region 15084060..15084101 FT /rpt_family="MIR" FT repeat_region 15084162..15084364 FT /rpt_family="MIR" FT repeat_region 15084370..15084479 FT /rpt_family="MIR" FT repeat_region 15084566..15084725 FT /rpt_family="MIR" FT repeat_region 15085242..15085365 FT /rpt_family="MIR" FT repeat_region 15085366..15085680 FT /rpt_family="Alu" FT repeat_region 15085651..15085685 FT /rpt_family="A-rich" FT repeat_region 15085681..15085734 FT /rpt_family="MIR" FT repeat_region 15085818..15085878 FT /rpt_family="L2" FT repeat_region 15086112..15086861 FT /rpt_family="L1" FT repeat_region 15086862..15087170 FT /rpt_family="MaLR" FT misc_feature 15088628 FT /note="match to EST AI701687 (NID:g4989587) we81b12.x1" FT repeat_region 15088724..15089076 FT /rpt_family="MaLR" FT repeat_region 15089077..15090142 FT /rpt_family="L1" FT repeat_region 15089505..15089558 FT /rpt_family="(TTTTTG)n" FT repeat_region 15089649..15089682 FT /rpt_family="CT-rich" FT repeat_region 15090183..15090239 FT /rpt_family="Mariner" FT repeat_region 15090240..15090395 FT /rpt_family="L1" FT repeat_region 15090428..15090934 FT /rpt_family="L1" FT repeat_region 15090935..15091235 FT /rpt_family="Alu" FT repeat_region 15091236..15092332 FT /rpt_family="L1" FT repeat_region 15091546..15091582 FT /rpt_family="AT_rich" FT repeat_region 15092074..15092115 FT /rpt_family="T-rich" FT repeat_region 15092738..15094580 FT /rpt_family="L1" FT repeat_region 15093321..15093348 FT /rpt_family="AT_rich" FT repeat_region 15094289..15094351 FT /rpt_family="AT_rich" FT repeat_region 15094581..15095057 FT /rpt_family="MaLR" FT repeat_region 15095058..15095077 FT /rpt_family="L1" FT repeat_region 15095078..15095357 FT /rpt_family="Alu" FT repeat_region 15095358..15095483 FT /rpt_family="L1" FT repeat_region 15095359..15095379 FT /rpt_family="AT_rich" FT misc_feature 15095471..15095723 FT /note="similar to Homo sapiens EST AV753828 FT (NID:g10911676)" FT misc_feature 15095471..15095714 FT /note="similar to Homo sapiens EST BE676909 FT (NID:g10037450)" FT repeat_region 15095722..15095945 FT /rpt_family="L1" FT repeat_region 15096010..15096097 FT /rpt_family="L1" FT repeat_region 15096098..15096405 FT /rpt_family="Alu" FT repeat_region 15096406..15096616 FT /rpt_family="L1" FT repeat_region 15096620..15096769 FT /rpt_family="MaLR" FT repeat_region 15096770..15096793 FT /rpt_family="(T)n" FT repeat_region 15097074..15097159 FT /rpt_family="MaLR" FT repeat_region 15097160..15097326 FT /rpt_family="L1" FT repeat_region 15097327..15097505 FT /rpt_family="MaLR" FT repeat_region 15097512..15098190 FT /rpt_family="L1" FT repeat_region 15097540..15097560 FT /rpt_family="AT_rich" FT repeat_region 15098192..15098425 FT /rpt_family="L1" FT repeat_region 15098426..15098750 FT /rpt_family="MaLR" FT repeat_region 15098751..15098874 FT /rpt_family="L1" FT repeat_region 15099110..15099129 FT /rpt_family="(T)n" FT repeat_region 15099461..15099483 FT /rpt_family="AT_rich" FT repeat_region 15099550..15099796 FT /rpt_family="L1" FT repeat_region 15099808..15100005 FT /rpt_family="L1" FT repeat_region 15100134..15100189 FT /rpt_family="MaLR" FT repeat_region 15100192..15100219 FT /rpt_family="AT_rich" FT repeat_region 15100325..15100680 FT /rpt_family="L1" FT repeat_region 15100681..15101033 FT /rpt_family="MaLR" FT repeat_region 15101034..15101162 FT /rpt_family="L1" FT misc_feature 15101457..15101744 FT /note="match to EST AV713437 (NID:g10733249)" FT repeat_region 15101638..15101728 FT /rpt_family="ERVL" FT misc_feature 15101795..15102145 FT /note="match to EST AV713437 (NID:g10733249)" FT repeat_region 15101999..15102233 FT /rpt_family="ERVL" FT repeat_region 15102260..15102380 FT /rpt_family="ERVL" FT repeat_region 15103443..15103500 FT /rpt_family="MIR" FT repeat_region 15103527..15103664 FT /rpt_family="MIR" FT repeat_region 15103817..15103857 FT /rpt_family="ERVL" FT repeat_region 15104052..15104521 FT /rpt_family="L1" FT repeat_region 15104930..15105295 FT /rpt_family="MaLR" FT repeat_region 15105539..15105718 FT /rpt_family="MaLR" FT repeat_region 15105880..15106066 FT /rpt_family="AcHobo" FT repeat_region 15106086..15106411 FT /rpt_family="AcHobo" FT repeat_region 15106405..15107035 FT /rpt_family="MaLR" FT repeat_region 15107039..15107271 FT /rpt_family="AcHobo" FT repeat_region 15107376..15107552 FT /rpt_family="MER2_type" FT repeat_region 15107602..15107625 FT /rpt_family="(A)n" FT repeat_region 15107758..15108489 FT /rpt_family="ERV1" FT repeat_region 15108771..15109005 FT /rpt_family="L1" FT repeat_region 15109022..15109387 FT /rpt_family="ERV1" FT repeat_region 15109388..15109681 FT /rpt_family="Alu" FT repeat_region 15109682..15109771 FT /rpt_family="ERV1" FT repeat_region 15109783..15110008 FT /rpt_family="L1" FT repeat_region 15110028..15110056 FT /rpt_family="AT_rich" FT repeat_region 15110429..15110607 FT /rpt_family="MER1_type" FT repeat_region 15110779..15111200 FT /rpt_family="MER2_type" FT repeat_region 15111348..15111435 FT /rpt_family="MIR" FT repeat_region 15112095..15112193 FT /rpt_family="MIR" FT repeat_region 15113773..15114014 FT /rpt_family="MIR" FT repeat_region 15114043..15114064 FT /rpt_family="AT_rich" FT repeat_region 15114069..15114147 FT /rpt_family="L1" FT repeat_region 15114135..15114174 FT /rpt_family="AT_rich" FT repeat_region 15114157..15115798 FT /rpt_family="L1" FT repeat_region 15115799..15116687 FT /rpt_family="L1" FT repeat_region 15116737..15116765 FT /rpt_family="(CA)n" FT repeat_region 15116771..15117259 FT /rpt_family="L2" FT repeat_region 15117293..15117426 FT /rpt_family="CT-rich" FT repeat_region 15117400..15117584 FT /rpt_family="Alu" FT repeat_region 15117592..15117658 FT /rpt_family="L2" FT repeat_region 15117713..15117769 FT /rpt_family="ERVL" FT repeat_region 15117913..15117976 FT /rpt_family="ERVL" FT repeat_region 15117999..15118049 FT /rpt_family="(TAGA)n" FT repeat_region 15118028..15118462 FT /rpt_family="ERVL" FT repeat_region 15118510..15118563 FT /rpt_family="L2" FT repeat_region 15118583..15119014 FT /rpt_family="MER1_type?" FT repeat_region 15119084..15119162 FT /rpt_family="MIR" FT repeat_region 15119561..15119680 FT /rpt_family="MIR" FT repeat_region 15119828..15119892 FT /rpt_family="GA-rich" FT repeat_region 15120456..15120530 FT /rpt_family="MIR" FT repeat_region 15120575..15121124 FT /rpt_family="MaLR" FT repeat_region 15121634..15122700 FT /rpt_family="ERVK" FT repeat_region 15122713..15122752 FT /rpt_family="MaLR" FT repeat_region 15122753..15123126 FT /rpt_family="L1" FT repeat_region 15123127..15123645 FT /rpt_family="MaLR" FT repeat_region 15124438..15124465 FT /rpt_family="AT_rich" FT repeat_region 15124455..15124863 FT /rpt_family="L1" FT repeat_region 15124615..15124648 FT /rpt_family="AT_rich" FT repeat_region 15124974..15125543 FT /rpt_family="L1" FT repeat_region 15126103..15126345 FT /rpt_family="L1" FT repeat_region 15126366..15126596 FT /rpt_family="L1" FT repeat_region 15127040..15127119 FT /rpt_family="L2" FT repeat_region 15127401..15127521 FT /rpt_family="L2" FT repeat_region 15127799..15128011 FT /rpt_family="MaLR" FT repeat_region 15128013..15128314 FT /rpt_family="Alu" FT repeat_region 15128296..15128369 FT /rpt_family="GA-rich" FT repeat_region 15128368..15128413 FT /rpt_family="MaLR" FT repeat_region 15128414..15128805 FT /rpt_family="MaLR" FT repeat_region 15128806..15128953 FT /rpt_family="MaLR" FT repeat_region 15128954..15129252 FT /rpt_family="Alu" FT repeat_region 15129772..15130143 FT /rpt_family="MaLR" FT repeat_region 15130144..15130487 FT /rpt_family="MaLR" FT repeat_region 15130656..15130740 FT /rpt_family="(CATA)n" FT repeat_region 15130682..15130862 FT /rpt_family="(CATATA)n" FT repeat_region 15131027..15131067 FT /rpt_family="MIR" FT repeat_region 15131110..15131186 FT /rpt_family="L2" FT repeat_region 15131187..15131207 FT /rpt_family="(T)n" FT repeat_region 15131491..15131918 FT /rpt_family="L2" FT repeat_region 15132681..15132778 FT /rpt_family="L2" FT repeat_region 15133168..15133196 FT /rpt_family="L1" FT repeat_region 15133197..15133587 FT /rpt_family="MaLR" FT repeat_region 15133588..15134338 FT /rpt_family="L1" FT repeat_region 15134745..15134799 FT /rpt_family="(T)n" FT repeat_region 15134770..15134930 FT /rpt_family="Alu" FT misc_feature 15134989..15135387 FT /note="match to EST AA781485 (NID:g2840816) ac01b01.s1" FT repeat_region 15135631..15135751 FT /rpt_family="MaLR" FT repeat_region 15135811..15135965 FT /rpt_family="MaLR" FT repeat_region 15136385..15136496 FT /rpt_family="MIR" FT repeat_region 15136497..15136857 FT /rpt_family="MaLR" FT repeat_region 15138451..15138811 FT /rpt_family="MaLR" FT repeat_region 15138812..15138897 FT /rpt_family="MIR" FT repeat_region 15139185..15139222 FT /rpt_family="(TG)n" FT repeat_region 15139222..15139254 FT /rpt_family="(GA)n" FT repeat_region 15139512..15139882 FT /rpt_family="MaLR" FT repeat_region 15140474..15140638 FT /rpt_family="MIR" FT repeat_region 15140769..15140934 FT /rpt_family="L2" FT repeat_region 15141295..15141451 FT /rpt_family="MaLR" FT repeat_region 15141586..15141777 FT /rpt_family="AcHobo" FT repeat_region 15142703..15143099 FT /rpt_family="MaLR" FT repeat_region 15143581..15143883 FT /rpt_family="Alu" FT repeat_region 15143856..15143883 FT /rpt_family="(A)n" FT repeat_region 15143970..15144435 FT /rpt_family="CR1" FT repeat_region 15144855..15144969 FT /rpt_family="L2" FT repeat_region 15145365..15145561 FT /rpt_family="MIR" FT repeat_region 15146473..15146618 FT /rpt_family="MIR" FT repeat_region 15147166..15147216 FT /rpt_family="(ATG)n" FT repeat_region 15147930..15148037 FT /rpt_family="L2" FT repeat_region 15148393..15148513 FT /rpt_family="MIR" FT repeat_region 15151061..15151260 FT /rpt_family="MIR" FT repeat_region 15151918..15152091 FT /rpt_family="MIR" FT repeat_region 15152738..15153107 FT /rpt_family="MaLR" FT repeat_region 15153310..15153488 FT /rpt_family="MIR" FT repeat_region 15154416..15154490 FT /rpt_family="CT-rich" FT repeat_region 15155093..15155205 FT /rpt_family="MIR" FT repeat_region 15155347..15155538 FT /rpt_family="L2" FT repeat_region 15155539..15155970 FT /rpt_family="MaLR" FT repeat_region 15155971..15156070 FT /rpt_family="L2" FT repeat_region 15156174..15156195 FT /rpt_family="(TTTTG)n" FT repeat_region 15159237..15159348 FT /rpt_family="T-rich" FT repeat_region 15160189..15161237 FT /rpt_family="L1" FT repeat_region 15161402..15161454 FT /rpt_family="CR1" FT misc_feature 15161418..15161729 FT /note="match to EST AW961835 (NID:g8151521)" FT repeat_region 15161713..15162022 FT /rpt_family="Alu" FT repeat_region 15161993..15162023 FT /rpt_family="(A)n" FT misc_feature 15162416..15163076 FT /note="match to EST AW973563 (NID:g8164743)" FT misc_feature 15162437..15162831 FT /note="match to EST AA553403 (NID:g2323942) nk80c05.s1" FT repeat_region 15162448..15162493 FT /rpt_family="L2" FT repeat_region 15164173..15164395 FT /rpt_family="GA-rich" FT repeat_region 15165722..15165861 FT /rpt_family="MIR" FT repeat_region 15165915..15166057 FT /rpt_family="L2" FT repeat_region 15166058..15166428 FT /rpt_family="MaLR" FT repeat_region 15166429..15166708 FT /rpt_family="L2" FT repeat_region 15166698..15166759 FT /rpt_family="MIR" FT repeat_region 15166786..15167269 FT /rpt_family="L1" FT repeat_region 15167264..15167304 FT /rpt_family="AT_rich" FT repeat_region 15167290..15167435 FT /rpt_family="L1" FT repeat_region 15167438..15167642 FT /rpt_family="L1" FT repeat_region 15167649..15167791 FT /rpt_family="L1" FT repeat_region 15167836..15167992 FT /rpt_family="L1" FT repeat_region 15168046..15168657 FT /rpt_family="L1" FT repeat_region 15168705..15168779 FT /rpt_family="L1" FT repeat_region 15168786..15168899 FT /rpt_family="Alu" FT repeat_region 15168963..15169143 FT /rpt_family="L1" FT repeat_region 15169155..15169252 FT /rpt_family="(TA)n" FT repeat_region 15170462..15170580 FT /rpt_family="L2" FT repeat_region 15170676..15170705 FT /rpt_family="(CA)n" FT repeat_region 15170735..15170762 FT /rpt_family="AT_rich" FT repeat_region 15171815..15171952 FT /rpt_family="L2" FT repeat_region 15172026..15172294 FT /rpt_family="L2" FT repeat_region 15172606..15172639 FT /rpt_family="(TTTTC)n" FT repeat_region 15172610..15172931 FT /rpt_family="Alu" FT repeat_region 15172791..15172814 FT /rpt_family="(T)n" FT repeat_region 15173505..15173842 FT /rpt_family="L1" FT repeat_region 15174792..15174813 FT /rpt_family="AT_rich" FT misc_feature 15174965..15175227 FT /note="match to EST AW015320 (NID:g5864077)" FT repeat_region 15175238..15175307 FT /rpt_family="MIR" FT repeat_region 15175549..15175632 FT /rpt_family="MER1_type" FT repeat_region 15181616..15181684 FT /rpt_family="A-rich" FT repeat_region 15181672..15182068 FT /rpt_family="MER1_type" FT repeat_region 15182209..15182303 FT /rpt_family="ERVL" FT repeat_region 15182601..15182882 FT /rpt_family="MaLR" FT repeat_region 15182946..15183238 FT /rpt_family="ERVL" FT repeat_region 15183745..15183818 FT /rpt_family="AT_rich" FT repeat_region 15184177..15184295 FT /rpt_family="L2" FT repeat_region 15184859..15184974 FT /rpt_family="MIR" FT repeat_region 15185002..15185388 FT /rpt_family="MaLR" FT repeat_region 15185606..15185772 FT /rpt_family="MIR" FT repeat_region 15185773..15185941 FT /rpt_family="L1" FT repeat_region 15185944..15185966 FT /rpt_family="AT_rich" FT misc_feature 15186312..15186318 FT /note="match to EST AI670817 (NID:g4850548) wa04e12.x1" FT repeat_region 15186417..15186506 FT /rpt_family="MIR" FT repeat_region 15186793..15186853 FT /rpt_family="MIR" FT repeat_region 15187009..15187378 FT /rpt_family="MaLR" FT repeat_region 15188844..15189016 FT /rpt_family="MIR" FT repeat_region 15189688..15190292 FT /rpt_family="MaLR" FT repeat_region 15190293..15190650 FT /rpt_family="MaLR" FT repeat_region 15192114..15192184 FT /rpt_family="MER103" FT repeat_region 15192416..15192609 FT /rpt_family="L1" FT repeat_region 15192773..15192881 FT /rpt_family="MIR" FT repeat_region 15193137..15193235 FT /rpt_family="GA-rich" FT repeat_region 15193441..15193735 FT /rpt_family="Alu" FT repeat_region 15194949..15195012 FT /rpt_family="ERVL" FT repeat_region 15195365..15195432 FT /rpt_family="MER53" FT repeat_region 15195438..15195484 FT /rpt_family="MIR" FT repeat_region 15196498..15196924 FT /rpt_family="ERVL" FT repeat_region 15196932..15197187 FT /rpt_family="ERVL" FT repeat_region 15197223..15197270 FT /rpt_family="MIR" FT repeat_region 15197398..15197688 FT /rpt_family="Alu" FT repeat_region 15197752..15197870 FT /rpt_family="MIR" FT repeat_region 15198588..15198637 FT /rpt_family="MIR" FT repeat_region 15199160..15199375 FT /rpt_family="MIR" FT repeat_region 15199461..15199533 FT /rpt_family="Mariner" FT repeat_region 15200386..15200552 FT /rpt_family="MIR" FT repeat_region 15200734..15201601 FT /rpt_family="L1" FT repeat_region 15202120..15202346 FT /rpt_family="L2" FT repeat_region 15202347..15202654 FT /rpt_family="Alu" FT repeat_region 15202625..15202656 FT /rpt_family="(A)n" FT repeat_region 15202655..15202752 FT /rpt_family="L2" FT repeat_region 15202960..15203114 FT /rpt_family="MER1_type" FT repeat_region 15203137..15203556 FT /rpt_family="MaLR" FT repeat_region 15205603..15206153 FT /rpt_family="L1" FT repeat_region 15206461..15206696 FT /rpt_family="MIR" FT repeat_region 15206713..15206750 FT /rpt_family="(TTC)n" FT repeat_region 15206733..15207019 FT /rpt_family="Alu" FT repeat_region 15207322..15207968 FT /rpt_family="L2" FT repeat_region 15207972..15208333 FT /rpt_family="MaLR" FT repeat_region 15208334..15208816 FT /rpt_family="MaLR" FT repeat_region 15208812..15209139 FT /rpt_family="MaLR" FT repeat_region 15209140..15209491 FT /rpt_family="MaLR" FT repeat_region 15209789..15209956 FT /rpt_family="L2" FT repeat_region 15209988..15210033 FT /rpt_family="MIR" FT repeat_region 15210991..15211237 FT /rpt_family="MaLR" FT repeat_region 15211235..15211270 FT /rpt_family="AT_rich" FT repeat_region 15211238..15211553 FT /rpt_family="Alu" FT repeat_region 15211554..15211704 FT /rpt_family="MaLR" FT repeat_region 15211828..15211954 FT /rpt_family="MIR" FT repeat_region 15212362..15212715 FT /rpt_family="L1" FT repeat_region 15212814..15213116 FT /rpt_family="Alu" FT misc_feature 15244753..15245033 FT /note="CpG_island (%GC=61.9, o/e=0.77, #CpGs=23)" FT repeat_region 15249960..15250299 FT /rpt_family="L1" FT repeat_region 15250310..15250506 FT /rpt_family="L1" FT repeat_region 15250718..15250759 FT /rpt_family="L2" FT repeat_region 15250791..15250979 FT /rpt_family="L2" FT misc_feature 15250879..15251380 FT /note="match to EST AA694070 (NID:g2695008) zi51h06.s1" FT misc_feature 15250930..15251213 FT /note="match to EST AA001839 (NID:g1445653) zh84e01.s1" FT repeat_region 15251183..15251287 FT /rpt_family="MaLR" FT repeat_region 15251299..15251343 FT /rpt_family="MaLR" FT misc_feature 15251723..15252154 FT /note="match to EST R89489 (NID:g954316) yq01f12.r1" FT repeat_region 15252190..15252520 FT /rpt_family="Alu" FT misc_feature 15252497..15252500 FT /note="match to EST AA001839 (NID:g1445653) zh84e01.s1" FT repeat_region 15252865..15252900 FT /rpt_family="MaLR" FT repeat_region 15253106..15253451 FT /rpt_family="MaLR" FT repeat_region 15253950..15254067 FT /rpt_family="MIR" FT repeat_region 15254125..15254144 FT /rpt_family="(TC)n" FT repeat_region 15254145..15254196 FT /rpt_family="(CA)n" FT repeat_region 15254951..15255107 FT /rpt_family="MIR" FT repeat_region 15255185..15255285 FT /rpt_family="MIR" FT repeat_region 15255440..15255465 FT /rpt_family="AT_rich" FT repeat_region 15255608..15255723 FT /rpt_family="MIR" FT repeat_region 15256261..15256563 FT /rpt_family="Alu" FT repeat_region 15256683..15257306 FT /rpt_family="MER2_type" FT repeat_region 15257926..15258258 FT /rpt_family="L2" FT repeat_region 15258419..15258519 FT /rpt_family="MIR" FT repeat_region 15259090..15259303 FT /rpt_family="MIR" FT repeat_region 15259329..15259448 FT /rpt_family="MIR" FT repeat_region 15259904..15260116 FT /rpt_family="MIR" FT repeat_region 15260277..15260572 FT /rpt_family="Alu" FT repeat_region 15261101..15261391 FT /rpt_family="Alu" FT repeat_region 15261754..15262093 FT /rpt_family="MaLR" FT repeat_region 15264326..15264629 FT /rpt_family="Alu" FT repeat_region 15264852..15264878 FT /rpt_family="MaLR" FT repeat_region 15264896..15265190 FT /rpt_family="L1" FT repeat_region 15265537..15266579 FT /rpt_family="L1" FT repeat_region 15266763..15266918 FT /rpt_family="L1" FT repeat_region 15266929..15267104 FT /rpt_family="MaLR" FT repeat_region 15267105..15267137 FT /rpt_family="(TC)n" FT repeat_region 15267138..15267325 FT /rpt_family="MaLR" FT repeat_region 15267341..15268103 FT /rpt_family="L1" FT repeat_region 15268138..15269499 FT /rpt_family="L1" FT misc_feature 15269526..15269599 FT /note="similar to Homo sapiens EST AW193766 (NID:g6472465) FT xm30a04.x1" FT repeat_region 15269987..15270347 FT /rpt_family="MaLR" FT repeat_region 15271915..15272273 FT /rpt_family="MaLR" FT misc_feature 15272314..15272369 FT /note="similar to Homo sapiens EST AW193766 (NID:g6472465) FT xm30a04.x1" FT repeat_region 15272400..15274154 FT /rpt_family="L1" FT misc_feature 15272447 FT /note="similar to Homo sapiens EST AW193766 (NID:g6472465) FT xm30a04.x1" FT repeat_region 15274133..15274601 FT /rpt_family="L1" FT repeat_region 15274598..15274687 FT /rpt_family="L1" FT repeat_region 15274690..15276161 FT /rpt_family="L1" FT repeat_region 15276162..15276471 FT /rpt_family="Alu" FT repeat_region 15276472..15277668 FT /rpt_family="L1" FT repeat_region 15277669..15278350 FT /rpt_family="L1" FT repeat_region 15278351..15278702 FT /rpt_family="MaLR" FT repeat_region 15278703..15278753 FT /rpt_family="L1" FT repeat_region 15278736..15280279 FT /rpt_family="L1" FT repeat_region 15286315..15287257 FT /rpt_family="L1" FT repeat_region 15287245..15287293 FT /rpt_family="L1" FT repeat_region 15287294..15287583 FT /rpt_family="Alu" FT repeat_region 15287584..15287827 FT /rpt_family="L1" FT repeat_region 15287828..15287882 FT /rpt_family="(TAAA)n" FT repeat_region 15287883..15288083 FT /rpt_family="L1" FT repeat_region 15288084..15288372 FT /rpt_family="Alu" FT repeat_region 15288373..15288560 FT /rpt_family="L1" FT repeat_region 15288562..15288681 FT /rpt_family="Mariner" FT repeat_region 15288682..15291577 FT /rpt_family="L1" FT repeat_region 15291571..15291869 FT /rpt_family="L1" FT repeat_region 15291880..15291913 FT /rpt_family="(TG)n" FT repeat_region 15291943..15292105 FT /rpt_family="L1" FT repeat_region 15292174..15292260 FT /rpt_family="MIR" FT repeat_region 15292352..15292525 FT /rpt_family="L2" FT repeat_region 15292651..15293372 FT /rpt_family="L2" FT repeat_region 15293577..15293619 FT /rpt_family="A-rich" FT repeat_region 15293622..15293691 FT /rpt_family="GA-rich" FT repeat_region 15294416..15294785 FT /rpt_family="MaLR" FT repeat_region 15295363..15295773 FT /rpt_family="ERVL" FT repeat_region 15295776..15295979 FT /rpt_family="MIR" FT repeat_region 15296697..15296733 FT /rpt_family="(CTAAT)n" FT repeat_region 15297010..15297038 FT /rpt_family="(A)n" FT repeat_region 15297264..15297461 FT /rpt_family="MIR" FT repeat_region 15297462..15298020 FT /rpt_family="MaLR" FT repeat_region 15299360..15299388 FT /rpt_family="AT_rich" FT repeat_region 15299398..15299459 FT /rpt_family="L2" FT repeat_region 15300625..15300795 FT /rpt_family="MIR" FT repeat_region 15300850..15301012 FT /rpt_family="MIR" FT repeat_region 15301385..15301587 FT /rpt_family="MIR" FT repeat_region 15301868..15302070 FT /rpt_family="MIR" FT repeat_region 15303397..15303525 FT /rpt_family="L2" FT repeat_region 15303563..15303851 FT /rpt_family="MaLR" FT repeat_region 15304756..15305231 FT /rpt_family="L2" FT repeat_region 15306009..15306270 FT /rpt_family="Alu" FT repeat_region 15306358..15306566 FT /rpt_family="MIR" FT repeat_region 15307328..15307501 FT /rpt_family="MaLR" FT repeat_region 15307537..15307790 FT /rpt_family="MaLR" FT repeat_region 15308069..15308130 FT /rpt_family="MER1_type" FT repeat_region 15308581..15308668 FT /rpt_family="MIR" FT repeat_region 15308941..15309298 FT /rpt_family="MaLR" FT repeat_region 15309299..15310904 FT /rpt_family="MaLR" FT repeat_region 15310908..15311281 FT /rpt_family="MaLR" FT repeat_region 15311312..15311660 FT /rpt_family="MaLR" FT repeat_region 15313240..15313592 FT /rpt_family="MaLR" FT repeat_region 15313696..15313913 FT /rpt_family="MIR" FT repeat_region 15314099..15314147 FT /rpt_family="L2" FT repeat_region 15314155..15314559 FT /rpt_family="MaLR" FT repeat_region 15314586..15314634 FT /rpt_family="MIR" FT repeat_region 15314676..15314770 FT /rpt_family="(TGGA)n" FT repeat_region 15315151..15315237 FT /rpt_family="L2" FT repeat_region 15315753..15315995 FT /rpt_family="MIR" FT repeat_region 15316093..15316224 FT /rpt_family="L2" FT repeat_region 15316229..15316379 FT /rpt_family="MIR" FT repeat_region 15316491..15316586 FT /rpt_family="MIR" FT misc_feature 15317064..15317346 FT /note="match to EST AA384585 (NID:g2036925)" FT repeat_region 15317369..15317400 FT /rpt_family="(T)n" FT misc_feature 15317401..15317558 FT /note="match to EST AI826144 (NID:g5446815) wk43a11.x1" FT repeat_region 15317536..15317628 FT /rpt_family="MER1_type" FT repeat_region 15317731..15317778 FT /rpt_family="MIR" FT repeat_region 15317798..15318237 FT /rpt_family="L1" FT repeat_region 15318314..15318487 FT /rpt_family="MER53" FT repeat_region 15318694..15318832 FT /rpt_family="MIR" FT repeat_region 15319199..15319342 FT /rpt_family="Tc2" FT repeat_region 15319352..15319406 FT /rpt_family="L1" FT repeat_region 15319407..15319495 FT /rpt_family="L1" FT repeat_region 15319496..15320042 FT /rpt_family="L1" FT repeat_region 15320043..15320365 FT /rpt_family="Alu" FT repeat_region 15320366..15320968 FT /rpt_family="L1" FT repeat_region 15321022..15321214 FT /rpt_family="MER1_type" FT repeat_region 15321445..15321498 FT /rpt_family="L1" FT repeat_region 15321544..15321636 FT /rpt_family="L1" FT repeat_region 15321637..15321763 FT /rpt_family="L2" FT repeat_region 15321997..15322065 FT /rpt_family="L2" FT repeat_region 15322813..15322894 FT /rpt_family="MIR" FT repeat_region 15322897..15323104 FT /rpt_family="MaLR" FT repeat_region 15323157..15323273 FT /rpt_family="MIR" FT repeat_region 15323336..15323467 FT /rpt_family="MaLR" FT repeat_region 15323469..15323602 FT /rpt_family="MIR" FT repeat_region 15323712..15323989 FT /rpt_family="MaLR" FT repeat_region 15323990..15324303 FT /rpt_family="Alu" FT repeat_region 15324304..15324444 FT /rpt_family="MaLR" FT repeat_region 15324553..15324906 FT /rpt_family="MaLR" FT repeat_region 15325763..15325959 FT /rpt_family="MIR" FT repeat_region 15326570..15326615 FT /rpt_family="ERVL" FT repeat_region 15326618..15326711 FT /rpt_family="(TAGA)n" FT repeat_region 15326852..15326889 FT /rpt_family="(CAGA)n" FT repeat_region 15326890..15327220 FT /rpt_family="ERVL" FT repeat_region 15327609..15327702 FT /rpt_family="MER1_type" FT repeat_region 15327735..15328357 FT /rpt_family="MaLR" FT repeat_region 15330105..15330135 FT /rpt_family="AT_rich" FT repeat_region 15330409..15330774 FT /rpt_family="L1" FT repeat_region 15330780..15331134 FT /rpt_family="MaLR" FT repeat_region 15331135..15331261 FT /rpt_family="L1" FT repeat_region 15331279..15331632 FT /rpt_family="Alu" FT repeat_region 15331644..15331932 FT /rpt_family="L1" FT repeat_region 15331982..15332045 FT /rpt_family="AcHobo" FT repeat_region 15332052..15332418 FT /rpt_family="MaLR" FT repeat_region 15332639..15332829 FT /rpt_family="L1" FT repeat_region 15334553..15334878 FT /rpt_family="MaLR" FT repeat_region 15335001..15335303 FT /rpt_family="L2" FT repeat_region 15335429..15335540 FT /rpt_family="MIR" FT repeat_region 15335548..15335747 FT /rpt_family="CR1" FT repeat_region 15335759..15335904 FT /rpt_family="CR1" FT repeat_region 15336656..15336900 FT /rpt_family="MIR" FT repeat_region 15337571..15337877 FT /rpt_family="L1" FT repeat_region 15337900..15337989 FT /rpt_family="MIR" FT repeat_region 15338142..15338352 FT /rpt_family="MaLR" FT repeat_region 15338669..15338709 FT /rpt_family="(CA)n" FT repeat_region 15338710..15339128 FT /rpt_family="MaLR" FT repeat_region 15339130..15339165 FT /rpt_family="(CA)n" FT repeat_region 15340103..15340193 FT /rpt_family="MIR" FT repeat_region 15340744..15340823 FT /rpt_family="L2" FT repeat_region 15340894..15340933 FT /rpt_family="(TG)n" FT misc_feature 15341611..15341831 FT /note="similar to EST BM698099 (NID:g19011357)" FT repeat_region 15344023..15344076 FT /rpt_family="L2" FT repeat_region 15344115..15344310 FT /rpt_family="L2" FT repeat_region 15344457..15344709 FT /rpt_family="MIR" FT repeat_region 15345390..15345616 FT /rpt_family="MIR" FT repeat_region 15345615..15345921 FT /rpt_family="L2" FT repeat_region 15346145..15346231 FT /rpt_family="MIR" FT repeat_region 15347479..15347595 FT /rpt_family="MIR" FT repeat_region 15348385..15348557 FT /rpt_family="L2" FT repeat_region 15348612..15348684 FT /rpt_family="Mariner" FT repeat_region 15348838..15349063 FT /rpt_family="CR1" FT repeat_region 15349216..15349311 FT /rpt_family="MER1_type" FT repeat_region 15349344..15349459 FT /rpt_family="CR1" FT repeat_region 15349538..15349696 FT /rpt_family="MIR" FT repeat_region 15350138..15350367 FT /rpt_family="MER1_type" FT repeat_region 15350376..15350418 FT /rpt_family="Mariner" FT repeat_region 15350575..15350659 FT /rpt_family="MIR" FT repeat_region 15351013..15351064 FT /rpt_family="L2" FT misc_feature 15351143..15351381 FT /note="match to EST BE145153 (NID:g8607877)" FT repeat_region 15351640..15351742 FT /rpt_family="GA-rich" FT repeat_region 15351756..15351932 FT /rpt_family="GA-rich" FT repeat_region 15351933..15351987 FT /rpt_family="(GGGA)n" FT repeat_region 15352308..15352483 FT /rpt_family="CR1" FT repeat_region 15352577..15352735 FT /rpt_family="MIR" FT repeat_region 15352848..15352906 FT /rpt_family="CT-rich" FT repeat_region 15353168..15353331 FT /rpt_family="MER1_type" FT repeat_region 15353848..15354041 FT /rpt_family="MIR" FT repeat_region 15354858..15354887 FT /rpt_family="AT_rich" FT repeat_region 15355304..15355394 FT /rpt_family="MIR" FT repeat_region 15356668..15356732 FT /rpt_family="MIR" FT misc_feature 15356767..15357212 FT /note="match to EST BE464644 (NID:g9510419) hs85h09.x1" FT repeat_region 15356961..15357021 FT /rpt_family="MER1_type" FT repeat_region 15357480..15357674 FT /rpt_family="Alu" FT repeat_region 15357687..15357717 FT /rpt_family="(TTTG)n" FT repeat_region 15360535..15360671 FT /rpt_family="AcHobo" FT repeat_region 15360693..15360768 FT /rpt_family="AcHobo" FT repeat_region 15360786..15360997 FT /rpt_family="AcHobo" FT repeat_region 15361090..15361163 FT /rpt_family="MER1_type" FT repeat_region 15361876..15362461 FT /rpt_family="MER2_type" FT repeat_region 15363614..15363819 FT /rpt_family="MIR" FT repeat_region 15365886..15365947 FT /rpt_family="L2" FT repeat_region 15365944..15365999 FT /rpt_family="MIR" FT repeat_region 15366006..15366070 FT /rpt_family="MaLR" FT repeat_region 15366910..15367065 FT /rpt_family="MIR" FT repeat_region 15367158..15367362 FT /rpt_family="MaLR" FT repeat_region 15367779..15367861 FT /rpt_family="AcHobo" FT repeat_region 15367870..15367953 FT /rpt_family="AcHobo" FT repeat_region 15368164..15368241 FT /rpt_family="CT-rich" FT repeat_region 15369501..15369869 FT /rpt_family="L1" FT repeat_region 15369920..15370446 FT /rpt_family="L1" FT repeat_region 15370960..15371170 FT /rpt_family="L1" FT repeat_region 15371589..15371850 FT /rpt_family="L1" FT repeat_region 15372507..15372711 FT /rpt_family="L2" FT repeat_region 15373082..15373159 FT /rpt_family="L2" FT repeat_region 15373648..15373701 FT /rpt_family="MIR" FT repeat_region 15373792..15374152 FT /rpt_family="MaLR" FT repeat_region 15374667..15375071 FT /rpt_family="MaLR" FT repeat_region 15375617..15375739 FT /rpt_family="MIR" FT repeat_region 15375749..15375894 FT /rpt_family="MIR" FT misc_feature 15376173..15376554 FT /note="similar to Mus musculus EST BI151758 FT (NID:g14611759)" FT repeat_region 15377944..15377987 FT /rpt_family="L2" FT repeat_region 15378022..15378196 FT /rpt_family="MIR" FT repeat_region 15378190..15378293 FT /rpt_family="MIR" FT repeat_region 15378379..15378580 FT /rpt_family="MIR" FT repeat_region 15378722..15378764 FT /rpt_family="MER1_type" FT repeat_region 15379535..15379834 FT /rpt_family="L2" FT repeat_region 15379864..15379976 FT /rpt_family="MIR" FT repeat_region 15380776..15380797 FT /rpt_family="AT_rich" FT repeat_region 15380819..15380993 FT /rpt_family="CR1" FT repeat_region 15381000..15381234 FT /rpt_family="MIR" FT repeat_region 15381294..15381476 FT /rpt_family="CR1" FT repeat_region 15381844..15382084 FT /rpt_family="MaLR" FT repeat_region 15382277..15382584 FT /rpt_family="Alu" FT repeat_region 15382675..15382702 FT /rpt_family="AT_rich" FT repeat_region 15382739..15382759 FT /rpt_family="AT_rich" FT repeat_region 15382760..15383060 FT /rpt_family="Alu" FT repeat_region 15383180..15383354 FT /rpt_family="MIR" FT misc_feature 15383296..15383918 FT /note="match to EST BM091006 (NID:g17019972) ig21b07.y1" FT misc_feature 15383454..15383794 FT /note="similar to Mus musculus EST BI151758 FT (NID:g14611759)" FT misc_feature 15383485..15383924 FT /note="similar to Mus musculus EST BB200474 FT (NID:g16271435)" FT misc_feature 15383553..15383924 FT /note="similar to Mus musculus EST BB634505 FT (NID:g16470752)" FT repeat_region 15384091..15384245 FT /rpt_family="MIR" FT repeat_region 15384582..15384629 FT /rpt_family="L2" FT repeat_region 15385446..15385674 FT /rpt_family="L2" FT repeat_region 15385830..15385890 FT /rpt_family="MIR" FT repeat_region 15386784..15386930 FT /rpt_family="L2" FT repeat_region 15387045..15387366 FT /rpt_family="L2" FT repeat_region 15387988..15390971 FT /rpt_family="L2" FT repeat_region 15391049..15391342 FT /rpt_family="Alu" FT repeat_region 15391715..15392072 FT /rpt_family="ERVL" FT repeat_region 15392595..15393139 FT /rpt_family="MaLR" FT misc_feature 15393205..15565772 FT /note="Quality: Phrap Quality >=40 99.9% of Sequence; FT Estimated Total Number of Errors is 0.2.; STS Content:; FT SHGC4-1069 G01801; SHGC-50182 G33403" FT repeat_region 15564218..15564429 FT /rpt_family="MIR" FT repeat_region 15565857..15565986 FT /rpt_family="Alu" FT repeat_region 15566031..15566189 FT /rpt_family="MIR" FT repeat_region 15566309..15566599 FT /rpt_family="Alu" FT repeat_region 15567253..15567534 FT /rpt_family="Alu" FT repeat_region 15567731..15567846 FT /rpt_family="L2" FT repeat_region 15568313..15568602 FT /rpt_family="Alu" FT repeat_region 15568603..15568623 FT /rpt_family="AT_rich" FT repeat_region 15568624..15568930 FT /rpt_family="Alu" FT repeat_region 15569444..15569571 FT /rpt_family="MIR" FT repeat_region 15569857..15569992 FT /rpt_family="MIR" FT repeat_region 15570004..15570218 FT /rpt_family="Alu" FT repeat_region 15571089..15571616 FT /rpt_family="ERV1" FT repeat_region 15571717..15571934 FT /rpt_family="MIR" FT repeat_region 15572196..15572540 FT /rpt_family="Alu" FT repeat_region 15572706..15572729 FT /rpt_family="AT_rich" FT repeat_region 15573137..15573243 FT /rpt_family="Alu" FT repeat_region 15573461..15573739 FT /rpt_family="CR1" FT repeat_region 15573750..15573969 FT /rpt_family="MIR" FT repeat_region 15574108..15574271 FT /rpt_family="MER1_type" FT repeat_region 15574272..15574779 FT /rpt_family="ERVL" FT repeat_region 15574780..15574801 FT /rpt_family="MER1_type" FT repeat_region 15574817..15574913 FT /rpt_family="CR1" FT repeat_region 15574914..15575213 FT /rpt_family="Alu" FT repeat_region 15575340..15575471 FT /rpt_family="MIR" FT repeat_region 15576532..15576658 FT /rpt_family="T2_type" FT repeat_region 15576987..15577092 FT /rpt_family="L2" FT repeat_region 15578606..15578918 FT /rpt_family="Alu" FT repeat_region 15580075..15580203 FT /rpt_family="L2" FT repeat_region 15580260..15580410 FT /rpt_family="Alu" FT repeat_region 15580411..15580442 FT /rpt_family="(TTTG)n" FT repeat_region 15580443..15580564 FT /rpt_family="Alu" FT repeat_region 15580568..15580593 FT /rpt_family="AT_rich" FT repeat_region 15580633..15580671 FT /rpt_family="AT_rich" FT repeat_region 15580806..15580963 FT /rpt_family="Alu" FT repeat_region 15581981..15582282 FT /rpt_family="Alu" FT repeat_region 15583258..15583739 FT /rpt_family="L1" FT repeat_region 15583792..15583941 FT /rpt_family="L1" FT repeat_region 15585291..15585602 FT /rpt_family="Alu" FT repeat_region 15587376..15587568 FT /rpt_family="L1" FT repeat_region 15587569..15587646 FT /rpt_family="MIR" FT repeat_region 15588243..15588354 FT /rpt_family="L2" FT repeat_region 15588623..15588653 FT /rpt_family="MIR" FT repeat_region 15588654..15588994 FT /rpt_family="MER1_type" FT repeat_region 15588995..15589138 FT /rpt_family="MIR" FT repeat_region 15590315..15590489 FT /rpt_family="MIR" FT repeat_region 15590508..15590549 FT /rpt_family="AT_rich" FT repeat_region 15591392..15591438 FT /rpt_family="(TA)n" FT repeat_region 15591529..15591609 FT /rpt_family="MIR" FT repeat_region 15591825..15591855 FT /rpt_family="MIR" FT repeat_region 15591856..15592146 FT /rpt_family="Alu" FT repeat_region 15592147..15592338 FT /rpt_family="MIR" FT repeat_region 15592355..15592649 FT /rpt_family="Alu" FT repeat_region 15592843..15593141 FT /rpt_family="Alu" FT repeat_region 15593297..15593318 FT /rpt_family="AT_rich" FT repeat_region 15593866..15594600 FT /rpt_family="L2" FT repeat_region 15594916..15595897 FT /rpt_family="L2" FT repeat_region 15596160..15596384 FT /rpt_family="MaLR" FT repeat_region 15596423..15596724 FT /rpt_family="Alu" FT repeat_region 15596729..15596871 FT /rpt_family="L2" FT repeat_region 15596880..15597030 FT /rpt_family="L2" FT repeat_region 15597046..15597280 FT /rpt_family="MIR" FT repeat_region 15597630..15597684 FT /rpt_family="(CATA)n" FT repeat_region 15598159..15598332 FT /rpt_family="MER1_type" FT repeat_region 15598362..15598451 FT /rpt_family="L1" FT repeat_region 15598475..15598680 FT /rpt_family="L1" FT repeat_region 15598728..15598788 FT /rpt_family="L2" FT repeat_region 15599470..15599640 FT /rpt_family="MIR" FT repeat_region 15600000..15600204 FT /rpt_family="MIR" FT repeat_region 15600501..15600792 FT /rpt_family="Alu" FT repeat_region 15601889..15601986 FT /rpt_family="MaLR" FT repeat_region 15602017..15602238 FT /rpt_family="MaLR" FT repeat_region 15602245..15602555 FT /rpt_family="Alu" FT repeat_region 15604206..15604491 FT /rpt_family="Alu" FT repeat_region 15608756..15608949 FT /rpt_family="L1" FT repeat_region 15609561..15609742 FT /rpt_family="MER2_type" FT repeat_region 15610872..15610924 FT /rpt_family="AT_rich" FT repeat_region 15613720..15613761 FT /rpt_family="AT_rich" FT repeat_region 15613833..15613854 FT /rpt_family="AT_rich" FT repeat_region 15614403..15614994 FT /rpt_family="L1" FT repeat_region 15618563..15618882 FT /rpt_family="L1" FT repeat_region 15618883..15619194 FT /rpt_family="Alu" FT repeat_region 15619195..15619613 FT /rpt_family="L1" FT repeat_region 15619614..15619870 FT /rpt_family="L1" FT repeat_region 15619876..15619980 FT /rpt_family="Alu" FT repeat_region 15620044..15620181 FT /rpt_family="L1" FT repeat_region 15620182..15620475 FT /rpt_family="Alu" FT repeat_region 15620476..15620510 FT /rpt_family="L1" FT repeat_region 15620511..15620794 FT /rpt_family="Alu" FT repeat_region 15620795..15621327 FT /rpt_family="L1" FT repeat_region 15621334..15621435 FT /rpt_family="Alu" FT repeat_region 15621460..15621544 FT /rpt_family="L1" FT repeat_region 15621560..15621711 FT /rpt_family="Alu" FT repeat_region 15621734..15622179 FT /rpt_family="L1" FT repeat_region 15622182..15622253 FT /rpt_family="L1" FT repeat_region 15622254..15622766 FT /rpt_family="ERVK" FT repeat_region 15622767..15623022 FT /rpt_family="L1" FT gene complement(15626875..15657013) FT /gene="FBXL5" FT mRNA complement(join(15626875..15627600,15628496..15628578, FT 15629508..15629656,15632289..15632414,15638117..15638299, FT 15640131..15640317,15642411..15642506,15646116..15646331, FT 15656827..15657013)) FT /gene="FBXL5" FT CDS complement(join(<15626875..15627600,15628496..15628578, FT 15629508..15629656,15632289..15632414,15638117..15638299, FT 15640131..15640317,15642411..15642506,15646116..15646331, FT 15656827..15656910)) FT /codon_start=1 FT /gene="FBXL5" FT /product="unknown" FT /note="Homo sapiens F-box and leucine-rich repeat protein 5 FT (FBXL5), transcript variant 1, mRNA.; H_NH0115L11.1 This FT gene was based on gi(21536438) Continues as H_NH0799M12.1" FT /protein_id="AAY40929.1" FT /translation="MAPFPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQ FT SLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYE FT QLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKD FT TAELLRGLSLWNHAEERQKFFKYSVDEKSDKEAEVSEHSTGITHLPPEVMLSIFSYLNP FT QELCRCSQVSMKWSQLTKTGSLWKHLYPVHWARGDWYSGPATELDTEPDDEWVKNRKDE FT SRAFHEWDEDADIDESEESAEESIAISIAQMEKRLLHGLIHNVLPYVGTSVKTLVLAYS FT SAVSSKMVRQILELCPNLEHLDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDV FT ALEKISRALGILTSHQSGFLKTSTSKITSTAWKNKDITMQSTKQYACLHDLTNKGIGEE FT IDNEHPWTKPVSSENFTSPYVWMLDAEDLADIEDTVEWRHRNVESLCVMETASNFSCST FT SGCFSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTMSSLPESSAMCRKAART FT RLPRGKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGL" FT misc_feature 15656365..15657739 FT /note="CpG_island (%GC=71.1, o/e=0.77, #CpGs=152)" FT misc_feature 15682922..15683601 FT /note="CpG_island (%GC=65.9, o/e=0.76, #CpGs=59)" FT misc_feature 15703284..15703517 FT /note="CpG_island (%GC=60.7, o/e=0.95, #CpGs=20)" FT misc_feature 15704550..15705000 FT /note="CpG_island (%GC=67.0, o/e=0.75, #CpGs=46)" FT gene 15704641..15733795 FT /gene="BST1" FT mRNA join(15704641..15704955,15707138..15707264, FT 15709134..15709269,15713430..15713512,15716908..15716984, FT 15717330..15717422,15720530..15720616,15724498..15724557, FT 15733363..15733795) FT /gene="BST1" FT CDS join(15704768..15704955,15707138..15707264, FT 15709134..15709269,15713430..15713512,15716908..15716984, FT 15717330..15717422,15720530..15720616,15724498..15724557, FT 15733363..15733468) FT /codon_start=1 FT /gene="BST1" FT /product="unknown" FT /note="Homo sapiens bone marrow stromal cell antigen 1 FT (BST1), mRNA.; H_NH0115L11.2 This gene was based on FT gi(4757873)" FT /protein_id="AAY40930.1" FT /translation="MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRD FT IFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRD FT KSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDC FT ENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRI FT EIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCA FT LKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL" FT misc_feature complement(15736352..15942982) FT /note="Finishing Completed at Stanford Human Genome Center; FT www-shgc.stanford.edu; Quality: Phrap Quality >=40 99.7% of FT Sequence; Estimated Total Number of Errors is 0.6.; STS FT Content:; SHGC-9823 G11336; SHGC-31590 G28538; SHGC-50808 FT G33802; WI-9983 G11674" FT misc_feature complement(15864161..16030903) FT /note="Quality: Phrap Quality >=40 99.8% of Sequence; FT Estimated Total Number of Errors is 0.7.; STS Content:; FT SHGC-5751 G16721; SHGC-50844 G33894; SHGC-7038 G16753; FT SHGC-5785 G16724; SHGC-9823 G11336" FT misc_feature 16030683..16031065 FT /note="similar to Homo sapiens EST BG980923 FT (NID:g14383658)" FT repeat_region 16032387..16032683 FT /rpt_family="Alu" FT repeat_region 16033217..16033306 FT /rpt_family="GA-rich" FT misc_feature 16033786..16034310 FT /note="match to EST AA553657 (NID:g2324196) nk79c09.s1" FT misc_feature 16034927..16035127 FT /note="match to EST W25808 (NID:g1305949)" FT misc_feature 16034932..16035132 FT /note="match to EST BG468504 (NID:g13400774)" FT misc_feature 16035035..16035132 FT /note="match to EST BF763710 (NID:g12111610)" FT repeat_region 16035207..16035472 FT /rpt_family="Alu" FT repeat_region 16035518..16035551 FT /rpt_family="(TA)n" FT repeat_region 16035926..16036054 FT /rpt_family="MIR" FT repeat_region 16036490..16036599 FT /rpt_family="MIR" FT misc_feature 16037569 FT /note="match to EST BF931354 (NID:g12348678)" FT misc_feature 16037578..16037747 FT /note="match to EST BF931354 (NID:g12348678)" FT misc_feature 16037588..16037849 FT /note="match to EST BF931667 (NID:g12348991)" FT repeat_region 16037767..16037840 FT /rpt_family="L2" FT misc_feature 16037774..16038154 FT /note="match to EST BG958997 (NID:g14377168)" FT repeat_region 16038299..16038381 FT /rpt_family="ERVL" FT repeat_region 16040016..16040323 FT /rpt_family="Alu" FT misc_feature 16040569..16040624 FT /note="match to EST BE925977 (NID:g10452053)" FT /note="match to EST BG468504 (NID:g13400774)" FT misc_feature 16040569..16040637 FT /note="match to EST BF763710 (NID:g12111610)" FT repeat_region 16041079..16041336 FT /rpt_family="Alu" FT repeat_region 16042222..16042409 FT /rpt_family="MIR" FT repeat_region 16042522..16042558 FT /rpt_family="(CAAAAA)n" FT repeat_region 16042663..16043110 FT /rpt_family="MER1_type" FT repeat_region 16043119..16043427 FT /rpt_family="Alu" FT repeat_region 16043491..16043736 FT /rpt_family="Alu" FT repeat_region 16043739..16044055 FT /rpt_family="MER1_type" FT repeat_region 16044056..16044215 FT /rpt_family="L1" FT repeat_region 16044216..16044790 FT /rpt_family="MER1_type" FT repeat_region 16044934..16045089 FT /rpt_family="Alu" FT repeat_region 16046599..16046632 FT /rpt_family="L2" FT repeat_region 16046768..16047153 FT /rpt_family="MaLR" FT repeat_region 16048576..16048827 FT /rpt_family="ERVL" FT repeat_region 16048833..16049126 FT /rpt_family="Alu" FT repeat_region 16049218..16049311 FT /rpt_family="ERVL" FT repeat_region 16051064..16051109 FT /rpt_family="AT_rich" FT repeat_region 16051334..16051382 FT /rpt_family="AT_rich" FT repeat_region 16051383..16051603 FT /rpt_family="Mariner" FT repeat_region 16051604..16051894 FT /rpt_family="Alu" FT repeat_region 16051895..16051980 FT /rpt_family="Mariner" FT repeat_region 16051981..16052278 FT /rpt_family="Alu" FT repeat_region 16052279..16052452 FT /rpt_family="Mariner" FT repeat_region 16052521..16052907 FT /rpt_family="L2" FT repeat_region 16052914..16053014 FT /rpt_family="MIR" FT repeat_region 16054028..16054100 FT /rpt_family="L1" FT repeat_region 16054101..16054402 FT /rpt_family="Alu" FT repeat_region 16054403..16054645 FT /rpt_family="L1" FT repeat_region 16054634..16054781 FT /rpt_family="L1" FT repeat_region 16054787..16054891 FT /rpt_family="L1" FT repeat_region 16055065..16055418 FT /rpt_family="L1" FT repeat_region 16055436..16055733 FT /rpt_family="Alu" FT repeat_region 16056001..16056134 FT /rpt_family="AcHobo" FT repeat_region 16056135..16056251 FT /rpt_family="MIR" FT repeat_region 16056870..16056942 FT /rpt_family="Alu" FT repeat_region 16057005..16057132 FT /rpt_family="MIR" FT repeat_region 16057604..16057927 FT /rpt_family="L2" FT repeat_region 16058017..16058397 FT /rpt_family="L2" FT misc_feature 16058504..16058949 FT /note="match to EST W26210 (NID:g1306621)" FT repeat_region 16059977..16060030 FT /rpt_family="L1" FT repeat_region 16060031..16060288 FT /rpt_family="Alu" FT repeat_region 16060289..16060461 FT /rpt_family="L1" FT repeat_region 16060793..16060922 FT /rpt_family="MIR" FT repeat_region 16060972..16061044 FT /rpt_family="L1" FT repeat_region 16061045..16061301 FT /rpt_family="Alu" FT repeat_region 16061302..16061808 FT /rpt_family="L1" FT repeat_region 16061934..16062170 FT /rpt_family="Alu" FT repeat_region 16062246..16062302 FT /rpt_family="L2" FT repeat_region 16063276..16063506 FT /rpt_family="MaLR" FT misc_feature 16063492..16063565 FT /note="match to EST BE002812 (NID:g8263045)" FT repeat_region 16063507..16063813 FT /rpt_family="Alu" FT misc_feature 16063515..16063530 FT /note="match to EST BG259386 (NID:g12769202)" FT repeat_region 16063814..16063995 FT /rpt_family="MaLR" FT repeat_region 16064466..16064531 FT /rpt_family="L1" FT repeat_region 16064601..16064938 FT /rpt_family="L1" FT repeat_region 16064939..16065226 FT /rpt_family="Alu" FT repeat_region 16065227..16065635 FT /rpt_family="L1" FT repeat_region 16065656..16066222 FT /rpt_family="L1" FT repeat_region 16066223..16066252 FT /rpt_family="AT_rich" FT repeat_region 16066266..16066539 FT /rpt_family="Alu" FT repeat_region 16066540..16066637 FT /rpt_family="MER1_type" FT repeat_region 16066954..16067076 FT /rpt_family="L2" FT repeat_region 16067283..16067365 FT /rpt_family="MIR" FT repeat_region 16067414..16067835 FT /rpt_family="MaLR" FT repeat_region 16067945..16068157 FT /rpt_family="MIR" FT repeat_region 16068841..16068960 FT /rpt_family="MIR" FT repeat_region 16068958..16069094 FT /rpt_family="MIR" FT misc_feature 16069351..16069356 FT /note="match to EST AA625057 (NID:g2537442) af66f07.r1" FT repeat_region 16069838..16070340 FT /rpt_family="ERV1" FT repeat_region 16070577..16070889 FT /rpt_family="Alu" FT misc_feature 16070830..16071181 FT /note="match to EST BE002812 (NID:g8263045)" FT repeat_region 16071216..16071312 FT /rpt_family="MIR" FT repeat_region 16071344..16071756 FT /rpt_family="ERV1" FT repeat_region 16071802..16071918 FT /rpt_family="ERV1" FT repeat_region 16071920..16072202 FT /rpt_family="ERV1" FT misc_feature 16071952..16071960 FT /note="similar to Homo sapiens EST AV658137 (NID:g9879151)" FT repeat_region 16072600..16072686 FT /rpt_family="MIR" FT repeat_region 16073055..16073445 FT /rpt_family="MaLR" FT repeat_region 16074058..16074807 FT /rpt_family="ERV1" FT misc_feature 16074674..16075046 FT /note="match to EST BG957961 (NID:g14376132)" FT repeat_region 16075736..16075989 FT /rpt_family="L1" FT misc_feature 16077310..16077741 FT /note="match to EST BG468504 (NID:g13400774)" FT misc_feature 16077310..16077576 FT /note="match to EST BE925977 (NID:g10452053)" FT misc_feature 16077325..16077373 FT /note="match to EST BF763710 (NID:g12111610)" FT misc_feature 16077412..16077741 FT /note="similar to Homo sapiens EST BG258221 FT (NID:g12768037)" FT misc_feature 16077623..16077753 FT /note="match to EST AW997495 (NID:g8257729)" FT repeat_region 16078027..16078243 FT /rpt_family="MIR" FT repeat_region 16078281..16079252 FT /rpt_family="ERVK" FT repeat_region 16079820..16079898 FT /rpt_family="L2" FT misc_feature 16081276..16081538 FT /note="match to EST AW884924 (NID:g8046936)" FT repeat_region 16081281..16081360 FT /rpt_family="MER1_type" FT repeat_region 16081599..16081796 FT /rpt_family="Alu" FT repeat_region 16081864..16082165 FT /rpt_family="Alu" FT repeat_region 16082651..16082693 FT /rpt_family="(TA)n" FT repeat_region 16082694..16082913 FT /rpt_family="L1" FT repeat_region 16082914..16083229 FT /rpt_family="L1" FT misc_feature 16083364..16083785 FT /note="match to EST BF326646 (NID:g11297394)" FT repeat_region 16083865..16083940 FT /rpt_family="Mariner" FT misc_feature 16084196..16085735 FT /note="CpG_island (%GC=66.6, o/e=0.90, #CpGs=135)" FT repeat_region 16084958..16084982 FT /rpt_family="(CCCCCA)n" FT misc_feature 16085601..16085975 FT /note="similar to Homo sapiens EST BG258221 FT (NID:g12768037)" FT misc_feature 16085601..16085624 FT /note="match to EST BG468504 (NID:g13400774)" FT misc_feature 16085612..16085646 FT /note="match to EST AW997495 (NID:g8257729)" FT repeat_region 16085929..16085975 FT /rpt_family="(CAAAA)n" FT repeat_region 16086324..16086383 FT /rpt_family="L2" FT repeat_region 16086608..16086942 FT /rpt_family="MaLR" FT repeat_region 16087118..16087227 FT /rpt_family="MIR" FT repeat_region 16087267..16087859 FT /rpt_family="L1" FT repeat_region 16088096..16088568 FT /rpt_family="L1" FT repeat_region 16088571..16090748 FT /rpt_family="L1" FT repeat_region 16090749..16090856 FT /rpt_family="L1" FT repeat_region 16090893..16091090 FT /rpt_family="MIR" FT repeat_region 16091572..16091684 FT /rpt_family="MIR" FT repeat_region 16091964..16092011 FT /rpt_family="GA-rich" FT repeat_region 16093342..16093483 FT /rpt_family="L2" FT repeat_region 16093498..16093647 FT /rpt_family="MIR" FT repeat_region 16094060..16094140 FT /rpt_family="ERV1" FT repeat_region 16095732..16095793 FT /rpt_family="(GA)n" FT repeat_region 16096454..16096887 FT /rpt_family="ERV1" FT repeat_region 16096888..16097100 FT /rpt_family="Alu" FT repeat_region 16097101..16097391 FT /rpt_family="ERV1" FT repeat_region 16101411..16101711 FT /rpt_family="Alu" FT repeat_region 16101960..16102073 FT /rpt_family="Alu" FT repeat_region 16102080..16102122 FT /rpt_family="(TAA)n" FT repeat_region 16102124..16103096 FT /rpt_family="L1" FT repeat_region 16103104..16103296 FT /rpt_family="ERV1" FT repeat_region 16103883..16103956 FT /rpt_family="MER1_type" FT repeat_region 16104116..16104166 FT /rpt_family="MER1_type" FT repeat_region 16104199..16104334 FT /rpt_family="MIR" FT repeat_region 16104984..16105115 FT /rpt_family="MIR" FT repeat_region 16105157..16105251 FT /rpt_family="MIR" FT repeat_region 16105274..16105386 FT /rpt_family="L2" FT repeat_region 16105458..16105887 FT /rpt_family="MaLR" FT repeat_region 16105892..16106028 FT /rpt_family="MIR" FT repeat_region 16106107..16106214 FT /rpt_family="L2" FT repeat_region 16106343..16106442 FT /rpt_family="L2" FT repeat_region 16107343..16107671 FT /rpt_family="MaLR" FT repeat_region 16107882..16108082 FT /rpt_family="MIR" FT misc_feature 16108169..16108172 FT /note="match to EST AW996537 (NID:g8256771)" FT repeat_region 16108821..16108967 FT /rpt_family="ERVL" FT repeat_region 16109193..16109327 FT /rpt_family="MER1_type?" FT misc_feature 16109236..16109755 FT /note="match to EST AW996537 (NID:g8256771)" FT repeat_region 16109386..16109508 FT /rpt_family="L2" FT repeat_region 16111169..16111288 FT /rpt_family="L2" FT repeat_region 16111315..16111458 FT /rpt_family="MIR" FT repeat_region 16111478..16111757 FT /rpt_family="Alu" FT repeat_region 16111775..16111962 FT /rpt_family="(GGA)n" FT repeat_region 16111965..16112006 FT /rpt_family="GA-rich" FT repeat_region 16112106..16112283 FT /rpt_family="L2" FT repeat_region 16112357..16112509 FT /rpt_family="MIR" FT repeat_region 16112866..16113202 FT /rpt_family="MER2_type" FT repeat_region 16113308..16113481 FT /rpt_family="MIR" FT repeat_region 16113836..16114013 FT /rpt_family="MIR" FT repeat_region 16114231..16114415 FT /rpt_family="(GGGA)n" FT repeat_region 16114775..16114867 FT /rpt_family="MIR" FT repeat_region 16114933..16114954 FT /rpt_family="AT_rich" FT repeat_region 16114955..16115238 FT /rpt_family="Alu" FT repeat_region 16115546..16115658 FT /rpt_family="MIR" FT repeat_region 16116194..16116324 FT /rpt_family="MIR" FT repeat_region 16117039..16117164 FT /rpt_family="L2" FT repeat_region 16117165..16117552 FT /rpt_family="MaLR" FT repeat_region 16117553..16117731 FT /rpt_family="L2" FT repeat_region 16117887..16117969 FT /rpt_family="L2" FT repeat_region 16119171..16119319 FT /rpt_family="L1" FT repeat_region 16120267..16120453 FT /rpt_family="MIR" FT repeat_region 16120588..16120895 FT /rpt_family="Alu" FT repeat_region 16121398..16121831 FT /rpt_family="L2" FT repeat_region 16123691..16123993 FT /rpt_family="MaLR" FT repeat_region 16123994..16124272 FT /rpt_family="ERV1" FT repeat_region 16124390..16124734 FT /rpt_family="ERV1" FT repeat_region 16124735..16124842 FT /rpt_family="MaLR" FT repeat_region 16124844..16124948 FT /rpt_family="MIR" FT repeat_region 16125349..16125496 FT /rpt_family="MIR" FT repeat_region 16125478..16125552 FT /rpt_family="L2" FT misc_feature 16125907..16126239 FT /note="match to EST AI379625 (NID:g4189478) tc54e08.x1" FT misc_feature 16126163..16126239 FT /note="match to EST AA625057 (NID:g2537442) af66f07.r1" FT repeat_region 16126341..16126603 FT /rpt_family="L1" FT misc_feature 16126566..16126733 FT /note="match to EST AA625057 (NID:g2537442) af66f07.r1" FT misc_feature 16126566..16126728 FT /note="match to EST AI379625 (NID:g4189478) tc54e08.x1" FT repeat_region 16126897..16127044 FT /rpt_family="MIR" FT repeat_region 16127180..16127286 FT /rpt_family="MIR" FT misc_feature 16127394..16127641 FT /note="match to EST AA625057 (NID:g2537442) af66f07.r1" FT repeat_region 16128587..16128814 FT /rpt_family="MIR" FT repeat_region 16130371..16130451 FT /rpt_family="MIR" FT repeat_region 16130454..16130590 FT /rpt_family="MaLR" FT repeat_region 16131316..16131343 FT /rpt_family="(CA)n" FT repeat_region 16131581..16131895 FT /rpt_family="Alu" FT repeat_region 16132611..16132970 FT /rpt_family="Alu" FT repeat_region 16133418..16133726 FT /rpt_family="Alu" FT repeat_region 16133751..16134483 FT /rpt_family="L1" FT repeat_region 16134872..16134892 FT /rpt_family="AT_rich" FT repeat_region 16135492..16135674 FT /rpt_family="MaLR" FT repeat_region 16135696..16135839 FT /rpt_family="MaLR" FT repeat_region 16135818..16135948 FT /rpt_family="MaLR" FT repeat_region 16136637..16136801 FT /rpt_family="AcHobo" FT repeat_region 16137295..16137839 FT /rpt_family="ERVL" FT repeat_region 16137947..16138069 FT /rpt_family="MIR" FT repeat_region 16139053..16139413 FT /rpt_family="MaLR" FT repeat_region 16139415..16139518 FT /rpt_family="L2" FT repeat_region 16139522..16139860 FT /rpt_family="MER2_type" FT repeat_region 16139880..16140000 FT /rpt_family="L2" FT repeat_region 16140166..16140425 FT /rpt_family="MER2_type" FT repeat_region 16140807..16140963 FT /rpt_family="Alu" FT repeat_region 16141567..16142023 FT /rpt_family="MaLR" FT repeat_region 16143072..16143534 FT /rpt_family="ERVL" FT repeat_region 16144719..16145412 FT /rpt_family="L1" FT repeat_region 16145416..16146057 FT /rpt_family="L1" FT repeat_region 16146062..16146276 FT /rpt_family="L1" FT repeat_region 16146277..16147292 FT /rpt_family="ERVK" FT repeat_region 16147293..16147339 FT /rpt_family="L1" FT repeat_region 16147513..16147610 FT /rpt_family="ERV1" FT repeat_region 16147611..16147983 FT /rpt_family="ERV1" FT repeat_region 16148188..16148269 FT /rpt_family="MIR" FT repeat_region 16148271..16148424 FT /rpt_family="Alu" FT repeat_region 16148435..16148595 FT /rpt_family="MIR" FT repeat_region 16148625..16148937 FT /rpt_family="L1" FT repeat_region 16149015..16149295 FT /rpt_family="Alu" FT repeat_region 16150510..16150652 FT /rpt_family="MIR" FT repeat_region 16150890..16150963 FT /rpt_family="MIR" FT repeat_region 16151463..16151525 FT /rpt_family="MIR" FT repeat_region 16151857..16152169 FT /rpt_family="Alu" FT repeat_region 16153200..16153254 FT /rpt_family="MaLR" FT repeat_region 16153553..16153722 FT /rpt_family="MIR" FT repeat_region 16154773..16154873 FT /rpt_family="AT_rich" FT repeat_region 16155003..16155325 FT /rpt_family="L1" FT repeat_region 16155338..16155625 FT /rpt_family="L1" FT repeat_region 16155909..16156082 FT /rpt_family="Alu" FT repeat_region 16156392..16156527 FT /rpt_family="MIR" FT repeat_region 16156622..16156918 FT /rpt_family="Alu" FT repeat_region 16157832..16158176 FT /rpt_family="L2" FT misc_feature 16158584..16158589 FT /note="match to EST BE223037 (NID:g8910355) hu46c11.x1" FT repeat_region 16158637..16158689 FT /rpt_family="MER1_type" FT repeat_region 16158694..16158985 FT /rpt_family="Alu" FT repeat_region 16159000..16159135 FT /rpt_family="MER1_type" FT repeat_region 16159186..16159270 FT /rpt_family="MIR" FT repeat_region 16159516..16159647 FT /rpt_family="MIR" FT repeat_region 16160152..16160224 FT /rpt_family="L2" FT repeat_region 16161607..16162019 FT /rpt_family="MaLR" FT misc_feature 16162128..16162484 FT /note="match to EST N27146 (NID:g1141494) yx98f03.s1" FT misc_feature 16162129..16162713 FT /note="match to EST AW977927 (NID:g8169186)" FT repeat_region 16162248..16162333 FT /rpt_family="L2" FT misc_feature 16162359..16162361 FT /note="match to EST H12331 (NID:g877151) yj11f06.s1" FT misc_feature 16162668..16162917 FT /note="match to EST AA465518 (NID:g2191685) aa32a08.s1" FT misc_feature 16162909..16163325 FT /note="match to EST AA652990 (NID:g2584642) ns62h01.s1" FT misc_feature 16162913..16163050 FT /note="match to EST BG259386 (NID:g12769202)" FT misc_feature 16162914..16163293 FT /note="match to EST AA493335 (NID:g2223176) nh55f04.s1" FT misc_feature 16162914..16163135 FT /note="match to EST AI972460 (NID:g5769376) wr40a03.x1" FT misc_feature 16162920..16163091 FT /note="match to EST AI032195 (NID:g3250407) or96d05.s1" FT misc_feature 16162920..16163575 FT /note="match to EST AW969499 (NID:g8159343)" FT misc_feature 16162938..16163305 FT /note="match to EST R85968 (NID:g944374) yt66g06.s1" FT misc_feature 16163022..16163565 FT /note="similar to Felis catus EST AW646741 (NID:g7405354)" FT misc_feature 16163204..16163611 FT /note="match to EST AI972460 (NID:g5769376) wr40a03.x1" FT misc_feature 16163256..16163729 FT /note="match to EST BE223037 (NID:g8910355) hu46c11.x1" FT misc_feature 16163283..16163325 FT /note="match to EST AV648259 (NID:g9869273)" FT misc_feature 16163361..16163756 FT /note="match to EST AA397807 (NID:g2051015) zt88f09.r1" FT misc_feature 16163382..16163731 FT /note="match to EST AV648259 (NID:g9869273)" FT misc_feature 16163433..16164061 FT /note="match to EST BE546224 (NID:g9774869)" FT misc_feature 16163482..16163774 FT /note="match to EST BI018332 (NID:g14424962)" FT misc_feature 16163978..16164438 FT /note="match to EST AW195631 (NID:g6474793) xn40a04.x1" FT misc_feature 16164011..16164501 FT /note="similar to Bos taurus EST BE754744 (NID:g10168736)" FT misc_feature 16164064..16164442 FT /note="match to EST R15368 (NID:g769641) yf90d06.r1" FT repeat_region 16164292..16164316 FT /rpt_family="AT_rich" FT misc_feature 16164350..16165107 FT /note="similar to Mus musculus EST BI555895 FT (NID:g15443209)" FT misc_feature 16164368..16164688 FT /note="match to EST AI381532 (NID:g4194313) te76d09.x1" FT misc_feature 16164370..16164906 FT /note="match to EST BE218018 (NID:g8905424) hv34d03.x1" FT misc_feature 16164377..16164793 FT /note="match to EST H12331 (NID:g877151) yj11f06.s1" FT misc_feature 16164421..16165160 FT /note="match to EST BG210148 (NID:g13731835)" FT misc_feature 16164517..16164925 FT /note="similar to Homo sapiens EST AA149874 (NID:g1721044) FT zo02e02.r1" FT misc_feature 16164599..16165160 FT /note="match to EST AV723596 (NID:g10827154)" FT misc_feature 16164648..16165081 FT /note="match to EST R84945 (NID:g943351) yt65g06.r1" FT misc_feature 16164746..16165160 FT /note="match to EST AV724515 (NID:g10828978)" FT misc_feature 16164761..16164782 FT /note="match to EST AV706288 (NID:g10723574)" FT repeat_region 16164813..16164845 FT /rpt_family="AT_rich" FT misc_feature 16164835..16165160 FT /note="match to EST AV706288 (NID:g10723574)" FT misc_feature 16164881..16165160 FT /note="match to EST AA164390 (NID:g1741337) zp04d10.r1" FT misc_feature 16164888..16165160 FT /note="match to EST BG260876 (NID:g12770692)" FT misc_feature 16164893..16165160 FT /note="similar to Mus musculus EST AW049285 (NID:g5909814)" FT misc_feature 16164947..16165160 FT /note="similar to EST BM457357 (NID:g18506397)" FT misc_feature 16164956..16165147 FT /note="match to EST BG200273 (NID:g13721960)" FT misc_feature 16165134..16165160 FT /note="match to EST BE835849 (NID:g10268136)" FT misc_feature 16165138..16165160 FT /note="similar to Mus musculus EST AW825669 (NID:g7918746) FT us20e04.y1" FT misc_feature 16165167..16165341 FT /note="similar to Homo sapiens EST BE008993 (NID:g8269226)" FT misc_feature 16165450..16165451 FT /note="match to EST BG210148 (NID:g13731835)" FT repeat_region 16165633..16165655 FT /rpt_family="(CAAA)n" FT repeat_region 16165764..16165808 FT /rpt_family="L1" FT misc_feature 16165799..16166093 FT /note="match to EST AA376932 (NID:g2029249)" FT repeat_region 16165809..16165952 FT /rpt_family="L1" FT misc_feature 16165873..16165876 FT /note="similar to Homo sapiens EST AI859406 (NID:g5513022) FT wm11b07.x1" FT repeat_region 16166222..16166356 FT /rpt_family="Alu" FT repeat_region 16166912..16167209 FT /rpt_family="Alu" FT repeat_region 16167303..16167786 FT /rpt_family="L2" FT misc_feature 16168255..16168416 FT /note="similar to Mus musculus EST BF138505 FT (NID:g10977545)" FT misc_feature 16168256..16168367 FT /note="similar to Mus musculus EST AW049285 (NID:g5909814)" FT misc_feature 16168256..16168416 FT /note="similar to EST BM457357 (NID:g18506397)" FT /note="match to EST BG260876 (NID:g12770692)" FT /note="similar to Mus musculus EST AW825669 (NID:g7918746) FT us20e04.y1" FT /note="match to EST AV706288 (NID:g10723574)" FT /note="match to EST BE835849 (NID:g10268136)" FT misc_feature 16168256..16168379 FT /note="match to EST AV724515 (NID:g10828978)" FT misc_feature 16168256..16168376 FT /note="match to EST AV723596 (NID:g10827154)" FT misc_feature 16168256..16168347 FT /note="match to EST AA164390 (NID:g1741337) zp04d10.r1" FT misc_feature 16168257..16168416 FT /note="similar to Mus musculus EST BI690488 FT (NID:g15653117)" FT misc_feature 16168265..16168416 FT /note="similar to Homo sapiens EST BF926881 FT (NID:g12324609)" FT misc_feature 16168287..16168416 FT /note="match to EST H12382 (NID:g877202) yj11f06.r1" FT repeat_region 16168610..16168913 FT /rpt_family="Alu" FT misc_feature 16168957..16169210 FT /note="match to EST AI868854 (NID:g5542858) wc49c03.x1" FT repeat_region 16169195..16169344 FT /rpt_family="MIR" FT repeat_region 16169352..16169664 FT /rpt_family="L1" FT repeat_region 16169739..16170026 FT /rpt_family="Alu" FT repeat_region 16170072..16170400 FT /rpt_family="L2" FT misc_feature 16170239..16170587 FT /note="match to EST AA211182 (NID:g1809905) zp33h12.r1" FT misc_feature 16170610..16171207 FT /note="match to EST BF513629 (NID:g11598808)" FT repeat_region 16171381..16171453 FT /rpt_family="L2" FT misc_feature 16172259..16172352 FT /note="similar to Mus musculus EST BB616427 FT (NID:g15396089)" FT /note="similar to Bos taurus EST AW478282 (NID:g7048388)" FT misc_feature 16172276..16172352 FT /note="similar to EST BM457357 (NID:g18506397)" FT /note="similar to Mus musculus EST BI690488 FT (NID:g15653117)" FT /note="similar to Mus musculus EST BF138505 FT (NID:g10977545)" FT /note="match to EST BG260876 (NID:g12770692)" FT /note="match to EST H12382 (NID:g877202) yj11f06.r1" FT /note="similar to Mus musculus EST AW825669 (NID:g7918746) FT us20e04.y1" FT /note="match to EST AV706288 (NID:g10723574)" FT misc_feature 16172276..16172363 FT /note="match to EST BE835849 (NID:g10268136)" FT /note="similar to Homo sapiens EST BF926881 FT (NID:g12324609)" FT misc_feature 16172716..16173081 FT /note="match to EST AI220278 (NID:g3802481) qg73d05.x1" FT misc_feature 16173230..16173331 FT /note="similar to Homo sapiens EST AV658137 (NID:g9879151)" FT misc_feature 16173381..16173897 FT /note="similar to Homo sapiens EST AV658137 (NID:g9879151)" FT repeat_region 16174435..16174746 FT /rpt_family="Alu" FT repeat_region 16174824..16174885 FT /rpt_family="Alu" FT repeat_region 16175037..16175171 FT /rpt_family="Alu" FT repeat_region 16175267..16175499 FT /rpt_family="L1" FT misc_feature 16175827..16175895 FT /note="similar to EST BM457357 (NID:g18506397)" FT /note="similar to Mus musculus EST BI690488 FT (NID:g15653117)" FT /note="similar to Mus musculus EST BB616427 FT (NID:g15396089)" FT /note="similar to Bos taurus EST AW478282 (NID:g7048388)" FT /note="match to EST BG260876 (NID:g12770692)" FT /note="match to EST H12382 (NID:g877202) yj11f06.r1" FT /note="similar to Mus musculus EST AW825669 (NID:g7918746) FT us20e04.y1" FT /note="match to EST AV706288 (NID:g10723574)" FT misc_feature 16175833..16175854 FT /note="similar to Homo sapiens EST BF926881 FT (NID:g12324609)" FT misc_feature 16176107..16176108 FT /note="match to EST BG483369 (NID:g13415648)" FT misc_feature 16176292..16176352 FT /note="match to EST AA689396 (NID:g2689749) ns16c04.r2" FT misc_feature 16176293..16176352 FT /note="similar to EST BM457357 (NID:g18506397)" FT /note="similar to Mus musculus EST BI690488 FT (NID:g15653117)" FT /note="similar to Mus musculus EST BF138505 FT (NID:g10977545)" FT /note="similar to Mus musculus EST BB616427 FT (NID:g15396089)" FT /note="similar to Bos taurus EST AW478282 (NID:g7048388)" FT /note="match to EST BG260876 (NID:g12770692)" FT /note="match to EST H12382 (NID:g877202) yj11f06.r1" FT /note="similar to Mus musculus EST AW825669 (NID:g7918746) FT us20e04.y1" FT misc_feature 16176293..16176316 FT /note="match to EST AV706288 (NID:g10723574)" FT misc_feature 16176388..16177076 FT /note="match to EST BG483369 (NID:g13415648)" FT repeat_region 16176420..16176447 FT /rpt_family="AT_rich" FT repeat_region 16176661..16176712 FT /rpt_family="AT_rich" FT misc_feature 16177245..16177465 FT /note="match to EST AA299928 (NID:g1952258)" FT repeat_region 16177374..16177398 FT /rpt_family="AT_rich" FT misc_feature 16177742..16177851 FT /note="similar to Mus musculus EST BI690488 FT (NID:g15653117)" FT /note="similar to EST BM457357 (NID:g18506397)" FT /note="similar to Mus musculus EST BB616427 FT (NID:g15396089)" FT /note="similar to Mus musculus EST BF138505 FT (NID:g10977545)" FT /note="match to EST AA689396 (NID:g2689749) ns16c04.r2" FT misc_feature 16177742..16177808 FT /note="similar to Bos taurus EST AW478282 (NID:g7048388)" FT /note="match to EST BG260876 (NID:g12770692)" FT misc_feature 16177742..16177803 FT /note="match to EST H12382 (NID:g877202) yj11f06.r1" FT misc_feature 16177742..16177774 FT /note="similar to Mus musculus EST AW825669 (NID:g7918746) FT us20e04.y1" FT repeat_region 16178054..16178336 FT /rpt_family="Alu" FT repeat_region 16178339..16178437 FT /rpt_family="L2" FT misc_feature 16178498..16178501 FT /note="match to EST H12382 (NID:g877202) yj11f06.r1" FT repeat_region 16178676..16178903 FT /rpt_family="L1" FT repeat_region 16179145..16179210 FT /rpt_family="MIR" FT repeat_region 16179239..16179365 FT /rpt_family="MIR" FT repeat_region 16180269..16180335 FT /rpt_family="L2" FT repeat_region 16180706..16181064 FT /rpt_family="MER2_type" FT misc_feature 16181104..16181280 FT /note="match to EST BF445571 (NID:g11510709)" FT misc_feature 16181109..16181522 FT /note="similar to Homo sapiens EST AI859406 (NID:g5513022) FT wm11b07.x1" FT misc_feature 16181200..16181280 FT /note="similar to EST BM457357 (NID:g18506397)" FT /note="similar to Mus musculus EST BI690488 FT (NID:g15653117)" FT /note="similar to Mus musculus EST BF138505 FT (NID:g10977545)" FT /note="similar to Mus musculus EST BB616427 FT (NID:g15396089)" FT /note="match to EST AA689396 (NID:g2689749) ns16c04.r2" FT misc_feature 16181201..16181280 FT /note="similar to Rattus sp. EST AI231447 (NID:g4135648)" FT repeat_region 16181383..16181425 FT /rpt_family="(TG)n" FT repeat_region 16181426..16181450 FT /rpt_family="(TG)n" FT misc_feature 16181582 FT /note="similar to Homo sapiens EST AI859406 (NID:g5513022) FT wm11b07.x1" FT repeat_region 16183203..16183490 FT /rpt_family="Alu" FT misc_feature 16184934..16185462 FT /note="match to EST BF515556 (NID:g11600735)" FT repeat_region 16185659..16186830 FT /rpt_family="L1" FT repeat_region 16186831..16186993 FT /rpt_family="MER1_type" FT repeat_region 16186994..16187291 FT /rpt_family="Alu" FT repeat_region 16187292..16187354 FT /rpt_family="MER1_type" FT repeat_region 16187500..16187643 FT /rpt_family="MER1_type" FT repeat_region 16187768..16187906 FT /rpt_family="MIR" FT repeat_region 16188762..16188842 FT /rpt_family="L2" FT repeat_region 16190262..16190559 FT /rpt_family="Alu" FT repeat_region 16190822..16191085 FT /rpt_family="L2" FT repeat_region 16191081..16191323 FT /rpt_family="MIR" FT repeat_region 16191961..16192261 FT /rpt_family="Alu" FT repeat_region 16192737..16192821 FT /rpt_family="MER1_type" FT repeat_region 16193514..16194017 FT /rpt_family="L1" FT repeat_region 16195878..16196080 FT /rpt_family="MIR" FT repeat_region 16196483..16196519 FT /rpt_family="(TTC)n" FT repeat_region 16196522..16196651 FT /rpt_family="Alu" FT repeat_region 16200185..16200209 FT /rpt_family="AT_rich" FT repeat_region 16201220..16201506 FT /rpt_family="Alu" FT repeat_region 16201949..16202247 FT /rpt_family="Alu" FT repeat_region 16202977..16203007 FT /rpt_family="AT_rich" FT repeat_region 16203353..16203517 FT /rpt_family="MIR" FT repeat_region 16203913..16203942 FT /rpt_family="AT_rich" FT repeat_region 16204995..16205094 FT /rpt_family="MaLR" FT repeat_region 16205104..16205428 FT /rpt_family="MaLR" FT repeat_region 16206046..16206073 FT /rpt_family="AT_rich" FT repeat_region 16207970..16208035 FT /rpt_family="MIR" FT repeat_region 16209171..16209267 FT /rpt_family="MIR" FT repeat_region 16209797..16209839 FT /rpt_family="AT_rich" FT repeat_region 16210002..16210409 FT /rpt_family="MaLR" FT repeat_region 16210498..16210704 FT /rpt_family="Alu" FT repeat_region 16211372..16211484 FT /rpt_family="MIR" FT repeat_region 16212182..16212317 FT /rpt_family="MIR" FT repeat_region 16212725..16212745 FT /rpt_family="AT_rich" FT repeat_region 16213307..16213402 FT /rpt_family="MER1_type" FT repeat_region 16216633..16216931 FT /rpt_family="Alu" FT repeat_region 16218052..16218928 FT /rpt_family="L2" FT repeat_region 16219744..16220035 FT /rpt_family="Alu" FT repeat_region 16220700..16220863 FT /rpt_family="MIR" FT repeat_region 16221297..16221509 FT /rpt_family="MIR" FT repeat_region 16222126..16222389 FT /rpt_family="Alu" FT repeat_region 16222455..16222527 FT /rpt_family="Alu" FT repeat_region 16222528..16222656 FT /rpt_family="Alu" FT repeat_region 16222745..16223048 FT /rpt_family="Alu" FT misc_feature 16227526..16229145 FT /note="CpG_island (%GC=73.5, o/e=0.90, #CpGs=207)" FT repeat_region 16227693..16228176 FT /rpt_family="L1" FT repeat_region 16228177..16228197 FT /rpt_family="(CCG)n" FT repeat_region 16228198..16228249 FT /rpt_family="L1" FT repeat_region 16228250..16228273 FT /rpt_family="(CCG)n" FT repeat_region 16228274..16228511 FT /rpt_family="L1" FT repeat_region 16228294..16228648 FT /rpt_family="L1" FT repeat_region 16229990..16230000 FT /rpt_family="GA-rich" FT repeat_region 16230001..16230315 FT /rpt_family="Alu" FT repeat_region 16230316..16230387 FT /rpt_family="GA-rich" FT repeat_region 16231669..16231814 FT /rpt_family="MIR" FT repeat_region 16232033..16232177 FT /rpt_family="MIR" FT misc_feature complement(16233612..16412135) FT /note="Quality: Phrap Quality >=40 99.9% of Sequence; FT Estimated Total Number of Errors is 0.1.; STS Content:; FT SHGC-33956 G29584; SHGC4-1650 G05155" FT repeat_region 16410519..16410598 FT /rpt_family="(TA)n" FT repeat_region 16411494..16411533 FT /rpt_family="L2" FT repeat_region 16412357..16412393 FT /rpt_family="CT-rich" FT repeat_region 16412579..16412890 FT /rpt_family="Alu" FT repeat_region 16413775..16414071 FT /rpt_family="Alu" FT repeat_region 16414110..16414399 FT /rpt_family="Alu" FT repeat_region 16414543..16414630 FT /rpt_family="MIR" FT repeat_region 16415085..16415375 FT /rpt_family="L1" FT repeat_region 16415398..16416526 FT /rpt_family="L1" FT repeat_region 16416547..16417033 FT /rpt_family="L1" FT repeat_region 16417034..16417454 FT /rpt_family="MaLR" FT repeat_region 16417455..16417940 FT /rpt_family="L1" FT repeat_region 16417826..16417861 FT /rpt_family="(TG)n" FT repeat_region 16418852..16419223 FT /rpt_family="MaLR" FT misc_feature 16419885..16420335 FT /note="match to EST AL119046 (NID:g5924945)" FT repeat_region 16420159..16420355 FT /rpt_family="MER1_type" FT repeat_region 16420489..16420647 FT /rpt_family="MER1_type" FT repeat_region 16420657..16420873 FT /rpt_family="MIR" FT repeat_region 16421050..16421069 FT /rpt_family="(T)n" FT repeat_region 16421307..16422275 FT /rpt_family="L1" FT repeat_region 16422500..16422786 FT /rpt_family="ERVL" FT misc_feature 16422675..16422756 FT /note="match to EST AW303390 (NID:g6713070) xv18e02.x1" FT repeat_region 16424764..16424792 FT /rpt_family="(TAAAAA)n" FT repeat_region 16425248..16425658 FT /rpt_family="ERVL" FT repeat_region 16425683..16425943 FT /rpt_family="L2" FT repeat_region 16426008..16426947 FT /rpt_family="L1" FT repeat_region 16426936..16427015 FT /rpt_family="(TA)n" FT repeat_region 16426999..16427907 FT /rpt_family="L1" FT repeat_region 16427909..16428052 FT /rpt_family="L1" FT misc_feature 16427976..16428063 FT /note="match to EST AI190918 (NID:g3742127) qd61g07.x1" FT misc_feature 16427988..16428063 FT /note="match to EST AW303390 (NID:g6713070) xv18e02.x1" FT repeat_region 16428066..16428928 FT /rpt_family="L1" FT repeat_region 16429344..16429549 FT /rpt_family="MIR" FT repeat_region 16429764..16430164 FT /rpt_family="MaLR" FT repeat_region 16430453..16430495 FT /rpt_family="MIR" FT repeat_region 16430496..16430706 FT /rpt_family="MER1_type" FT repeat_region 16430707..16430827 FT /rpt_family="MIR" FT repeat_region 16430912..16430936 FT /rpt_family="AT_rich" FT repeat_region 16430924..16431546 FT /rpt_family="L1" FT repeat_region 16431642..16431822 FT /rpt_family="MIR" FT repeat_region 16431880..16432208 FT /rpt_family="Alu" FT repeat_region 16432187..16432209 FT /rpt_family="(TAAAA)n" FT repeat_region 16432426..16432901 FT /rpt_family="MaLR" FT misc_feature 16432665..16433207 FT /note="match to EST AI633369 (NID:g4684699) ts96d04.x1" FT repeat_region 16433198..16433220 FT /rpt_family="AT_rich" FT repeat_region 16433855..16433883 FT /rpt_family="(TG)n" FT repeat_region 16433990..16434124 FT /rpt_family="MIR" FT repeat_region 16434343..16434440 FT /rpt_family="MIR" FT repeat_region 16434857..16435170 FT /rpt_family="Alu" FT repeat_region 16435143..16435171 FT /rpt_family="(CAAAAA)n" FT misc_feature 16435680..16435865 FT /note="match to EST AW303390 (NID:g6713070) xv18e02.x1" FT misc_feature 16435973 FT /note="match to EST AW303390 (NID:g6713070) xv18e02.x1" FT repeat_region 16436625..16436999 FT /rpt_family="MaLR" FT repeat_region 16437005..16437504 FT /rpt_family="ERVL" FT repeat_region 16438555..16438695 FT /rpt_family="MIR" FT repeat_region 16438746..16438839 FT /rpt_family="MIR" FT repeat_region 16438849..16439366 FT /rpt_family="ERVL" FT repeat_region 16439420..16440008 FT /rpt_family="ERV1" FT repeat_region 16441898..16442114 FT /rpt_family="MIR" FT repeat_region 16442115..16442161 FT /rpt_family="MIR" FT repeat_region 16442267..16442350 FT /rpt_family="(TTCC)n" FT repeat_region 16442420..16442471 FT /rpt_family="(GGAA)n" FT repeat_region 16442473..16442597 FT /rpt_family="ERVL" FT repeat_region 16442598..16442660 FT /rpt_family="CT-rich" FT repeat_region 16442753..16442840 FT /rpt_family="L2" FT repeat_region 16443061..16443106 FT /rpt_family="(CATATA)n" FT repeat_region 16443194..16443313 FT /rpt_family="ERVL" FT repeat_region 16443335..16443370 FT /rpt_family="(TA)n" FT repeat_region 16443378..16443444 FT /rpt_family="MaLR" FT repeat_region 16443477..16443565 FT /rpt_family="(TA)n" FT repeat_region 16443480..16443545 FT /rpt_family="L1" FT repeat_region 16444225..16444311 FT /rpt_family="ERVL" FT repeat_region 16444409..16444596 FT /rpt_family="ERVL" FT repeat_region 16444727..16444779 FT /rpt_family="AT_rich" FT repeat_region 16444812..16445115 FT /rpt_family="Alu" FT repeat_region 16445170..16445250 FT /rpt_family="MaLR" FT repeat_region 16445334..16445879 FT /rpt_family="L2" FT repeat_region 16446256..16446598 FT /rpt_family="MaLR" FT repeat_region 16446665..16446818 FT /rpt_family="MaLR" FT repeat_region 16446823..16446946 FT /rpt_family="L1" FT repeat_region 16447122..16447547 FT /rpt_family="MaLR" FT repeat_region 16447577..16447995 FT /rpt_family="L1" FT repeat_region 16448075..16448102 FT /rpt_family="AT_rich" FT repeat_region 16448091..16448388 FT /rpt_family="L1" FT repeat_region 16448692..16448747 FT /rpt_family="AT_rich" FT repeat_region 16448994..16449319 FT /rpt_family="L1" FT repeat_region 16449293..16449322 FT /rpt_family="AT_rich" FT repeat_region 16449436..16449464 FT /rpt_family="AT_rich" FT repeat_region 16450094..16450242 FT /rpt_family="MIR" FT repeat_region 16453027..16453048 FT /rpt_family="(T)n" FT repeat_region 16453457..16453593 FT /rpt_family="MaLR" FT repeat_region 16453594..16453888 FT /rpt_family="Alu" FT repeat_region 16453889..16454156 FT /rpt_family="MaLR" FT repeat_region 16454213..16454336 FT /rpt_family="MIR" FT repeat_region 16454407..16454693 FT /rpt_family="Alu" FT repeat_region 16455474..16455521 FT /rpt_family="(CA)n" FT repeat_region 16455515..16455690 FT /rpt_family="MIR" FT repeat_region 16455741..16455971 FT /rpt_family="L1" FT repeat_region 16455972..16456068 FT /rpt_family="L1" FT repeat_region 16456048..16456078 FT /rpt_family="AT_rich" FT repeat_region 16459264..16459374 FT /rpt_family="CT-rich" FT repeat_region 16459380..16459653 FT /rpt_family="Alu" FT repeat_region 16459802..16460567 FT /rpt_family="ERV1" FT repeat_region 16461074..16461622 FT /rpt_family="ERV1" FT repeat_region 16462007..16462164 FT /rpt_family="MIR" FT repeat_region 16462470..16462500 FT /rpt_family="AT_rich" FT repeat_region 16462523..16462624 FT /rpt_family="L2" FT repeat_region 16463693..16463876 FT /rpt_family="MIR" FT repeat_region 16463878..16464186 FT /rpt_family="Alu" FT repeat_region 16464159..16464196 FT /rpt_family="(A)n" FT repeat_region 16464640..16464681 FT /rpt_family="MIR" FT repeat_region 16465072..16465255 FT /rpt_family="MER1_type" FT repeat_region 16465305..16465492 FT /rpt_family="Alu" FT repeat_region 16465493..16465600 FT /rpt_family="MER1_type" FT repeat_region 16465847..16466183 FT /rpt_family="ERVL" FT repeat_region 16466344..16466884 FT /rpt_family="ERV1" FT misc_feature 16466978..16467537 FT /note="match to EST AA528334 (NID:g2270403) ne83b05.s1" FT repeat_region 16467392..16467441 FT /rpt_family="CR1" FT repeat_region 16467549..16467859 FT /rpt_family="Alu" FT repeat_region 16467830..16467862 FT /rpt_family="(A)n" FT repeat_region 16467895..16468002 FT /rpt_family="MIR" FT repeat_region 16468085..16468143 FT /rpt_family="MIR" FT repeat_region 16468272..16468357 FT /rpt_family="MIR" FT repeat_region 16468652..16468782 FT /rpt_family="MIR" FT repeat_region 16469059..16469422 FT /rpt_family="MaLR" FT repeat_region 16469576..16469802 FT /rpt_family="MIR" FT repeat_region 16469798..16469823 FT /rpt_family="AT_rich" FT repeat_region 16469862..16469976 FT /rpt_family="MIR" FT repeat_region 16470170..16470310 FT /rpt_family="MER1_type" FT repeat_region 16470488..16471490 FT /rpt_family="L1" FT repeat_region 16471500..16471523 FT /rpt_family="(GA)n" FT repeat_region 16471595..16471990 FT /rpt_family="L1" FT repeat_region 16471991..16472316 FT /rpt_family="MER2_type" FT repeat_region 16472317..16472403 FT /rpt_family="L1" FT repeat_region 16472475..16472618 FT /rpt_family="L1" FT repeat_region 16472713..16473101 FT /rpt_family="MaLR" FT repeat_region 16473195..16473485 FT /rpt_family="L1" FT repeat_region 16473582..16474070 FT /rpt_family="L1" FT repeat_region 16474071..16474290 FT /rpt_family="MER1_type" FT repeat_region 16474291..16475526 FT /rpt_family="L1" FT repeat_region 16475530..16476590 FT /rpt_family="Mariner" FT repeat_region 16476524..16476558 FT /rpt_family="AT_rich" FT repeat_region 16476597..16476745 FT /rpt_family="L1" FT repeat_region 16476731..16477572 FT /rpt_family="L1" FT repeat_region 16477577..16477649 FT /rpt_family="MIR" FT repeat_region 16479134..16479290 FT /rpt_family="MIR" FT repeat_region 16479218..16479245 FT /rpt_family="AT_rich" FT repeat_region 16479366..16479554 FT /rpt_family="ERVL" FT repeat_region 16479602..16479762 FT /rpt_family="ERVL" FT repeat_region 16479798..16479878 FT /rpt_family="L2" FT repeat_region 16479929..16480297 FT /rpt_family="MaLR" FT repeat_region 16480338..16480523 FT /rpt_family="L2" FT repeat_region 16480836..16481183 FT /rpt_family="MaLR" FT repeat_region 16481638..16482014 FT /rpt_family="MaLR" FT repeat_region 16483060..16483176 FT /rpt_family="MIR" FT repeat_region 16483320..16483498 FT /rpt_family="(TCTA)n" FT repeat_region 16483861..16483899 FT /rpt_family="(ATG)n" FT repeat_region 16483951..16484146 FT /rpt_family="MIR" FT repeat_region 16484169..16484202 FT /rpt_family="(ATG)n" FT repeat_region 16484210..16484447 FT /rpt_family="MIR" FT repeat_region 16485107..16485310 FT /rpt_family="ERVL" FT repeat_region 16485321..16485653 FT /rpt_family="MER1_type" FT repeat_region 16485452..16485486 FT /rpt_family="AT_rich" FT repeat_region 16485654..16485751 FT /rpt_family="ERVL" FT repeat_region 16485789..16486046 FT /rpt_family="ERVL" FT repeat_region 16486056..16486187 FT /rpt_family="MER1_type" FT repeat_region 16486193..16486272 FT /rpt_family="MIR" FT repeat_region 16486308..16486380 FT /rpt_family="L2" FT repeat_region 16487668..16488007 FT /rpt_family="L2" FT misc_feature 16488806..16489217 FT /note="match to EST AW297170 (NID:g6703796)" FT repeat_region 16489578..16489934 FT /rpt_family="MaLR" FT repeat_region 16490445..16490483 FT /rpt_family="(T)n" FT misc_feature 16490473..16490754 FT /note="match to EST AI950722 (NID:g5743032) wx54c06.x1" FT repeat_region 16491774..16491850 FT /rpt_family="MaLR" FT repeat_region 16492289..16492615 FT /rpt_family="MaLR" FT repeat_region 16492707..16493143 FT /rpt_family="L1" FT repeat_region 16493196..16493365 FT /rpt_family="MIR" FT repeat_region 16493464..16493491 FT /rpt_family="AT_rich" FT repeat_region 16493667..16493737 FT /rpt_family="L1" FT repeat_region 16493741..16494014 FT /rpt_family="L1" FT repeat_region 16493956..16494017 FT /rpt_family="AT_rich" FT repeat_region 16494015..16494150 FT /rpt_family="Alu" FT repeat_region 16494151..16494506 FT /rpt_family="L1" FT repeat_region 16494386..16494409 FT /rpt_family="AT_rich" FT repeat_region 16495159..16495181 FT /rpt_family="(T)n" FT repeat_region 16495620..16495920 FT /rpt_family="Alu" FT repeat_region 16496237..16496345 FT /rpt_family="MIR" FT repeat_region 16496722..16497037 FT /rpt_family="L1" FT repeat_region 16497523..16497597 FT /rpt_family="MIR" FT repeat_region 16497609..16497963 FT /rpt_family="MaLR" FT repeat_region 16498074..16498233 FT /rpt_family="MIR" FT repeat_region 16498260..16498510 FT /rpt_family="MER1_type" FT repeat_region 16498539..16498858 FT /rpt_family="MaLR" FT repeat_region 16499149..16499349 FT /rpt_family="MaLR" FT repeat_region 16499351..16499731 FT /rpt_family="MaLR" FT repeat_region 16499943..16500171 FT /rpt_family="L2" FT repeat_region 16500221..16500550 FT /rpt_family="MaLR" FT repeat_region 16500689..16500749 FT /rpt_family="MaLR" FT repeat_region 16500791..16501160 FT /rpt_family="MaLR" FT repeat_region 16501317..16501387 FT /rpt_family="L1" FT repeat_region 16501377..16501433 FT /rpt_family="(TAAAAA)n" FT repeat_region 16501577..16502048 FT /rpt_family="ERVL" FT repeat_region 16501921..16501967 FT /rpt_family="AT_rich" FT repeat_region 16502287..16502397 FT /rpt_family="MIR" FT repeat_region 16502405..16502503 FT /rpt_family="L2" FT repeat_region 16502572..16503046 FT /rpt_family="ERVL" FT misc_feature 16503160..16503612 FT /note="match to EST AI375446 (NID:g4175436) tc25b10.x1" FT misc_feature 16503160..16503575 FT /note="match to EST AA628698 (NID:g2541085) af30h02.s1" FT misc_feature 16503165..16503586 FT /note="similar to Mus musculus EST BB676806 FT (NID:g15976027)" FT misc_feature 16503167..16503454 FT /note="similar to Mus musculus EST AV078332 (NID:g5198160)" FT misc_feature 16503167..16503611 FT /note="match to EST AI768595 (NID:g5235104) wh23g06.x1" FT misc_feature 16503168..16503395 FT /note="match to EST H73914 (NID:g1046915) ys15c06.s1" FT misc_feature 16503191..16503816 FT /note="match to EST AL515866 (NID:g12779359)" FT misc_feature 16503198..16503733 FT /note="match to EST BF437895 (NID:g11450412)" FT misc_feature 16503272..16504133 FT /note="similar to Homo sapiens EST AL566389 FT (NID:g12918700)" FT misc_feature 16503473..16503752 FT /note="match to EST BF090992 (NID:g10896702)" FT misc_feature 16503491..16503994 FT /note="similar to Rattus norvegicus EST BF551481 FT (NID:g11661211)" FT misc_feature 16503561..16504036 FT /note="match to EST BE048244 (NID:g8365297) tz49a05.y1" FT misc_feature 16503580..16504348 FT /note="match to EST BG529966 (NID:g13521503)" FT misc_feature 16503783..16504346 FT /note="similar to Sus scrofa EST BF703382 (NID:g11988790)" FT misc_feature 16503792..16504289 FT /note="match to EST AW156933 (NID:g6228334) au89g04.x1" FT misc_feature 16503795..16504091 FT /note="match to EST AA114246 (NID:g1668157) zn76g01.s1" FT misc_feature 16503800..16504006 FT /note="match to EST R37540 (NID:g794996) yh93c07.r1" FT misc_feature 16503863..16504381 FT /note="similar to Mus musculus EST BE135200 (NID:g8597700) FT ug28b12.y1" FT misc_feature 16503881..16504598 FT /note="match to EST BI818700 (NID:g15930250)" FT misc_feature 16503898..16504317 FT /note="match to EST D81012 (NID:g1178889)" FT misc_feature 16503911..16503937 FT /note="match to EST AI768595 (NID:g5235104) wh23g06.x1" FT misc_feature 16504091..16504496 FT /note="similar to Rattus norvegicus EST BF397537 FT (NID:g11382520)" FT misc_feature 16504271..16504437 FT /note="match to EST BF431983 (NID:g11444097)" FT misc_feature 16504272..16504496 FT /note="similar to EST BG808121 (NID:g17955096)" FT misc_feature 16504312..16504496 FT /note="similar to EST BI990068 (NID:g17961075)" FT misc_feature 16504368..16504754 FT /note="match to EST T89244 (NID:g717757) ye12g05.r1" FT misc_feature 16504390..16504496 FT /note="match to EST BG217326 (NID:g13743347)" FT misc_feature 16504398..16504754 FT /note="similar to Rattus norvegicus EST BF398216 FT (NID:g11383203)" FT misc_feature 16504440..16504496 FT /note="match to EST AU125035 (NID:g10949751)" FT repeat_region 16504761..16504795 FT /rpt_family="AT_rich" FT misc_feature 16504850..16505402 FT /note="similar to Sus scrofa EST BF080204 (NID:g10874034)" FT repeat_region 16505663..16505703 FT /rpt_family="CR1" FT misc_feature 16505922..16506113 FT /note="match to EST AA331388 (NID:g1983651)" FT repeat_region 16506957..16507016 FT /rpt_family="(TG)n" FT misc_feature 16507463..16507605 FT /note="match to EST AU125035 (NID:g10949751)" FT misc_feature 16507463..16507517 FT /note="match to EST T89244 (NID:g717757) ye12g05.r1" FT misc_feature 16507463..16507570 FT /note="similar to Rattus norvegicus EST BF398216 FT (NID:g11383203)" FT repeat_region 16508182..16508295 FT /rpt_family="MER1_type" FT repeat_region 16508319..16508460 FT /rpt_family="L2" FT misc_feature 16509472 FT /note="match to EST BG981314 (NID:g14384049)" FT misc_feature 16509511..16509938 FT /note="match to EST BG981314 (NID:g14384049)" FT misc_feature 16509636..16509920 FT /note="match to EST BF375821 (NID:g11337859)" FT misc_feature 16509863..16510312 FT /note="similar to Bos taurus EST AW344916 (NID:g6842626)" FT misc_feature 16510158..16510309 FT /note="match to EST AU125035 (NID:g10949751)" FT /note="match to EST BG217326 (NID:g13743347)" FT misc_feature 16510158..16510209 FT /note="similar to Rattus norvegicus EST BF397537 FT (NID:g11382520)" FT misc_feature 16510164..16510309 FT /note="similar to EST BI990068 (NID:g17961075)" FT /note="similar to EST BG808121 (NID:g17955096)" FT misc_feature 16510178..16510309 FT /note="match to EST BF988098 (NID:g12394423)" FT misc_feature 16510221..16510306 FT /note="similar to Homo sapiens EST BG211909 FT (NID:g13733596)" FT misc_feature 16510278..16510309 FT /note="match to EST AI968108 (NID:g5764926) wu13c01.x1" FT repeat_region 16511177..16511286 FT /rpt_family="MIR" FT repeat_region 16511457..16511761 FT /rpt_family="Alu" FT repeat_region 16511810..16511865 FT /rpt_family="L2" FT repeat_region 16512391..16512482 FT /rpt_family="L2" FT repeat_region 16512822..16512853 FT /rpt_family="AT_rich" FT repeat_region 16513103..16513203 FT /rpt_family="CT-rich" FT repeat_region 16513261..16513428 FT /rpt_family="MIR" FT misc_feature 16513558..16513810 FT /note="match to EST AI190918 (NID:g3742127) qd61g07.x1" FT misc_feature 16513604..16513665 FT /note="similar to Homo sapiens EST BG211909 FT (NID:g13733596)" FT misc_feature 16513604..16513744 FT /note="similar to EST BG808121 (NID:g17955096)" FT misc_feature 16513604..16513739 FT /note="similar to EST BI990068 (NID:g17961075)" FT /note="match to EST BF988098 (NID:g12394423)" FT /note="match to EST AU125035 (NID:g10949751)" FT /note="match to EST AI968108 (NID:g5764926) wu13c01.x1" FT /note="match to EST BG217326 (NID:g13743347)" FT misc_feature 16513693..16513739 FT /note="similar to Homo sapiens EST BG211909 FT (NID:g13733596)" FT repeat_region 16513944..16514000 FT /rpt_family="(CA)n" FT repeat_region 16514065..16514106 FT /rpt_family="A-rich" FT repeat_region 16514810..16515121 FT /rpt_family="L2" FT repeat_region 16515194..16515318 FT /rpt_family="MER1_type" FT repeat_region 16515370..16515960 FT /rpt_family="ERV1" FT repeat_region 16516545..16517063 FT /rpt_family="L1" FT repeat_region 16517453..16517506 FT /rpt_family="(TTTA)n" FT repeat_region 16517480..16517786 FT /rpt_family="Alu" FT repeat_region 16517796..16517922 FT /rpt_family="MIR" FT repeat_region 16518019..16518107 FT /rpt_family="L2" FT repeat_region 16519493..16519551 FT /rpt_family="(TGGA)n" FT repeat_region 16520208..16520315 FT /rpt_family="MER1_type" FT repeat_region 16520982..16521079 FT /rpt_family="MIR" FT repeat_region 16521178..16521237 FT /rpt_family="MIR" FT repeat_region 16521262..16521407 FT /rpt_family="MIR" FT repeat_region 16522596..16522745 FT /rpt_family="ERVL" FT repeat_region 16522747..16523196 FT /rpt_family="MaLR" FT repeat_region 16523208..16523495 FT /rpt_family="ERVL" FT repeat_region 16523588..16523793 FT /rpt_family="MIR" FT repeat_region 16523887..16523928 FT /rpt_family="(TG)n" FT repeat_region 16523930..16524249 FT /rpt_family="MER2_type" FT repeat_region 16524692..16524842 FT /rpt_family="ERVL" FT repeat_region 16524732..16524769 FT /rpt_family="(TATG)n" FT repeat_region 16524808..16524912 FT /rpt_family="MER2_type" FT repeat_region 16524906..16525238 FT /rpt_family="MER2_type" FT repeat_region 16525289..16525517 FT /rpt_family="MER2_type" FT repeat_region 16525805..16526110 FT /rpt_family="L2" FT repeat_region 16527178..16527209 FT /rpt_family="(TTCA)n" FT repeat_region 16527197..16527443 FT /rpt_family="L2" FT repeat_region 16527331..16527351 FT /rpt_family="AT_rich" FT repeat_region 16527474..16527643 FT /rpt_family="MaLR" FT repeat_region 16527644..16528168 FT /rpt_family="ERVL" FT repeat_region 16528162..16528202 FT /rpt_family="(TCTA)n" FT repeat_region 16528208..16528545 FT /rpt_family="MaLR" FT repeat_region 16528587..16528744 FT /rpt_family="MER53" FT repeat_region 16528642..16528698 FT /rpt_family="AT_rich" FT repeat_region 16528753..16528960 FT /rpt_family="L2" FT repeat_region 16528961..16528997 FT /rpt_family="Mariner" FT repeat_region 16528998..16529334 FT /rpt_family="L1" FT repeat_region 16529355..16529576 FT /rpt_family="L1" FT repeat_region 16529593..16529989 FT /rpt_family="L1" FT repeat_region 16529608..16529638 FT /rpt_family="(TA)n" FT repeat_region 16529980..16530001 FT /rpt_family="AT_rich" FT repeat_region 16530000..16530066 FT /rpt_family="Mariner" FT repeat_region 16530086..16530145 FT /rpt_family="L2" FT repeat_region 16530754..16530809 FT /rpt_family="MIR" FT misc_feature 16531725..16532114 FT /note="similar to Homo sapiens EST BI039584 FT (NID:g14446210)" FT repeat_region 16532448..16532556 FT /rpt_family="MIR" FT repeat_region 16532560..16532697 FT /rpt_family="MIR" FT repeat_region 16532715..16532779 FT /rpt_family="L2" FT repeat_region 16534658..16534770 FT /rpt_family="AcHobo" FT repeat_region 16534813..16534886 FT /rpt_family="MIR" FT repeat_region 16534963..16535008 FT /rpt_family="MIR" FT repeat_region 16536167..16536309 FT /rpt_family="L1" FT repeat_region 16537043..16537170 FT /rpt_family="L2" FT repeat_region 16537319..16537569 FT /rpt_family="MIR" FT repeat_region 16538390..16538502 FT /rpt_family="MIR" FT repeat_region 16540041..16540072 FT /rpt_family="(CAAAAA)n" FT repeat_region 16540190..16540324 FT /rpt_family="MIR" FT repeat_region 16540351..16540385 FT /rpt_family="(TTCA)n" FT repeat_region 16540385..16540626 FT /rpt_family="MIR" FT repeat_region 16540826..16541046 FT /rpt_family="L2" FT repeat_region 16541441..16541502 FT /rpt_family="MaLR" FT repeat_region 16541503..16541865 FT /rpt_family="MaLR" FT repeat_region 16542217..16542270 FT /rpt_family="L2" FT repeat_region 16542333..16542361 FT /rpt_family="AT_rich" FT repeat_region 16542741..16543156 FT /rpt_family="MaLR" FT repeat_region 16543787..16544195 FT /rpt_family="L2" FT repeat_region 16544377..16544421 FT /rpt_family="T-rich" FT repeat_region 16544413..16545221 FT /rpt_family="L1" FT repeat_region 16545218..16545555 FT /rpt_family="L1" FT repeat_region 16545591..16546705 FT /rpt_family="L2" FT repeat_region 16546734..16546858 FT /rpt_family="CT-rich" FT repeat_region 16548585..16549047 FT /rpt_family="MaLR" FT repeat_region 16549308..16549504 FT /rpt_family="MIR" FT repeat_region 16549512..16549539 FT /rpt_family="AT_rich" FT repeat_region 16549566..16549598 FT /rpt_family="(T)n" FT repeat_region 16549570..16549745 FT /rpt_family="Alu" FT repeat_region 16550064..16550249 FT /rpt_family="L2" FT repeat_region 16551021..16551323 FT /rpt_family="L2" FT repeat_region 16551719..16551800 FT /rpt_family="MIR" FT repeat_region 16551813..16552041 FT /rpt_family="L2" FT repeat_region 16552194..16552812 FT /rpt_family="L1" FT repeat_region 16553123..16553158 FT /rpt_family="(TTTTTA)n" FT repeat_region 16553129..16553438 FT /rpt_family="Alu" FT repeat_region 16553628..16553688 FT /rpt_family="L2" FT misc_feature 16554629..16554632 FT /note="match to EST BG007875 (NID:g12452496)" FT misc_feature 16554644..16554818 FT /note="match to EST BG007875 (NID:g12452496)" FT repeat_region 16554773..16554793 FT /rpt_family="AT_rich" FT repeat_region 16554774..16555083 FT /rpt_family="Alu" FT repeat_region 16555088..16555147 FT /rpt_family="MIR" FT repeat_region 16555161..16555192 FT /rpt_family="(TTTG)n" FT misc_feature 16555252..16555255 FT /note="match to EST BG007875 (NID:g12452496)" FT repeat_region 16555381..16555577 FT /rpt_family="MIR" FT repeat_region 16555674..16555971 FT /rpt_family="Alu" FT repeat_region 16556125..16556176 FT /rpt_family="MER1_type" FT repeat_region 16556182..16556708 FT /rpt_family="L1" FT repeat_region 16556764..16556884 FT /rpt_family="MER1_type" FT repeat_region 16557144..16557336 FT /rpt_family="L2" FT misc_feature 16557250..16557460 FT /note="match to EST D63298 (NID:g966967)" FT repeat_region 16557635..16557956 FT /rpt_family="L2" FT repeat_region 16557954..16557997 FT /rpt_family="MIR" FT repeat_region 16564834..16564874 FT /rpt_family="AT_rich" FT repeat_region 16564922..16564953 FT /rpt_family="AT_rich" FT repeat_region 16565053..16565089 FT /rpt_family="(T)n" FT repeat_region 16565060..16565378 FT /rpt_family="Alu" FT misc_feature 16565203..16565205 FT /note="similar to Homo sapiens EST BF847341 FT (NID:g12234491)" FT repeat_region 16565236..16565263 FT /rpt_family="AT_rich" FT misc_feature 16565422..16565659 FT /note="similar to Homo sapiens EST BF847341 FT (NID:g12234491)" FT repeat_region 16565833..16566015 FT /rpt_family="Alu" FT repeat_region 16566745..16566972 FT /rpt_family="MIR" FT repeat_region 16567031..16567442 FT /rpt_family="L1" FT repeat_region 16567374..16567394 FT /rpt_family="AT_rich" FT repeat_region 16567533..16567567 FT /rpt_family="(TATATG)n" FT repeat_region 16567570..16567615 FT /rpt_family="(CA)n" FT repeat_region 16567672..16568105 FT /rpt_family="L1" FT repeat_region 16568426..16568913 FT /rpt_family="L1" FT repeat_region 16568991..16569048 FT /rpt_family="(TG)n" FT repeat_region 16569149..16569411 FT /rpt_family="Alu" FT repeat_region 16569676..16569756 FT /rpt_family="Mariner" FT repeat_region 16570224..16570452 FT /rpt_family="MER2_type" FT repeat_region 16571149..16571197 FT /rpt_family="L2" FT repeat_region 16571276..16571319 FT /rpt_family="(TCCA)n" FT repeat_region 16571411..16571477 FT /rpt_family="MIR" FT repeat_region 16571805..16572115 FT /rpt_family="Alu" FT repeat_region 16572086..16572127 FT /rpt_family="(A)n" FT repeat_region 16572161..16572392 FT /rpt_family="L2" FT repeat_region 16572420..16572602 FT /rpt_family="MIR" FT misc_feature 16572472..16572478 FT /note="match to EST AW156933 (NID:g6228334) au89g04.x1" FT repeat_region 16572617..16572827 FT /rpt_family="L2" FT repeat_region 16572899..16573000 FT /rpt_family="L2" FT misc_feature 16573065..16573261 FT /note="match to EST BF358400 (NID:g11317472)" FT repeat_region 16573194..16573333 FT /rpt_family="MIR" FT misc_feature 16573548..16574010 FT /note="match to EST AI378527 (NID:g4188380) tc63b10.x1" FT misc_feature 16573912..16574236 FT /note="match to EST AA836957 (NID:g2912156) oe97f11.s1" FT repeat_region 16574500..16574556 FT /rpt_family="GA-rich" FT repeat_region 16575114..16575229 FT /rpt_family="MER1_type" FT repeat_region 16575981..16576123 FT /rpt_family="MER1_type" FT repeat_region 16576237..16576342 FT /rpt_family="MIR" FT repeat_region 16576360..16576567 FT /rpt_family="MIR" FT repeat_region 16576666..16576785 FT /rpt_family="L1" FT repeat_region 16577366..16577650 FT /rpt_family="Alu" FT repeat_region 16580759..16580798 FT /rpt_family="AT_rich" FT repeat_region 16581473..16581902 FT /rpt_family="L2" FT repeat_region 16582889..16582960 FT /rpt_family="MIR" FT repeat_region 16583369..16583519 FT /rpt_family="MIR" FT repeat_region 16583536..16583675 FT /rpt_family="(GGAA)n" FT repeat_region 16583681..16583748 FT /rpt_family="MIR" FT repeat_region 16583740..16583897 FT /rpt_family="L2" FT misc_feature 16583814..16584229 FT /note="match to EST AA348262 (NID:g2000498)" FT misc_feature 16584644..16585113 FT /note="match to EST AV748876 (NID:g10906724)" FT misc_feature 16584943..16585287 FT /note="match to EST AA348263 (NID:g2000499)" FT repeat_region 16585696..16585779 FT /rpt_family="L2" FT repeat_region 16585802..16585893 FT /rpt_family="MIR" FT repeat_region 16586018..16586137 FT /rpt_family="MIR" FT misc_feature 16586201..16586603 FT /note="match to EST AA984634 (NID:g3163159) am85h02.s1" FT misc_feature 16586635 FT /note="match to EST AA984634 (NID:g3163159) am85h02.s1" FT misc_feature 16586713..16586889 FT /note="match to EST BI043231 (NID:g14449857)" FT misc_feature 16587099..16587545 FT /note="match to EST AI188205 (NID:g3739414) qd66g01.x1" FT repeat_region 16587546..16587603 FT /rpt_family="ERV1" FT misc_feature 16587663 FT /note="match to EST AI188205 (NID:g3739414) qd66g01.x1" FT repeat_region 16588111..16588174 FT /rpt_family="(CA)n" FT repeat_region 16588645..16588676 FT /rpt_family="L2" FT repeat_region 16588853..16589088 FT /rpt_family="MIR" FT repeat_region 16589343..16589566 FT /rpt_family="MIR" FT repeat_region 16590097..16590119 FT /rpt_family="AT_rich" FT misc_feature 16590332..16590456 FT /note="match to EST BF988098 (NID:g12394423)" FT misc_feature 16590332..16590455 FT /note="match to EST AL515867 (NID:g12779360)" FT /note="match to EST BG217326 (NID:g13743347)" FT /note="match to EST AL603365 (NID:g15166871)" FT /note="match to EST BG211909 (NID:g13733596)" FT /note="match to EST BF740295 (NID:g12066958)" FT misc_feature 16590431..16590445 FT /note="match to EST AA886714 (NID:g3001822) oj52f08.s1" FT repeat_region 16590624..16590769 FT /rpt_family="MIR" FT repeat_region 16591407..16591655 FT /rpt_family="MIR" FT misc_feature 16593146..16593803 FT /note="similar to Mus musculus EST BB463106 FT (NID:g16426840)" FT repeat_region 16594080..16594129 FT /rpt_family="(TA)n" FT repeat_region 16594129..16594155 FT /rpt_family="(CA)n" FT repeat_region 16595089..16595137 FT /rpt_family="A-rich" FT misc_feature 16596718..16596806 FT /note="match to EST BE670122 (NID:g10030663)" FT misc_feature 16597320..16597457 FT /note="match to EST AA886714 (NID:g3001822) oj52f08.s1" FT misc_feature 16597326..16597498 FT /note="match to EST BG211909 (NID:g13733596)" FT /note="match to EST BF740295 (NID:g12066958)" FT /note="match to EST AL603365 (NID:g15166871)" FT /note="match to EST BG217326 (NID:g13743347)" FT /note="match to EST AL515867 (NID:g12779360)" FT misc_feature 16597388..16597498 FT /note="match to EST BI670282 (NID:g15584515)" FT misc_feature 16598004..16598096 FT /note="match to EST BE670122 (NID:g10030663)" FT repeat_region 16598696..16598723 FT /rpt_family="AT_rich" FT repeat_region 16599765..16600244 FT /rpt_family="MaLR" FT misc_feature 16599893..16600199 FT /note="match to EST BE670122 (NID:g10030663)" FT repeat_region 16600488..16600516 FT /rpt_family="(T)n" FT misc_feature 16600499..16600772 FT /note="match to EST AW205040 (NID:g6504512)" FT repeat_region 16600520..16600583 FT /rpt_family="MaLR" FT repeat_region 16600724..16601206 FT /rpt_family="MaLR" FT repeat_region 16601891..16601911 FT /rpt_family="AT_rich" FT repeat_region 16603210..16603231 FT /rpt_family="AT_rich" FT repeat_region 16603625..16603655 FT /rpt_family="AT_rich" FT repeat_region 16603792..16604256 FT /rpt_family="L2" FT repeat_region 16604383..16604443 FT /rpt_family="L2" FT repeat_region 16604602..16604860 FT /rpt_family="CR1" FT repeat_region 16605039..16605475 FT /rpt_family="L1" FT repeat_region 16605488..16605774 FT /rpt_family="Alu" FT repeat_region 16606142..16606170 FT /rpt_family="(TA)n" FT repeat_region 16607436..16607611 FT /rpt_family="MaLR" FT repeat_region 16607977..16608133 FT /rpt_family="L1" FT repeat_region 16609073..16609260 FT /rpt_family="MIR" FT repeat_region 16609310..16609457 FT /rpt_family="L2" FT repeat_region 16609830..16609851 FT /rpt_family="(A)n" FT repeat_region 16615079..16615122 FT /rpt_family="L2" FT repeat_region 16615127..16616411 FT /rpt_family="L1" FT repeat_region 16616194..16616224 FT /rpt_family="(A)n" FT repeat_region 16616412..16616715 FT /rpt_family="Alu" FT repeat_region 16616693..16616715 FT /rpt_family="(A)n" FT repeat_region 16616716..16617363 FT /rpt_family="L1" FT repeat_region 16617352..16617388 FT /rpt_family="AT_rich" FT repeat_region 16617462..16617662 FT /rpt_family="MIR" FT repeat_region 16617684..16617871 FT /rpt_family="L2" FT repeat_region 16617915..16617940 FT /rpt_family="AT_rich" FT repeat_region 16619555..16619711 FT /rpt_family="L2" FT repeat_region 16619763..16619942 FT /rpt_family="MER1_type" FT repeat_region 16619947..16620064 FT /rpt_family="L2" FT repeat_region 16620075..16620160 FT /rpt_family="(TATG)n" FT repeat_region 16620364..16620772 FT /rpt_family="MaLR" FT repeat_region 16621693..16621812 FT /rpt_family="L2" FT repeat_region 16622920..16622997 FT /rpt_family="L2" FT repeat_region 16623161..16623191 FT /rpt_family="AT_rich" FT repeat_region 16623179..16623477 FT /rpt_family="Alu" FT repeat_region 16623586..16623657 FT /rpt_family="Mariner" FT repeat_region 16623932..16623978 FT /rpt_family="L2" FT repeat_region 16624191..16624266 FT /rpt_family="L2" FT repeat_region 16624655..16624767 FT /rpt_family="L2" FT repeat_region 16624939..16625246 FT /rpt_family="Alu" FT repeat_region 16625222..16625256 FT /rpt_family="(TAAA)n" FT repeat_region 16625385..16625410 FT /rpt_family="(CA)n" FT repeat_region 16625738..16625834 FT /rpt_family="L1" FT misc_feature 16625790..16625793 FT /note="match to EST AU121459 (NID:g10936694)" FT repeat_region 16625885..16626014 FT /rpt_family="Alu" FT repeat_region 16626037..16626073 FT /rpt_family="(TAAA)n" FT repeat_region 16626093..16626222 FT /rpt_family="MIR" FT repeat_region 16626479..16626542 FT /rpt_family="CR1" FT repeat_region 16626604..16626755 FT /rpt_family="L2" FT repeat_region 16626773..16626923 FT /rpt_family="L2" FT repeat_region 16627052..16627174 FT /rpt_family="L2" FT repeat_region 16627691..16627819 FT /rpt_family="MIR" FT repeat_region 16628272..16628414 FT /rpt_family="MIR" FT repeat_region 16629101..16629129 FT /rpt_family="(CAT)n" FT repeat_region 16629156..16629267 FT /rpt_family="MIR" FT repeat_region 16629272..16629476 FT /rpt_family="MaLR" FT repeat_region 16629730..16629905 FT /rpt_family="MER121" FT repeat_region 16630259..16631218 FT /rpt_family="L1" FT repeat_region 16634394..16635067 FT /rpt_family="L1" FT repeat_region 16635063..16636922 FT /rpt_family="L1" FT repeat_region 16636971..16637056 FT /rpt_family="MER1_type" FT repeat_region 16637756..16637887 FT /rpt_family="MIR" FT repeat_region 16638923..16638947 FT /rpt_family="(T)n" FT misc_feature 16638948..16639441 FT /note="match to EST AU147267 (NID:g11008788)" FT repeat_region 16639076..16639315 FT /rpt_family="L2" FT repeat_region 16639513..16639746 FT /rpt_family="MIR" FT misc_feature 16639628..16639984 FT /note="match to EST AW511812 (NID:g7149890) xu77e01.x1" FT misc_feature 16639918..16640296 FT /note="match to EST H00764 (NID:g863697) yj30a05.r1" FT misc_feature 16639948..16640833 FT /note="match to EST AU121459 (NID:g10936694)" FT repeat_region 16640295..16640441 FT /rpt_family="L2" FT repeat_region 16640558..16640578 FT /rpt_family="AT_rich" FT repeat_region 16641100..16641380 FT /rpt_family="Alu" FT repeat_region 16642167..16642395 FT /rpt_family="MIR" FT repeat_region 16643003..16643405 FT /rpt_family="MaLR" FT repeat_region 16643798..16644207 FT /rpt_family="L1" FT repeat_region 16644357..16644403 FT /rpt_family="L2" FT repeat_region 16644653..16644737 FT /rpt_family="MER1_type" FT repeat_region 16644756..16644865 FT /rpt_family="MER1_type" FT repeat_region 16644874..16645111 FT /rpt_family="MIR" FT repeat_region 16646043..16646067 FT /rpt_family="(T)n" FT misc_feature 16646043..16646067 FT /note="match to EST BG623344 (NID:g13674715)" FT repeat_region 16646878..16647187 FT /rpt_family="Alu" FT repeat_region 16647167..16647187 FT /rpt_family="(A)n" FT repeat_region 16647355..16647512 FT /rpt_family="MIR" FT misc_feature 16647880..16648334 FT /note="match to EST AI820794 (NID:g5439873) an33h02.x5" FT repeat_region 16648027..16648134 FT /rpt_family="MaLR" FT repeat_region 16648493..16649074 FT /rpt_family="L1" FT repeat_region 16649623..16649746 FT /rpt_family="L2" FT repeat_region 16649757..16649910 FT /rpt_family="MIR" FT repeat_region 16651022..16651052 FT /rpt_family="(GA)n" FT repeat_region 16651196..16651366 FT /rpt_family="MIR" FT repeat_region 16651723..16651969 FT /rpt_family="MIR" FT repeat_region 16652016..16652085 FT /rpt_family="L2" FT repeat_region 16653572..16653864 FT /rpt_family="Alu" FT repeat_region 16657520..16657540 FT /rpt_family="(T)n" FT repeat_region 16658049..16658804 FT /rpt_family="MER1_type" FT repeat_region 16658477..16658517 FT /rpt_family="AT_rich" FT repeat_region 16658841..16658905 FT /rpt_family="MER1_type" FT repeat_region 16658977..16659359 FT /rpt_family="L2" FT repeat_region 16660145..16660322 FT /rpt_family="MER1_type" FT repeat_region 16660345..16660508 FT /rpt_family="MIR" FT repeat_region 16660602..16660636 FT /rpt_family="(CAAA)n" FT repeat_region 16661255..16661334 FT /rpt_family="(TA)n" FT repeat_region 16661603..16661713 FT /rpt_family="MER1_type" FT repeat_region 16661930..16662068 FT /rpt_family="MIR" FT repeat_region 16662092..16662121 FT /rpt_family="(CCA)n" FT repeat_region 16662170..16662256 FT /rpt_family="L2" FT repeat_region 16662994..16663217 FT /rpt_family="MIR" FT repeat_region 16663397..16663538 FT /rpt_family="CR1" FT misc_feature 16663494..16663764 FT /note="match to EST BE169694 (NID:g8632415)" FT repeat_region 16664149..16664518 FT /rpt_family="MaLR" FT repeat_region 16664870..16665079 FT /rpt_family="MER1_type" FT repeat_region 16665214..16665322 FT /rpt_family="L2" FT misc_feature 16665287..16665671 FT /note="match to EST AW451652 (NID:g6992428)" FT repeat_region 16665691..16666043 FT /rpt_family="MaLR" FT misc_feature 16666580..16666725 FT /note="match to EST BF360903 (NID:g11319975)" FT repeat_region 16666872..16666906 FT /rpt_family="(T)n" FT repeat_region 16666877..16667182 FT /rpt_family="Alu" FT misc_feature 16667177..16667178 FT /note="match to EST BE169694 (NID:g8632415)" FT misc_feature 16667191..16667494 FT /note="match to EST AA320287 (NID:g1972776)" FT repeat_region 16667366..16667756 FT /rpt_family="MaLR" FT misc_feature 16667931..16668316 FT /note="match to EST BF851706 (NID:g12238868)" FT repeat_region 16668993..16669132 FT /rpt_family="MIR" FT repeat_region 16669597..16669862 FT /rpt_family="MER1_type" FT repeat_region 16669773..16669793 FT /rpt_family="AT_rich" FT repeat_region 16669983..16670184 FT /rpt_family="CR1" FT repeat_region 16670223..16670287 FT /rpt_family="MIR" FT repeat_region 16670527..16670743 FT /rpt_family="MaLR" FT repeat_region 16670765..16670920 FT /rpt_family="MIR" FT repeat_region 16671182..16671347 FT /rpt_family="MIR" FT repeat_region 16671538..16671725 FT /rpt_family="MER1_type" FT repeat_region 16672262..16672474 FT /rpt_family="MIR" FT repeat_region 16672475..16672531 FT /rpt_family="MIR" FT repeat_region 16672951..16673026 FT /rpt_family="MIR" FT repeat_region 16673703..16673930 FT /rpt_family="MIR" FT repeat_region 16674427..16674452 FT /rpt_family="(CCTG)n" FT repeat_region 16674450..16674690 FT /rpt_family="CT-rich" FT repeat_region 16675267..16675452 FT /rpt_family="MER1_type" FT misc_feature 16675823..16675908 FT /note="match to EST AL515867 (NID:g12779360)" FT repeat_region 16676155..16676278 FT /rpt_family="MIR" FT repeat_region 16676323..16676366 FT /rpt_family="L2" FT repeat_region 16676411..16676454 FT /rpt_family="(CA)n" FT repeat_region 16676701..16676947 FT /rpt_family="L1" FT repeat_region 16677051..16677194 FT /rpt_family="L2" FT repeat_region 16677244..16677264 FT /rpt_family="AT_rich" FT repeat_region 16678107..16678176 FT /rpt_family="L2" FT repeat_region 16678435..16678593 FT /rpt_family="L2" FT repeat_region 16678591..16678748 FT /rpt_family="MIR" FT repeat_region 16679353..16679427 FT /rpt_family="AcHobo" FT repeat_region 16680912..16680977 FT /rpt_family="GA-rich" FT repeat_region 16681030..16681229 FT /rpt_family="MIR" FT repeat_region 16681592..16681932 FT /rpt_family="MaLR" FT repeat_region 16682090..16682327 FT /rpt_family="MIR" FT repeat_region 16682588..16683186 FT /rpt_family="MaLR" FT repeat_region 16683239..16683267 FT /rpt_family="(T)n" FT misc_feature 16683281..16683936 FT /note="match to EST AL079433 (NID:g5423327)" FT repeat_region 16684070..16684158 FT /rpt_family="MIR" FT repeat_region 16685012..16685165 FT /rpt_family="MIR" FT repeat_region 16685336..16685506 FT /rpt_family="MaLR" FT repeat_region 16686432..16686639 FT /rpt_family="MER1_type" FT repeat_region 16686831..16686991 FT /rpt_family="MIR" FT repeat_region 16686995..16687048 FT /rpt_family="(TTTTG)n" FT misc_feature 16687027..16687524 FT /note="match to EST T90347 (NID:g718860) yd43a04.s1" FT misc_feature 16687045..16687747 FT /note="match to EST BG623344 (NID:g13674715)" FT repeat_region 16687111..16687183 FT /rpt_family="MIR" FT repeat_region 16687390..16687682 FT /rpt_family="Alu" FT misc_feature 16687714..16688067 FT /note="match to EST BE011090 (NID:g8271323)" FT misc_feature 16687863..16688622 FT /note="match to EST AL079432 (NID:g5423326)" FT misc_feature 16687931..16688330 FT /note="match to EST BF994535 (NID:g12400858)" FT repeat_region 16687994..16688060 FT /rpt_family="MIR" FT repeat_region 16688349..16688379 FT /rpt_family="(TGAA)n" FT repeat_region 16688798..16689135 FT /rpt_family="MaLR" FT repeat_region 16689666..16689804 FT /rpt_family="MIR" FT repeat_region 16690198..16690218 FT /rpt_family="AT_rich" FT repeat_region 16690532..16690955 FT /rpt_family="ERVL" FT repeat_region 16691184..16691317 FT /rpt_family="MIR" FT repeat_region 16691872..16692081 FT /rpt_family="Alu" FT repeat_region 16692083..16692192 FT /rpt_family="(GGGA)n" FT repeat_region 16692614..16692857 FT /rpt_family="MIR" FT repeat_region 16692894..16692992 FT /rpt_family="L2" FT misc_feature 16694520..16694865 FT /note="match to EST AI253398 (NID:g3850353) aq14b08.x1" FT misc_feature 16694737 FT /note="similar to Homo sapiens EST AW939071 (NID:g8114517)" FT misc_feature 16694853..16694986 FT /note="similar to Homo sapiens EST AW939071 (NID:g8114517)" FT repeat_region 16694968..16694992 FT /rpt_family="(T)n" FT repeat_region 16696362..16696509 FT /rpt_family="MIR" FT repeat_region 16696878..16697111 FT /rpt_family="Alu" FT repeat_region 16697217..16697549 FT /rpt_family="MER1_type" FT misc_feature 16697459..16697989 FT /note="match to EST AA777655 (NID:g2837134) zi95d11.s1" FT repeat_region 16698432..16698565 FT /rpt_family="MER1_type" FT repeat_region 16698765..16699095 FT /rpt_family="Alu" FT repeat_region 16698890..16698926 FT /rpt_family="(CA)n" FT repeat_region 16699362..16699516 FT /rpt_family="L2" FT repeat_region 16699529..16699614 FT /rpt_family="L2" FT repeat_region 16699664..16700274 FT /rpt_family="L1" FT misc_feature 16701343..16702098 FT /note="match to EST BG697848 (NID:g13964523)" FT repeat_region 16701516..16701588 FT /rpt_family="MER53" FT repeat_region 16701589..16701831 FT /rpt_family="MER2_type" FT repeat_region 16701832..16701867 FT /rpt_family="MER53" FT repeat_region 16701971..16701999 FT /rpt_family="AT_rich" FT repeat_region 16702147..16702180 FT /rpt_family="(TTTTA)n" FT repeat_region 16702579..16702738 FT /rpt_family="MIR" FT repeat_region 16703087..16703288 FT /rpt_family="MIR" FT repeat_region 16703321..16703549 FT /rpt_family="MIR" FT repeat_region 16703543..16703634 FT /rpt_family="(CTA)n" FT repeat_region 16704494..16704647 FT /rpt_family="L2" FT repeat_region 16704832..16705006 FT /rpt_family="L2" FT repeat_region 16705157..16705223 FT /rpt_family="MIR" FT repeat_region 16705868..16705966 FT /rpt_family="ERVL" FT repeat_region 16706853..16707076 FT /rpt_family="MaLR" FT repeat_region 16707329..16707418 FT /rpt_family="L2" FT repeat_region 16707839..16708179 FT /rpt_family="MaLR" FT repeat_region 16708347..16708462 FT /rpt_family="L2" FT repeat_region 16709822..16709946 FT /rpt_family="Alu" FT repeat_region 16709937..16709973 FT /rpt_family="AT_rich" FT repeat_region 16710197..16710323 FT /rpt_family="L2" FT repeat_region 16710705..16710798 FT /rpt_family="L2" FT repeat_region 16710795..16710822 FT /rpt_family="AT_rich" FT repeat_region 16711067..16711155 FT /rpt_family="L2" FT repeat_region 16711230..16711524 FT /rpt_family="MER1_type" FT repeat_region 16713138..16713286 FT /rpt_family="L2" FT repeat_region 16713297..16713907 FT /rpt_family="L1" FT repeat_region 16713908..16714202 FT /rpt_family="Alu" FT repeat_region 16714203..16714996 FT /rpt_family="L1" FT repeat_region 16715141..16715351 FT /rpt_family="MIR" FT repeat_region 16716071..16716182 FT /rpt_family="MIR" FT repeat_region 16716220..16716594 FT /rpt_family="MaLR" FT repeat_region 16716651..16716826 FT /rpt_family="MIR" FT repeat_region 16716968..16717006 FT /rpt_family="L2" FT repeat_region 16718470..16718514 FT /rpt_family="AT_rich" FT repeat_region 16718585..16718612 FT /rpt_family="AT_rich" FT repeat_region 16718783..16718818 FT /rpt_family="(TAA)n" FT repeat_region 16719762..16719899 FT /rpt_family="L2" FT repeat_region 16719894..16719920 FT /rpt_family="AT_rich" FT repeat_region 16720255..16720406 FT /rpt_family="MER103" FT repeat_region 16721233..16721318 FT /rpt_family="MaLR" FT repeat_region 16721319..16721390 FT /rpt_family="MIR" FT repeat_region 16721456..16721552 FT /rpt_family="MIR" FT repeat_region 16721725..16722150 FT /rpt_family="ERVL" FT repeat_region 16722465..16722694 FT /rpt_family="CR1" FT repeat_region 16723583..16723603 FT /rpt_family="AT_rich" FT repeat_region 16723620..16723758 FT /rpt_family="MIR" FT repeat_region 16723814..16723973 FT /rpt_family="MIR" FT repeat_region 16724404..16724471 FT /rpt_family="L2" FT repeat_region 16724472..16724548 FT /rpt_family="MER2_type" FT repeat_region 16724550..16724627 FT /rpt_family="MER2_type" FT repeat_region 16724618..16724698 FT /rpt_family="MER2_type" FT repeat_region 16724812..16725191 FT /rpt_family="MaLR" FT repeat_region 16725204..16725709 FT /rpt_family="L2" FT repeat_region 16726866..16726907 FT /rpt_family="(CA)n" FT repeat_region 16726912..16726941 FT /rpt_family="(GA)n" FT repeat_region 16726936..16727485 FT /rpt_family="ERV1" FT repeat_region 16727490..16727587 FT /rpt_family="(TA)n" FT repeat_region 16727669..16727718 FT /rpt_family="AT_rich" FT misc_feature 16727770..16727772 FT /note="match to EST BI033937 (NID:g14440563)" FT repeat_region 16727876..16728010 FT /rpt_family="MIR" FT repeat_region 16729464..16729627 FT /rpt_family="MIR" FT misc_feature 16729760..16730064 FT /note="match to EST BF868934 (NID:g12258973)" FT repeat_region 16729999..16730058 FT /rpt_family="(TAGA)n" FT misc_feature 16731089..16731620 FT /note="match to EST BI033937 (NID:g14440563)" FT repeat_region 16732162..16732285 FT /rpt_family="MIR" FT repeat_region 16732498..16732615 FT /rpt_family="MIR" FT repeat_region 16732812..16732882 FT /rpt_family="(GAATG)n" FT repeat_region 16732944..16733346 FT /rpt_family="MaLR" FT misc_feature 16733799..16734049 FT /note="similar to Homo sapiens EST AW957050 (NID:g8146733)" FT misc_feature 16735214..16735889 FT /note="match to EST BF959342 (NID:g12376630)" FT misc_feature 16735219..16735672 FT /note="similar to Homo sapiens EST BF747604 FT (NID:g12074280)" FT misc_feature 16735219..16735768 FT /note="match to EST BI034969 (NID:g14441595)" FT repeat_region 16735679..16735809 FT /rpt_family="MIR" FT repeat_region 16735944..16735983 FT /rpt_family="(TGAA)n" FT repeat_region 16736322..16736348 FT /rpt_family="(T)n" FT repeat_region 16737087..16737155 FT /rpt_family="MaLR" FT repeat_region 16737171..16737582 FT /rpt_family="L1" FT repeat_region 16738190..16738322 FT /rpt_family="MIR" FT repeat_region 16738719..16738810 FT /rpt_family="L1" FT repeat_region 16738825..16738867 FT /rpt_family="(TTTA)n" FT repeat_region 16738852..16739016 FT /rpt_family="Alu" FT repeat_region 16739025..16739049 FT /rpt_family="AT_rich" FT repeat_region 16739041..16739500 FT /rpt_family="L1" FT repeat_region 16739985..16740038 FT /rpt_family="GA-rich" FT repeat_region 16740623..16740676 FT /rpt_family="GA-rich" FT repeat_region 16740928..16741213 FT /rpt_family="Alu" FT repeat_region 16741213..16741383 FT /rpt_family="(TA)n" FT misc_feature 16742208..16742576 FT /note="similar to Mus musculus EST BB046468 FT (NID:g16259416)" FT misc_feature 16742605..16742837 FT /note="similar to Mus musculus EST BB046468 FT (NID:g16259416)" FT repeat_region 16742755..16742873 FT /rpt_family="CR1" FT repeat_region 16742895..16742975 FT /rpt_family="L2" FT repeat_region 16743516..16743629 FT /rpt_family="L2" FT repeat_region 16743653..16743715 FT /rpt_family="(T)n" FT repeat_region 16743688..16743991 FT /rpt_family="Alu" FT misc_feature 16743710..16744225 FT /note="match to EST AA835501 (NID:g2909229) ak75d02.s1" FT repeat_region 16744631..16744918 FT /rpt_family="Alu" FT repeat_region 16744976..16745550 FT /rpt_family="MaLR" FT repeat_region 16745770..16745797 FT /rpt_family="(TTTG)n" FT repeat_region 16745771..16746078 FT /rpt_family="Alu" FT repeat_region 16746091..16746397 FT /rpt_family="Alu" FT repeat_region 16746418..16746484 FT /rpt_family="MIR" FT repeat_region 16746534..16746755 FT /rpt_family="MIR" FT repeat_region 16747705..16747805 FT /rpt_family="L2" FT repeat_region 16748128..16748419 FT /rpt_family="Alu" FT repeat_region 16750552..16750666 FT /rpt_family="L2" FT repeat_region 16750916..16751211 FT /rpt_family="Alu" FT repeat_region 16751182..16751213 FT /rpt_family="(A)n" FT repeat_region 16751639..16751848 FT /rpt_family="L1" FT repeat_region 16751912..16752015 FT /rpt_family="L2" FT repeat_region 16752290..16752413 FT /rpt_family="MER53" FT misc_feature 16752470..16752550 FT /note="match to EST AA781460 (NID:g2840791) aj26g03.s1" FT misc_feature 16753253..16753860 FT /note="match to EST BE150716 (NID:g8613346)" FT repeat_region 16753357..16753415 FT /rpt_family="L2" FT repeat_region 16753549..16753610 FT /rpt_family="Alu" FT repeat_region 16753589..16753612 FT /rpt_family="AT_rich" FT repeat_region 16753746..16753873 FT /rpt_family="CR1" FT misc_feature 16754030..16754081 FT /note="match to EST AA781460 (NID:g2840791) aj26g03.s1" FT repeat_region 16754201..16754266 FT /rpt_family="(TTCA)n" FT repeat_region 16754317..16754479 FT /rpt_family="MIR" FT repeat_region 16756147..16756168 FT /rpt_family="AT_rich" FT repeat_region 16756149..16756453 FT /rpt_family="Alu" FT misc_feature 16756412..16756767 FT /note="match to EST AA491950 (NID:g2221512) ng16g02.s1" FT misc_feature 16756722..16756920 FT /note="match to EST R15496 (NID:g768699)" FT repeat_region 16757096..16757152 FT /rpt_family="(TG)n" FT repeat_region 16757153..16757190 FT /rpt_family="(GA)n" FT repeat_region 16757180..16757281 FT /rpt_family="MIR" FT repeat_region 16757786..16758090 FT /rpt_family="Alu" FT misc_feature 16758125..16758543 FT /note="match to EST BF961923 (NID:g12379198)" FT repeat_region 16758258..16758408 FT /rpt_family="L2" FT misc_feature 16758654..16758892 FT /note="similar to Homo sapiens EST AA654087 (NID:g2590241) FT nt08h10.s1" FT misc_feature 16760781..16760883 FT /note="match to EST AA781460 (NID:g2840791) aj26g03.s1" FT misc_feature 16760781..16760885 FT /note="match to EST AL603365 (NID:g15166871)" FT /note="match to EST BI670282 (NID:g15584515)" FT /note="match to EST BF740295 (NID:g12066958)" FT misc_feature complement(16761541..16954964) FT /note="Quality: Phrap Quality >=40 100% of Sequence; FT Estimated Total Number of Errors is 0.0.; STS Content:; FT SHGC-50603 G33661; WI-3971 G04495; SHGC-51605 G34137" FT misc_feature complement(17037558..17038132) FT /note="CpG_island (%GC=60.0, o/e=0.78, #CpGs=43)" FT misc_feature complement(17013140..17013503) FT /note="CpG_island (%GC=56.9, o/e=0.89, #CpGs=25)" FT misc_feature complement(16944418..16944843) FT /note="CpG_island (%GC=59.9, o/e=0.82, #CpGs=32)" FT misc_feature complement(16919294..16919514) FT /note="CpG_island (%GC=59.7, o/e=0.85, #CpGs=17)" FT gene complement(16899977..16900225) FT /gene="LDB2" FT mRNA complement(16899977..16900225) FT /gene="LDB2" FT CDS complement(<16899977..16900108) FT /codon_start=1 FT /gene="LDB2" FT /product="unknown" FT /note="Homo sapiens LIM domain binding 2, mRNA (cDNA clone FT MGC:22545 IMAGE:4693654), complete cds.; H_NH0141E13.1 This FT gene was based on gi(21706449) Continues as H_NH0547J14.1" FT /protein_id="AAY40912.1" FT /translation="MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTE" FT misc_feature complement(16865336..16865575) FT /note="CpG_island (%GC=59.2, o/e=0.88, #CpGs=21)" FT misc_feature 17121430..17324524 FT /note="Finishing Completed at Stanford Human Genome Center; FT www-shgc.stanford.edu; Quality: Phrap Quality >=40 99.7% of FT Sequence; Estimated Total Number of Errors is 0.6.; STS FT Content:; SHGC-80718 G51238" FT repeat_region 17367074..17367285 FT /rpt_family="MER1_type" FT repeat_region 17367381..17367510 FT /rpt_family="MIR" FT repeat_region 17367511..17367785 FT /rpt_family="Alu" FT repeat_region 17367809..17367997 FT /rpt_family="MER1_type" FT repeat_region 17368032..17368573 FT /rpt_family="MaLR" FT repeat_region 17368706..17368727 FT /rpt_family="AT_rich" FT repeat_region 17368856..17368919 FT /rpt_family="MaLR" FT repeat_region 17368920..17369363 FT /rpt_family="L1" FT repeat_region 17369364..17369724 FT /rpt_family="MaLR" FT repeat_region 17369725..17369735 FT /rpt_family="L1" FT repeat_region 17369730..17369751 FT /rpt_family="AT_rich" FT repeat_region 17369736..17370256 FT /rpt_family="MaLR" FT repeat_region 17370266..17370354 FT /rpt_family="MIR" FT repeat_region 17370431..17370585 FT /rpt_family="L1" FT repeat_region 17370586..17370621 FT /rpt_family="ERV1" FT repeat_region 17370622..17370919 FT /rpt_family="Alu" FT repeat_region 17370920..17371264 FT /rpt_family="ERV1" FT repeat_region 17371630..17371701 FT /rpt_family="Alu" FT repeat_region 17371876..17371899 FT /rpt_family="AT_rich" FT repeat_region 17372927..17373131 FT /rpt_family="MIR" FT repeat_region 17373317..17373555 FT /rpt_family="L2" FT repeat_region 17373842..17374002 FT /rpt_family="MER2_type" FT repeat_region 17374802..17374831 FT /rpt_family="(TC)n" FT repeat_region 17374832..17374859 FT /rpt_family="(CA)n" FT repeat_region 17375455..17375604 FT /rpt_family="MER103" FT repeat_region 17375664..17375816 FT /rpt_family="MIR" FT repeat_region 17377076..17377103 FT /rpt_family="AT_rich" FT repeat_region 17377380..17377438 FT /rpt_family="MER1_type" FT repeat_region 17377522..17377666 FT /rpt_family="MER1_type" FT repeat_region 17378045..17378227 FT /rpt_family="CR1" FT repeat_region 17378988..17379333 FT /rpt_family="MaLR" FT repeat_region 17379971..17380041 FT /rpt_family="GA-rich" FT repeat_region 17380309..17380345 FT /rpt_family="L1" FT repeat_region 17380334..17380372 FT /rpt_family="AT_rich" FT repeat_region 17380783..17381367 FT /rpt_family="L1" FT repeat_region 17381368..17382083 FT /rpt_family="L1" FT repeat_region 17382084..17382631 FT /rpt_family="L1" FT repeat_region 17382502..17382524 FT /rpt_family="AT_rich" FT repeat_region 17382644..17382931 FT /rpt_family="Alu" FT repeat_region 17382927..17382957 FT /rpt_family="AT_rich" FT repeat_region 17383054..17383262 FT /rpt_family="MIR" FT repeat_region 17383287..17383669 FT /rpt_family="L1" FT repeat_region 17383672..17383804 FT /rpt_family="Alu" FT repeat_region 17383848..17384180 FT /rpt_family="L1" FT repeat_region 17383903..17383930 FT /rpt_family="AT_rich" FT repeat_region 17384181..17384915 FT /rpt_family="L1" FT repeat_region 17384916..17385136 FT /rpt_family="L1" FT repeat_region 17385145..17385283 FT /rpt_family="ERVL" FT repeat_region 17385297..17385515 FT /rpt_family="MaLR" FT repeat_region 17385516..17385729 FT /rpt_family="MaLR" FT repeat_region 17385730..17386025 FT /rpt_family="Alu" FT repeat_region 17386026..17386203 FT /rpt_family="MaLR" FT repeat_region 17386208..17386521 FT /rpt_family="Alu" FT repeat_region 17386605..17386884 FT /rpt_family="L1" FT repeat_region 17386963..17387453 FT /rpt_family="MaLR" FT repeat_region 17387490..17387610 FT /rpt_family="L1" FT repeat_region 17387702..17388088 FT /rpt_family="MaLR" FT repeat_region 17388160..17388226 FT /rpt_family="L2" FT repeat_region 17388252..17388481 FT /rpt_family="MIR" FT repeat_region 17388681..17388963 FT /rpt_family="Alu" FT repeat_region 17389289..17389387 FT /rpt_family="MIR" FT repeat_region 17389396..17389759 FT /rpt_family="MaLR" FT repeat_region 17390355..17390733 FT /rpt_family="MaLR" FT repeat_region 17390743..17390884 FT /rpt_family="ERVL" FT misc_feature 17390910..17391208 FT /note="match to EST AI285410 (NID:g3923643) qt69h01.x1" FT repeat_region 17391069..17391389 FT /rpt_family="Alu" FT repeat_region 17391187..17391214 FT /rpt_family="AT_rich" FT repeat_region 17391361..17391402 FT /rpt_family="(A)n" FT repeat_region 17391696..17391760 FT /rpt_family="L2" FT repeat_region 17391868..17393152 FT /rpt_family="L1" FT repeat_region 17392554..17392581 FT /rpt_family="AT_rich" FT repeat_region 17393314..17393703 FT /rpt_family="MaLR" FT repeat_region 17393706..17393968 FT /rpt_family="Alu" FT repeat_region 17393965..17394001 FT /rpt_family="(CAGA)n" FT repeat_region 17394006..17394107 FT /rpt_family="GA-rich" FT repeat_region 17394106..17394395 FT /rpt_family="Alu" FT repeat_region 17394365..17394494 FT /rpt_family="(GAAA)n" FT repeat_region 17394503..17394680 FT /rpt_family="GA-rich" FT repeat_region 17394679..17394970 FT /rpt_family="Alu" FT repeat_region 17394970..17395003 FT /rpt_family="(AGGGGG)n" FT repeat_region 17395356..17395388 FT /rpt_family="(CA)n" FT repeat_region 17395618..17395700 FT /rpt_family="L2" FT repeat_region 17396511..17396824 FT /rpt_family="Alu" FT repeat_region 17396796..17396839 FT /rpt_family="(A)n" FT repeat_region 17397062..17397096 FT /rpt_family="AT_rich" FT repeat_region 17397476..17397524 FT /rpt_family="T-rich" FT repeat_region 17397962..17398199 FT /rpt_family="MIR" FT repeat_region 17398202..17398277 FT /rpt_family="(ATG)n" FT repeat_region 17400053..17400352 FT /rpt_family="MaLR" FT repeat_region 17400847..17401146 FT /rpt_family="Alu" FT repeat_region 17401265..17401805 FT /rpt_family="L1" FT repeat_region 17402638..17403152 FT /rpt_family="MaLR" FT repeat_region 17403195..17403330 FT /rpt_family="MER1_type" FT repeat_region 17403575..17403829 FT /rpt_family="MIR" FT repeat_region 17404166..17404440 FT /rpt_family="Alu" FT repeat_region 17404443..17405448 FT /rpt_family="L1" FT repeat_region 17405430..17405450 FT /rpt_family="AT_rich" FT repeat_region 17405906..17405948 FT /rpt_family="GA-rich" FT repeat_region 17406069..17406356 FT /rpt_family="Alu" FT repeat_region 17406184..17406203 FT /rpt_family="(A)n" FT repeat_region 17406851..17406939 FT /rpt_family="GA-rich" FT repeat_region 17407222..17407314 FT /rpt_family="MaLR" FT repeat_region 17407356..17407376 FT /rpt_family="AT_rich" FT repeat_region 17407446..17407742 FT /rpt_family="Alu" FT repeat_region 17408300..17408725 FT /rpt_family="MaLR" FT repeat_region 17410543..17410646 FT /rpt_family="MIR" FT repeat_region 17410781..17410834 FT /rpt_family="MIR" FT repeat_region 17411557..17412706 FT /rpt_family="L1" FT repeat_region 17412935..17413132 FT /rpt_family="L1" FT repeat_region 17413158..17413260 FT /rpt_family="G-rich" FT repeat_region 17413267..17414055 FT /rpt_family="ERV1" FT repeat_region 17414061..17414083 FT /rpt_family="(CATA)n" FT repeat_region 17414115..17414481 FT /rpt_family="L1" FT repeat_region 17414482..17414900 FT /rpt_family="ERV1" FT repeat_region 17414914..17415026 FT /rpt_family="L1" FT repeat_region 17415039..17416459 FT /rpt_family="ERV1" FT repeat_region 17416460..17416918 FT /rpt_family="L1" FT repeat_region 17416951..17416997 FT /rpt_family="L1" FT repeat_region 17416989..17417024 FT /rpt_family="AT_rich" FT repeat_region 17417234..17417257 FT /rpt_family="AT_rich" FT repeat_region 17417455..17417814 FT /rpt_family="L1" FT misc_feature 17417578..17417608 FT /note="similar to Homo sapiens EST BE968642 FT (NID:g10579347)" FT misc_feature 17417582..17417599 FT /note="match to EST AW339613 (NID:g6836239) he15b06.x1" FT repeat_region 17418471..17418692 FT /rpt_family="MIR" FT repeat_region 17420074..17420269 FT /rpt_family="MIR" FT repeat_region 17420998..17421101 FT /rpt_family="MER1_type" FT repeat_region 17421117..17421291 FT /rpt_family="MER1_type" FT repeat_region 17421739..17421844 FT /rpt_family="MIR" FT repeat_region 17422093..17422249 FT /rpt_family="L1" FT repeat_region 17422754..17422795 FT /rpt_family="MIR" FT repeat_region 17422917..17423142 FT /rpt_family="MIR" FT repeat_region 17423313..17423428 FT /rpt_family="L2" FT repeat_region 17423529..17423595 FT /rpt_family="L2" FT repeat_region 17423829..17424155 FT /rpt_family="MER2_type" FT repeat_region 17424313..17424399 FT /rpt_family="L2" FT repeat_region 17424482..17424614 FT /rpt_family="MER1_type" FT repeat_region 17424649..17424991 FT /rpt_family="MaLR" FT repeat_region 17424998..17425246 FT /rpt_family="MaLR" FT repeat_region 17425247..17425592 FT /rpt_family="MaLR" FT repeat_region 17425593..17425619 FT /rpt_family="(TTTA)n" FT repeat_region 17425903..17425938 FT /rpt_family="MaLR" FT repeat_region 17425950..17426485 FT /rpt_family="Tc2" FT repeat_region 17426711..17426758 FT /rpt_family="AcHobo" FT repeat_region 17427097..17427331 FT /rpt_family="MIR" FT misc_feature 17427663..17427664 FT /note="similar to Homo sapiens EST AW370987 (NID:g6875641)" FT repeat_region 17428312..17428433 FT /rpt_family="MaLR" FT repeat_region 17428434..17428763 FT /rpt_family="AcHobo" FT misc_feature 17428760..17428786 FT /note="match to EST BF673247 (NID:g11947142)" FT repeat_region 17428761..17428781 FT /rpt_family="AT_rich" FT repeat_region 17428764..17429062 FT /rpt_family="Alu" FT misc_feature 17428764..17428779 FT /note="similar to Homo sapiens EST BG028943 FT (NID:g12418038)" FT misc_feature 17428765..17428786 FT /note="similar to Homo sapiens EST BE968642 FT (NID:g10579347)" FT misc_feature 17428767..17428783 FT /note="similar to Homo sapiens EST AV692375 FT (NID:g10294238)" FT repeat_region 17429063..17429157 FT /rpt_family="AcHobo" FT misc_feature 17429288..17429694 FT /note="similar to Homo sapiens EST BG028943 FT (NID:g12418038)" FT misc_feature 17429293..17429341 FT /note="similar to Homo sapiens EST AV692375 FT (NID:g10294238)" FT misc_feature 17429293..17429477 FT /note="similar to Homo sapiens EST BE968642 FT (NID:g10579347)" FT misc_feature 17429304..17429583 FT /note="similar to Homo sapiens EST R16825 (NID:g770435) FT yf33h07.s1" FT misc_feature 17429304..17429903 FT /note="similar to Homo sapiens EST AA582168 (NID:g2360846) FT nn44f01.s1" FT misc_feature 17429304..17429621 FT /note="similar to Homo sapiens EST BG289323 FT (NID:g13045050)" FT misc_feature 17429304..17429905 FT /note="similar to Homo sapiens EST BG773646 FT (NID:g14043596)" FT misc_feature 17429304..17429693 FT /note="similar to Homo sapiens EST AA167581 (NID:g1745992) FT zp16a11.s1" FT misc_feature 17429304..17429481 FT /note="similar to Homo sapiens EST AI005578 (NID:g3215088) FT ov58f01.s1" FT misc_feature 17429304..17429694 FT /note="similar to Homo sapiens EST AA187722 (NID:g1773923) FT zp72d09.s1" FT /note="similar to Homo sapiens EST AI193200 (NID:g3744409) FT qe41g02.s1" FT misc_feature 17429305..17429905 FT /note="similar to Homo sapiens EST BF975391 FT (NID:g12342606)" FT misc_feature 17429305..17429510 FT /note="similar to Homo sapiens EST AV717175 FT (NID:g10814327)" FT misc_feature 17429306..17429903 FT /note="similar to Homo sapiens EST BF793343 FT (NID:g12098397)" FT misc_feature 17429307..17429692 FT /note="similar to Mus musculus EST AA067282 (NID:g1565073) FT mm31g07.r1" FT misc_feature 17429326..17429805 FT /note="similar to Homo sapiens EST BF212736 FT (NID:g11106322)" FT misc_feature 17429333..17429905 FT /note="similar to Homo sapiens EST BG026845 FT (NID:g12414849)" FT misc_feature 17429389..17429905 FT /note="similar to Homo sapiens EST BE618580 (NID:g9889518)" FT misc_feature 17429397..17429661 FT /note="similar to Homo sapiens EST AV692375 FT (NID:g10294238)" FT misc_feature 17429470..17429905 FT /note="similar to Homo sapiens EST BG434645 FT (NID:g13341151)" FT misc_feature 17429514..17429911 FT /note="similar to Mus musculus EST AA666924 (NID:g2625625) FT vq87d02.r1" FT misc_feature 17429525..17429844 FT /note="similar to Homo sapiens EST AV746588 FT (NID:g10904436)" FT misc_feature 17429527..17429905 FT /note="similar to Homo sapiens EST BF209595 FT (NID:g11103181)" FT misc_feature 17429558..17429821 FT /note="similar to Homo sapiens EST AW370987 (NID:g6875641)" FT misc_feature 17429560..17429905 FT /note="similar to Homo sapiens EST AV717175 FT (NID:g10814327)" FT misc_feature 17429579..17429833 FT /note="similar to Homo sapiens EST AW088278 (NID:g6044083) FT xd15a06.x1" FT misc_feature 17429619..17429794 FT /note="similar to Homo sapiens EST AA570790 (NID:g2343381) FT nm37f01.s1" FT misc_feature 17429678..17429905 FT /note="similar to Homo sapiens EST N84626 (NID:g1260251)" FT misc_feature 17429715..17429762 FT /note="similar to Homo sapiens EST AI193200 (NID:g3744409) FT qe41g02.s1" FT misc_feature 17429858..17429905 FT /note="similar to Homo sapiens EST BF212736 FT (NID:g11106322)" FT repeat_region 17429967..17430604 FT /rpt_family="AcHobo" FT repeat_region 17430605..17430903 FT /rpt_family="Alu" FT repeat_region 17430904..17431152 FT /rpt_family="AcHobo" FT repeat_region 17431144..17431179 FT /rpt_family="(TTTG)n" FT repeat_region 17431153..17431461 FT /rpt_family="Alu" FT repeat_region 17431462..17432296 FT /rpt_family="AcHobo" FT repeat_region 17432299..17432428 FT /rpt_family="MaLR" FT repeat_region 17432432..17432573 FT /rpt_family="Alu" FT repeat_region 17432758..17433340 FT /rpt_family="L1" FT repeat_region 17433341..17433628 FT /rpt_family="Alu" FT repeat_region 17433629..17435355 FT /rpt_family="L1" FT misc_feature 17433643..17433648 FT /note="similar to Homo sapiens EST BF793343 FT (NID:g12098397)" FT repeat_region 17435462..17435506 FT /rpt_family="(A)n" FT repeat_region 17435529..17435762 FT /rpt_family="MaLR" FT misc_feature 17435895..17435900 FT /note="similar to Homo sapiens EST BE968642 FT (NID:g10579347)" FT repeat_region 17436421..17436584 FT /rpt_family="L2" FT misc_feature 17436799..17437087 FT /note="match to EST AA372629 (NID:g2024946)" FT repeat_region 17436967..17437263 FT /rpt_family="ERV1" FT repeat_region 17437266..17437694 FT /rpt_family="ERV1" FT repeat_region 17437695..17437795 FT /rpt_family="ERV1" FT repeat_region 17437796..17438690 FT /rpt_family="ERV1" FT repeat_region 17438691..17439276 FT /rpt_family="ERV1" FT repeat_region 17439595..17439703 FT /rpt_family="MER103" FT repeat_region 17439704..17439999 FT /rpt_family="Alu" FT misc_feature 17439905..17439908 FT /note="similar to Homo sapiens EST AA187722 (NID:g1773923) FT zp72d09.s1" FT repeat_region 17440103..17440366 FT /rpt_family="MaLR" FT repeat_region 17440368..17440449 FT /rpt_family="MER1_type" FT repeat_region 17440450..17440760 FT /rpt_family="Alu" FT repeat_region 17440761..17440847 FT /rpt_family="MER1_type" FT repeat_region 17440848..17441268 FT /rpt_family="MaLR" FT repeat_region 17441269..17441380 FT /rpt_family="MER1_type" FT repeat_region 17441381..17441671 FT /rpt_family="Alu" FT repeat_region 17441655..17441696 FT /rpt_family="AT_rich" FT repeat_region 17441672..17442141 FT /rpt_family="MER1_type" FT repeat_region 17442142..17442458 FT /rpt_family="Alu" FT repeat_region 17442465..17443852 FT /rpt_family="L1" FT repeat_region 17442905..17442931 FT /rpt_family="AT_rich" FT repeat_region 17443853..17444093 FT /rpt_family="Alu" FT repeat_region 17443893..17443923 FT /rpt_family="(A)n" FT repeat_region 17444095..17444738 FT /rpt_family="L1" FT repeat_region 17444739..17445116 FT /rpt_family="MaLR" FT repeat_region 17446736..17446974 FT /rpt_family="MaLR" FT repeat_region 17446976..17447008 FT /rpt_family="ERVL" FT repeat_region 17447009..17447317 FT /rpt_family="Alu" FT repeat_region 17447291..17447322 FT /rpt_family="(TAAAA)n" FT repeat_region 17447318..17447458 FT /rpt_family="ERVL" FT repeat_region 17447474..17447639 FT /rpt_family="ERVL" FT repeat_region 17447718..17448043 FT /rpt_family="Alu" FT repeat_region 17447882..17447914 FT /rpt_family="(TTTTC)n" FT repeat_region 17448676..17448754 FT /rpt_family="L2" FT repeat_region 17449226..17449413 FT /rpt_family="MaLR" FT repeat_region 17449492..17449568 FT /rpt_family="MaLR" FT repeat_region 17449614..17449947 FT /rpt_family="Alu" FT repeat_region 17449788..17449827 FT /rpt_family="(T)n" FT misc_feature 17449807..17449823 FT /note="match to EST AI144281 (NID:g3666090) qb59f10.x1" FT repeat_region 17450399..17450795 FT /rpt_family="ERV1" FT repeat_region 17450810..17450830 FT /rpt_family="AT_rich" FT repeat_region 17450972..17451001 FT /rpt_family="AT_rich" FT repeat_region 17451016..17451169 FT /rpt_family="MIR" FT repeat_region 17451588..17451986 FT /rpt_family="MER2_type" FT repeat_region 17452014..17452100 FT /rpt_family="L2" FT repeat_region 17452208..17452478 FT /rpt_family="ERVL" FT repeat_region 17452512..17452536 FT /rpt_family="AT_rich" FT repeat_region 17452526..17452663 FT /rpt_family="L1" FT repeat_region 17452665..17453249 FT /rpt_family="ERV1" FT repeat_region 17453257..17453992 FT /rpt_family="L1" FT repeat_region 17453993..17454319 FT /rpt_family="MaLR" FT repeat_region 17454320..17454646 FT /rpt_family="Alu" FT repeat_region 17454647..17454816 FT /rpt_family="Alu" FT repeat_region 17454793..17454816 FT /rpt_family="(A)n" FT repeat_region 17454817..17454889 FT /rpt_family="L1" FT repeat_region 17454926..17455143 FT /rpt_family="ERVL" FT repeat_region 17456444..17456657 FT /rpt_family="L1" FT repeat_region 17458885..17458905 FT /rpt_family="AT_rich" FT repeat_region 17458977..17459105 FT /rpt_family="L1" FT repeat_region 17459245..17459426 FT /rpt_family="MIR" FT repeat_region 17459481..17459855 FT /rpt_family="MaLR" FT repeat_region 17459856..17460738 FT /rpt_family="ERV1" FT repeat_region 17460448..17460526 FT /rpt_family="(GTCTG)n" FT repeat_region 17460792..17460878 FT /rpt_family="(TA)n" FT repeat_region 17460952..17461128 FT /rpt_family="(TA)n" FT repeat_region 17461144..17461352 FT /rpt_family="(TA)n" FT repeat_region 17461429..17461480 FT /rpt_family="L1" FT repeat_region 17461464..17461633 FT /rpt_family="(TA)n" FT repeat_region 17461647..17461669 FT /rpt_family="AT_rich" FT repeat_region 17461680..17461813 FT /rpt_family="MIR" FT misc_feature 17461925..17462404 FT /note="match to EST N93911 (NID:g1266220) yy65d12.r1" FT repeat_region 17462179..17462620 FT /rpt_family="ERV1" FT repeat_region 17462621..17462643 FT /rpt_family="(T)n" FT repeat_region 17462785..17462819 FT /rpt_family="(T)n" FT repeat_region 17462939..17463199 FT /rpt_family="ERV1" FT repeat_region 17463227..17463440 FT /rpt_family="MIR" FT repeat_region 17464459..17464535 FT /rpt_family="MIR" FT repeat_region 17464551..17464852 FT /rpt_family="Alu" FT repeat_region 17464986..17465039 FT /rpt_family="L2" FT repeat_region 17465076..17465123 FT /rpt_family="MER103" FT repeat_region 17465143..17465201 FT /rpt_family="(TAGA)n" FT repeat_region 17465342..17465814 FT /rpt_family="ERV1" FT repeat_region 17465815..17466077 FT /rpt_family="MER2_type" FT repeat_region 17466076..17466093 FT /rpt_family="MER2_type" FT repeat_region 17466094..17466447 FT /rpt_family="MaLR" FT repeat_region 17466448..17466529 FT /rpt_family="MER2_type" FT repeat_region 17466530..17466592 FT /rpt_family="ERV1" FT repeat_region 17467040..17467332 FT /rpt_family="Alu" FT repeat_region 17467314..17467337 FT /rpt_family="AT_rich" FT repeat_region 17467341..17467609 FT /rpt_family="Alu" FT repeat_region 17467656..17467683 FT /rpt_family="(CA)n" FT repeat_region 17468158..17468491 FT /rpt_family="MaLR" FT repeat_region 17468492..17468800 FT /rpt_family="Alu" FT repeat_region 17468801..17468912 FT /rpt_family="MaLR" FT repeat_region 17469748..17469893 FT /rpt_family="MIR" FT repeat_region 17470129..17470207 FT /rpt_family="Mariner" FT repeat_region 17470501..17470535 FT /rpt_family="(TTTA)n" FT repeat_region 17470742..17470841 FT /rpt_family="MIR" FT repeat_region 17470842..17471150 FT /rpt_family="Alu" FT repeat_region 17471151..17471283 FT /rpt_family="MIR" FT repeat_region 17471326..17471352 FT /rpt_family="(T)n" FT repeat_region 17471343..17471648 FT /rpt_family="L1" FT repeat_region 17471714..17471787 FT /rpt_family="L2" FT repeat_region 17471828..17471978 FT /rpt_family="ERVL" FT repeat_region 17471979..17472056 FT /rpt_family="Mariner" FT repeat_region 17472057..17472253 FT /rpt_family="ERVL" FT repeat_region 17473594..17473811 FT /rpt_family="MaLR" FT repeat_region 17473813..17473890 FT /rpt_family="MER1_type" FT repeat_region 17474411..17474716 FT /rpt_family="Alu" FT repeat_region 17474804..17475103 FT /rpt_family="Alu" FT repeat_region 17475080..17475115 FT /rpt_family="(GAAA)n" FT misc_feature 17475169..17475514 FT /note="match to EST AI262581 (NID:g3870784) qk22h03.x1" FT repeat_region 17475729..17475856 FT /rpt_family="MIR" FT repeat_region 17475871..17475952 FT /rpt_family="L2" FT repeat_region 17475957..17476253 FT /rpt_family="Alu" FT repeat_region 17476339..17476367 FT /rpt_family="(TTTTA)n" FT repeat_region 17476638..17476734 FT /rpt_family="L1" FT repeat_region 17476790..17476998 FT /rpt_family="MIR" FT repeat_region 17477197..17477566 FT /rpt_family="L1" FT repeat_region 17477771..17478078 FT /rpt_family="Alu" FT repeat_region 17478049..17478146 FT /rpt_family="GA-rich" FT repeat_region 17478824..17478892 FT /rpt_family="MIR" FT repeat_region 17478893..17479366 FT /rpt_family="ERVL" FT misc_feature 17479266..17479270 FT /note="match to EST W70002 (NID:g1379263) zd51b11.r1" FT repeat_region 17479367..17479419 FT /rpt_family="MIR" FT repeat_region 17480189..17480546 FT /rpt_family="MaLR" FT repeat_region 17480547..17480795 FT /rpt_family="Alu" FT repeat_region 17480874..17480988 FT /rpt_family="MIR" FT repeat_region 17481045..17481378 FT /rpt_family="L1" FT repeat_region 17481571..17481904 FT /rpt_family="L1" FT repeat_region 17481966..17482163 FT /rpt_family="MIR" FT repeat_region 17482643..17482942 FT /rpt_family="L2" FT misc_feature 17482746..17482749 FT /note="match to EST BI602370 (NID:g15495296)" FT repeat_region 17482999..17483169 FT /rpt_family="ERVL" FT repeat_region 17483457..17483568 FT /rpt_family="ERVL" FT repeat_region 17483575..17484130 FT /rpt_family="L2" FT repeat_region 17484133..17484210 FT /rpt_family="MER1_type" FT repeat_region 17484234..17484366 FT /rpt_family="MER1_type" FT repeat_region 17484378..17484614 FT /rpt_family="L2" FT repeat_region 17484615..17485009 FT /rpt_family="MaLR" FT repeat_region 17485010..17485283 FT /rpt_family="L2" FT misc_feature 17485016..17485697 FT /note="match to EST BG034901 (NID:g12428621)" FT repeat_region 17485432..17485460 FT /rpt_family="AT_rich" FT repeat_region 17485459..17485498 FT /rpt_family="L1" FT repeat_region 17485587..17485877 FT /rpt_family="Alu" FT misc_feature 17485888..17486133 FT /note="match to EST AI640297 (NID:g4703406) wa16f01.x1" FT misc_feature 17485911..17486384 FT /note="match to EST BF940997 (NID:g12358317) hu62h09.x1" FT repeat_region 17486090..17486203 FT /rpt_family="MIR" FT misc_feature 17486151..17486154 FT /note="match to EST AW886683 (NID:g8048695)" FT repeat_region 17486226..17486246 FT /rpt_family="L1" FT repeat_region 17486247..17486578 FT /rpt_family="Alu" FT repeat_region 17486376..17486404 FT /rpt_family="AT_rich" FT repeat_region 17486579..17486895 FT /rpt_family="L1" FT misc_feature 17486595..17486599 FT /note="match to EST BG766690 (NID:g14077343)" FT repeat_region 17486896..17487180 FT /rpt_family="Alu" FT repeat_region 17487181..17487419 FT /rpt_family="L1" FT repeat_region 17487420..17487720 FT /rpt_family="Alu" FT repeat_region 17487703..17487724 FT /rpt_family="AT_rich" FT repeat_region 17487721..17487747 FT /rpt_family="L1" FT repeat_region 17487789..17487895 FT /rpt_family="MIR" FT misc_feature 17487944..17487945 FT /note="match to EST AL556843 (NID:g12899880)" FT misc_feature 17488014..17488423 FT /note="match to EST AI084769 (NID:g3423192) oz80a01.x1" FT misc_feature 17488018..17488860 FT /note="match to EST AI188651 (NID:g3739860) qd15g07.x1" FT misc_feature 17488028..17488643 FT /note="match to EST AA586807 (NID:g2397621) nn79a11.s1" FT misc_feature 17488031..17488643 FT /note="match to EST BF673247 (NID:g11947142)" FT misc_feature 17488052..17488264 FT /note="similar to Homo sapiens EST BE935797 FT (NID:g10461873)" FT misc_feature 17488058..17488247 FT /note="similar to Homo sapiens EST BE935801 FT (NID:g10461877)" FT misc_feature 17488070..17488397 FT /note="similar to Homo sapiens EST BG033083 FT (NID:g12425018)" FT misc_feature 17488077..17488559 FT /note="similar to Homo sapiens EST BE935813 FT (NID:g10461889)" FT misc_feature 17488097..17488859 FT /note="similar to Homo sapiens EST AL565146 FT (NID:g12916230)" FT misc_feature 17488104..17488472 FT /note="match to EST C00286 (NID:g1432516)" FT misc_feature 17488143..17488761 FT /note="match to EST AV727826 (NID:g10837247)" FT misc_feature 17488148..17488637 FT /note="match to EST AI312600 (NID:g4018205) qp77a08.x1" FT misc_feature 17488149..17488870 FT /note="match to EST AI142541 (NID:g3658900) qb47a12.x1" FT misc_feature 17488150..17488412 FT /note="match to EST AI718753 (NID:g5036009) as58e02.x1" FT misc_feature 17488181..17488859 FT /note="match to EST AL556843 (NID:g12899880)" FT misc_feature 17488196..17488859 FT /note="match to EST BF967892 (NID:g12335107)" FT misc_feature 17488226..17488859 FT /note="match to EST BF967647 (NID:g12334862)" FT misc_feature 17488239..17488567 FT /note="similar to Homo sapiens EST AL524673 FT (NID:g12788166)" FT misc_feature 17488252..17488302 FT /note="match to EST AI805221 (NID:g5391714) tu44f03.x1" FT misc_feature 17488301..17488859 FT /note="match to EST BE898155 (NID:g10364341)" FT misc_feature 17488309..17488859 FT /note="match to EST BE744629 (NID:g10158621)" FT misc_feature 17488323..17488859 FT /note="match to EST AL517818 (NID:g12781311)" FT misc_feature 17488326..17488753 FT /note="match to EST BF690198 (NID:g11975606)" FT misc_feature 17488380..17488669 FT /note="match to EST BG982255 (NID:g14384990)" FT misc_feature 17488393..17488753 FT /note="match to EST BG767393 (NID:g14078046)" FT misc_feature 17488409..17488672 FT /note="match to EST BG981356 (NID:g14384091)" FT misc_feature 17488416..17488751 FT /note="match to EST BG766690 (NID:g14077343)" FT misc_feature 17488457..17488859 FT /note="match to EST W70002 (NID:g1379263) zd51b11.r1" FT misc_feature 17488461..17488859 FT /note="match to EST AL556877 (NID:g12899944)" FT misc_feature 17488490..17488666 FT /note="match to EST AV648654 (NID:g9869668)" FT misc_feature 17488507..17488859 FT /note="match to EST AL522297 (NID:g12785790)" FT misc_feature 17488513 FT /note="match to EST BG706904 (NID:g13982714)" FT misc_feature 17488513..17488859 FT /note="match to EST BG476260 (NID:g13408539)" FT misc_feature 17488519..17488859 FT /note="match to EST BI603125 (NID:g15496064)" FT misc_feature 17488529..17488824 FT /note="match to EST BG706904 (NID:g13982714)" FT misc_feature 17488530..17488859 FT /note="match to EST BI597954 (NID:g15490893)" FT misc_feature 17488537..17488859 FT /note="match to EST AI144281 (NID:g3666090) qb59f10.x1" FT misc_feature 17488546..17488859 FT /note="match to EST AW339613 (NID:g6836239) he15b06.x1" FT misc_feature 17488556..17488859 FT /note="match to EST BG282045 (NID:g13030971)" FT misc_feature 17488559..17488859 FT /note="match to EST BG715928 (NID:g13995115)" FT misc_feature 17488565..17488666 FT /note="match to EST AV657177 (NID:g9878191)" FT misc_feature 17488593..17488867 FT /note="similar to Mus musculus EST AI536308 (NID:g4450443) FT ma85d01.y1" FT misc_feature 17488606..17488859 FT /note="match to EST BG763835 (NID:g14074488)" FT misc_feature 17488618..17488859 FT /note="match to EST BE062793 (NID:g8407443)" FT misc_feature 17488621..17488859 FT /note="match to EST AV724186 (NID:g10828322)" FT /note="similar to Mus musculus EST BG915846 FT (NID:g14296322)" FT misc_feature 17488624..17488859 FT /note="match to EST BF947088 (NID:g12364272)" FT misc_feature 17488641..17488859 FT /note="match to EST BI602370 (NID:g15495296)" FT misc_feature 17488644..17488859 FT /note="match to EST BE169193 (NID:g8631914)" FT misc_feature 17488645..17488859 FT /note="match to EST BE062800 (NID:g8407450)" FT misc_feature 17488679..17488859 FT /note="similar to Homo sapiens EST BF964008 FT (NID:g12381283)" FT misc_feature 17488716..17488859 FT /note="similar to Mus musculus EST BG869117 FT (NID:g14219657)" FT misc_feature 17488717..17488859 FT /note="match to EST AV648654 (NID:g9869668)" FT /note="match to EST AV657177 (NID:g9878191)" FT misc_feature 17488720..17488753 FT /note="match to EST BF689810 (NID:g11975218)" FT misc_feature 17488728..17488859 FT /note="match to EST BI545371 (NID:g15432683)" FT misc_feature 17488731 FT /note="match to EST BI599707 (NID:g15492646)" FT misc_feature 17488734..17488781 FT /note="match to EST AV648738 (NID:g9869752)" FT misc_feature 17488749..17488859 FT /note="similar to Bos taurus EST AW354296 (NID:g6853286)" FT misc_feature 17488793..17488859 FT /note="match to EST BI457986 (NID:g15248642)" FT misc_feature 17488799..17488859 FT /note="match to EST BI599707 (NID:g15492646)" FT misc_feature 17488802..17488859 FT /note="match to EST BI552951 (NID:g15440263)" FT misc_feature 17488811..17488859 FT /note="match to EST BG766690 (NID:g14077343)" FT misc_feature 17488813..17488859 FT /note="match to EST BF689810 (NID:g11975218)" FT /note="match to EST BG767393 (NID:g14078046)" FT /note="match to EST BF690198 (NID:g11975606)" FT misc_feature 17488817..17488846 FT /note="similar to Homo sapiens EST AL524673 FT (NID:g12788166)" FT misc_feature 17488836..17488859 FT /note="match to EST AV648738 (NID:g9869752)" FT misc_feature 17488942 FT /note="similar to Homo sapiens EST AL524673 FT (NID:g12788166)" FT repeat_region 17488991..17489289 FT /rpt_family="Alu" FT repeat_region 17489272..17489293 FT /rpt_family="(TAAA)n" FT repeat_region 17489304..17489436 FT /rpt_family="Alu" FT repeat_region 17489421..17489445 FT /rpt_family="AT_rich" FT repeat_region 17489508..17489579 FT /rpt_family="L1" FT repeat_region 17489604..17489897 FT /rpt_family="Alu" FT repeat_region 17489884..17489919 FT /rpt_family="AT_rich" FT misc_feature 17490232..17490633 FT /note="match to EST AA844132 (NID:g2930583) ai93e08.s1" FT misc_feature 17490239..17490846 FT /note="match to EST AW963312 (NID:g8153148)" FT misc_feature 17490586..17490860 FT /note="match to EST AA348581 (NID:g2000817)" FT repeat_region 17490618..17490711 FT /rpt_family="L1" FT misc_feature 17490633..17491034 FT /note="match to EST W88980 (NID:g1403866) zh70e06.s1" FT repeat_region 17491144..17491365 FT /rpt_family="MIR" FT repeat_region 17491547..17491636 FT /rpt_family="L2" FT misc_feature 17491684..17492093 FT /note="match to EST AW886683 (NID:g8048695)" FT repeat_region 17491899..17492067 FT /rpt_family="MIR" FT misc_feature 17492285..17492368 FT /note="match to EST AV648738 (NID:g9869752)" FT /note="match to EST AV648654 (NID:g9869668)" FT /note="similar to Bos taurus EST AW354296 (NID:g6853286)" FT /note="match to EST BE744629 (NID:g10158621)" FT /note="match to EST BE898155 (NID:g10364341)" FT /note="match to EST BF947088 (NID:g12364272)" FT /note="match to EST AV657177 (NID:g9878191)" FT /note="match to EST BE169193 (NID:g8631914)" FT /note="match to EST AI144281 (NID:g3666090) qb59f10.x1" FT /note="match to EST AL522297 (NID:g12785790)" FT /note="match to EST BF690198 (NID:g11975606)" FT /note="match to EST AL517818 (NID:g12781311)" FT /note="match to EST BF967647 (NID:g12334862)" FT /note="match to EST AL556843 (NID:g12899880)" FT /note="similar to Homo sapiens EST AL565146 FT (NID:g12916230)" FT /note="match to EST BI552951 (NID:g15440263)" FT /note="match to EST BI599707 (NID:g15492646)" FT /note="match to EST BI457986 (NID:g15248642)" FT /note="match to EST BI602370 (NID:g15495296)" FT /note="match to EST BI603125 (NID:g15496064)" FT /note="match to EST BG715928 (NID:g13995115)" FT /note="match to EST BG476260 (NID:g13408539)" FT /note="similar to Mus musculus EST BG869117 FT (NID:g14219657)" FT /note="similar to Gallus gallus EST BI390378 FT (NID:g15083660)" FT /note="match to EST AV724186 (NID:g10828322)" FT /note="match to EST AL556877 (NID:g12899944)" FT /note="match to EST AW607121 (NID:g7311862)" FT /note="similar to Mus musculus EST BG915846 FT (NID:g14296322)" FT /note="match to EST BE062793 (NID:g8407443)" FT /note="match to EST BE062800 (NID:g8407450)" FT /note="match to EST BG763835 (NID:g14074488)" FT /note="match to EST BF689810 (NID:g11975218)" FT /note="match to EST BG767393 (NID:g14078046)" FT /note="match to EST BG766690 (NID:g14077343)" FT /note="match to EST BG282045 (NID:g13030971)" FT misc_feature 17492285..17492341 FT /note="match to EST BI597954 (NID:g15490893)" FT misc_feature 17492285..17492324 FT /note="match to EST W70002 (NID:g1379263) zd51b11.r1" FT /note="similar to Homo sapiens EST BF964008 FT (NID:g12381283)" FT misc_feature 17492285..17492339 FT /note="match to EST AW339613 (NID:g6836239) he15b06.x1" FT misc_feature 17492286..17492368 FT /note="similar to Mus musculus EST BI145424 FT (NID:g14605412)" FT misc_feature 17492289..17492368 FT /note="match to EST BF375181 (NID:g11337206)" FT misc_feature 17492290..17492365 FT /note="match to EST BF967892 (NID:g12335107)" FT misc_feature 17492303..17492374 FT /note="similar to Homo sapiens EST W25983 (NID:g1306250)" FT misc_feature 17492307..17492368 FT /note="match to EST BF836006 (NID:g12187543)" FT misc_feature 17492311..17492368 FT /note="match to EST BI544438 (NID:g15431750)" FT repeat_region 17492930..17493086 FT /rpt_family="CR1" FT repeat_region 17493248..17493307 FT /rpt_family="GA-rich" FT repeat_region 17493369..17493708 FT /rpt_family="MaLR" FT misc_feature 17493851..17493963 FT /note="match to EST AL556843 (NID:g12899880)" FT misc_feature 17493854..17493963 FT /note="match to EST BF935642 (NID:g12352966)" FT misc_feature 17493855..17493967 FT /note="match to EST BF947088 (NID:g12364272)" FT misc_feature 17493855..17493866 FT /note="match to EST AV657177 (NID:g9878191)" FT misc_feature 17493855..17493949 FT /note="match to EST AL522297 (NID:g12785790)" FT misc_feature 17493855..17493963 FT /note="match to EST BI544438 (NID:g15431750)" FT /note="match to EST BI552951 (NID:g15440263)" FT /note="match to EST BI599707 (NID:g15492646)" FT /note="match to EST BI602370 (NID:g15495296)" FT /note="match to EST BI603125 (NID:g15496064)" FT /note="match to EST BG476260 (NID:g13408539)" FT /note="similar to Mus musculus EST BG869117 FT (NID:g14219657)" FT /note="similar to Gallus gallus EST BI390378 FT (NID:g15083660)" FT /note="match to EST AL556877 (NID:g12899944)" FT /note="match to EST AW607121 (NID:g7311862)" FT /note="similar to Mus musculus EST BI145424 FT (NID:g14605412)" FT /note="similar to Mus musculus EST BG915846 FT (NID:g14296322)" FT /note="match to EST BF836006 (NID:g12187543)" FT /note="match to EST BG763835 (NID:g14074488)" FT /note="match to EST BF689810 (NID:g11975218)" FT /note="match to EST BG767393 (NID:g14078046)" FT /note="match to EST BG766690 (NID:g14077343)" FT /note="match to EST BG282045 (NID:g13030971)" FT /note="match to EST AV648738 (NID:g9869752)" FT /note="match to EST AV648654 (NID:g9869668)" FT /note="similar to Bos taurus EST AW354296 (NID:g6853286)" FT /note="match to EST BF375181 (NID:g11337206)" FT /note="match to EST BE744629 (NID:g10158621)" FT /note="match to EST BE898155 (NID:g10364341)" FT /note="match to EST BE169193 (NID:g8631914)" FT /note="match to EST AI144281 (NID:g3666090) qb59f10.x1" FT /note="match to EST AL517818 (NID:g12781311)" FT /note="match to EST BF690198 (NID:g11975606)" FT /note="similar to Homo sapiens EST AL565146 FT (NID:g12916230)" FT misc_feature 17493856..17493963 FT /note="match to EST BG702530 (NID:g13973958)" FT misc_feature 17493878..17493963 FT /note="match to EST AA419009 (NID:g2078797) zv33f11.r1" FT misc_feature 17494008 FT /note="match to EST AL522297 (NID:g12785790)" FT repeat_region 17494580..17494720 FT /rpt_family="MIR" FT repeat_region 17494784..17495035 FT /rpt_family="Alu" FT repeat_region 17495038..17495527 FT /rpt_family="ERV1" FT repeat_region 17495654..17495826 FT /rpt_family="MIR" FT repeat_region 17495828..17496235 FT /rpt_family="ERV1" FT repeat_region 17497258..17497318 FT /rpt_family="L2" FT repeat_region 17497350..17497660 FT /rpt_family="Alu" FT repeat_region 17497646..17497674 FT /rpt_family="(TAAA)n" FT repeat_region 17497787..17498095 FT /rpt_family="Alu" FT repeat_region 17498066..17498102 FT /rpt_family="(A)n" FT repeat_region 17498261..17498381 FT /rpt_family="Alu" FT repeat_region 17498382..17498670 FT /rpt_family="Alu" FT repeat_region 17498905..17498925 FT /rpt_family="AT_rich" FT repeat_region 17499125..17499159 FT /rpt_family="AT_rich" FT repeat_region 17499181..17499201 FT /rpt_family="AT_rich" FT repeat_region 17499227..17499326 FT /rpt_family="MIR" FT repeat_region 17499407..17499505 FT /rpt_family="L1" FT repeat_region 17500769..17500919 FT /rpt_family="MIR" FT repeat_region 17501261..17501544 FT /rpt_family="Alu" FT repeat_region 17501608..17501874 FT /rpt_family="Alu" FT repeat_region 17501998..17502361 FT /rpt_family="MaLR" FT repeat_region 17502423..17502529 FT /rpt_family="MIR" FT repeat_region 17502691..17502776 FT /rpt_family="MIR" FT repeat_region 17502810..17502938 FT /rpt_family="Alu" FT misc_feature 17503342..17503482 FT /note="match to EST BG767393 (NID:g14078046)" FT /note="match to EST BG766690 (NID:g14077343)" FT /note="match to EST BF935642 (NID:g12352966)" FT /note="match to EST AI144281 (NID:g3666090) qb59f10.x1" FT /note="match to EST AL517818 (NID:g12781311)" FT /note="match to EST AL556843 (NID:g12899880)" FT /note="match to EST BI544438 (NID:g15431750)" FT /note="match to EST BI552951 (NID:g15440263)" FT /note="match to EST BI599707 (NID:g15492646)" FT /note="match to EST BG702530 (NID:g13973958)" FT /note="match to EST BI457986 (NID:g15248642)" FT /note="match to EST BI602370 (NID:g15495296)" FT /note="match to EST BG715928 (NID:g13995115)" FT /note="match to EST BI545371 (NID:g15432683)" FT /note="match to EST BG476260 (NID:g13408539)" FT /note="similar to Mus musculus EST BG869117 FT (NID:g14219657)" FT /note="similar to Gallus gallus EST BI390378 FT (NID:g15083660)" FT /note="match to EST AL556877 (NID:g12899944)" FT /note="match to EST AW607121 (NID:g7311862)" FT /note="similar to Mus musculus EST BI145424 FT (NID:g14605412)" FT /note="similar to Mus musculus EST BG915846 FT (NID:g14296322)" FT /note="match to EST AA419009 (NID:g2078797) zv33f11.r1" FT /note="match to EST BE062793 (NID:g8407443)" FT /note="match to EST BF836006 (NID:g12187543)" FT /note="match to EST BE062800 (NID:g8407450)" FT /note="match to EST BG763835 (NID:g14074488)" FT /note="match to EST BF689810 (NID:g11975218)" FT misc_feature 17503342..17503392 FT /note="match to EST BE744629 (NID:g10158621)" FT /note="similar to Homo sapiens EST AL565146 FT (NID:g12916230)" FT misc_feature 17503342..17503405 FT /note="match to EST BI603125 (NID:g15496064)" FT misc_feature 17503342..17503488 FT /note="match to EST BG282045 (NID:g13030971)" FT misc_feature 17503342..17503474 FT /note="match to EST AV648738 (NID:g9869752)" FT misc_feature 17503342..17503480 FT /note="match to EST AV648654 (NID:g9869668)" FT misc_feature 17503342..17503440 FT /note="similar to Bos taurus EST AW354296 (NID:g6853286)" FT misc_feature 17503342..17503433 FT /note="match to EST BF375181 (NID:g11337206)" FT misc_feature 17503342..17503349 FT /note="match to EST BE898155 (NID:g10364341)" FT misc_feature 17503342..17503379 FT /note="match to EST BE169193 (NID:g8631914)" FT misc_feature 17503342..17503460 FT /note="match to EST BF690198 (NID:g11975606)" FT misc_feature 17503372..17503394 FT /note="similar to Homo sapiens EST W25983 (NID:g1306250)" FT misc_feature 17503389..17503482 FT /note="match to EST AI423525 (NID:g4269456) tf73a11.x1" FT misc_feature 17503403..17503482 FT /note="match to EST BG706904 (NID:g13982714)" FT misc_feature 17503458..17503482 FT /note="match to EST AI805221 (NID:g5391714) tu44f03.x1" FT /note="match to EST AV724186 (NID:g10828322)" FT misc_feature 17503466..17503482 FT /note="similar to Homo sapiens EST W25983 (NID:g1306250)" FT misc_feature 17503695..17503696 FT /note="match to EST BE744629 (NID:g10158621)" FT repeat_region 17504325..17505279 FT /rpt_family="L1" FT repeat_region 17505291..17505580 FT /rpt_family="Alu" FT misc_feature 17505360..17505366 FT /note="match to EST BE169193 (NID:g8631914)" FT repeat_region 17505580..17505618 FT /rpt_family="(GGGGA)n" FT misc_feature 17506002..17506098 FT /note="match to EST BE062800 (NID:g8407450)" FT /note="match to EST BI544438 (NID:g15431750)" FT /note="match to EST BI552951 (NID:g15440263)" FT /note="match to EST BI599707 (NID:g15492646)" FT /note="match to EST BG706904 (NID:g13982714)" FT /note="match to EST BG702530 (NID:g13973958)" FT /note="match to EST BI457986 (NID:g15248642)" FT /note="match to EST AI805221 (NID:g5391714) tu44f03.x1" FT /note="match to EST AI423525 (NID:g4269456) tf73a11.x1" FT /note="match to EST BI602370 (NID:g15495296)" FT /note="match to EST BG715928 (NID:g13995115)" FT /note="match to EST BI545371 (NID:g15432683)" FT /note="match to EST BG476260 (NID:g13408539)" FT /note="similar to Mus musculus EST BG869117 FT (NID:g14219657)" FT /note="similar to Gallus gallus EST BI390378 FT (NID:g15083660)" FT /note="match to EST AV724186 (NID:g10828322)" FT /note="match to EST AL556877 (NID:g12899944)" FT /note="match to EST AW607121 (NID:g7311862)" FT /note="similar to Mus musculus EST BI145424 FT (NID:g14605412)" FT /note="similar to Mus musculus EST BG915846 FT (NID:g14296322)" FT /note="match to EST AA419009 (NID:g2078797) zv33f11.r1" FT /note="match to EST BE062793 (NID:g8407443)" FT /note="match to EST BF836006 (NID:g12187543)" FT misc_feature 17506002..17506092 FT /note="match to EST BG763835 (NID:g14074488)" FT misc_feature 17506002..17506068 FT /note="match to EST BF689810 (NID:g11975218)" FT /note="match to EST BG767393 (NID:g14078046)" FT /note="match to EST BG766690 (NID:g14077343)" FT misc_feature 17506002..17506062 FT /note="match to EST BF935642 (NID:g12352966)" FT misc_feature 17506002..17506094 FT /note="match to EST AI144281 (NID:g3666090) qb59f10.x1" FT misc_feature 17506002..17506069 FT /note="match to EST AL517818 (NID:g12781311)" FT misc_feature 17506033..17506098 FT /note="match to EST AU099185 (NID:g13550314)" FT repeat_region 17506385..17506482 FT /rpt_family="L1" FT repeat_region 17506863..17506888 FT /rpt_family="(T)n" FT repeat_region 17507193..17507312 FT /rpt_family="Alu" FT repeat_region 17507742..17508052 FT /rpt_family="Alu" FT repeat_region 17508102..17508326 FT /rpt_family="MIR" FT repeat_region 17508547..17508672 FT /rpt_family="L1" FT repeat_region 17509032..17509149 FT /rpt_family="Alu" FT repeat_region 17509216..17509244 FT /rpt_family="(T)n" FT repeat_region 17509734..17509777 FT /rpt_family="L1" FT repeat_region 17509778..17510070 FT /rpt_family="Alu" FT repeat_region 17510071..17510475 FT /rpt_family="L1" FT repeat_region 17510243..17510271 FT /rpt_family="AT_rich" FT repeat_region 17510500..17510807 FT /rpt_family="Alu" FT misc_feature 17510883..17510986 FT /note="similar to Mus musculus EST AI536308 (NID:g4450443) FT ma85d01.y1" FT misc_feature 17510892..17510986 FT /note="match to EST BI667389 (NID:g15581622)" FT misc_feature 17510894..17510986 FT /note="match to EST BI544438 (NID:g15431750)" FT /note="match to EST BI552951 (NID:g15440263)" FT /note="match to EST BG706904 (NID:g13982714)" FT /note="match to EST BG702530 (NID:g13973958)" FT /note="match to EST BI457986 (NID:g15248642)" FT /note="match to EST AI805221 (NID:g5391714) tu44f03.x1" FT /note="match to EST AI423525 (NID:g4269456) tf73a11.x1" FT /note="match to EST BI597954 (NID:g15490893)" FT /note="match to EST BI602370 (NID:g15495296)" FT /note="match to EST AU099185 (NID:g13550314)" FT /note="match to EST BI545371 (NID:g15432683)" FT /note="similar to Mus musculus EST BG869117 FT (NID:g14219657)" FT /note="similar to Gallus gallus EST BI390378 FT (NID:g15083660)" FT /note="match to EST AV724186 (NID:g10828322)" FT /note="match to EST AL556877 (NID:g12899944)" FT /note="match to EST AW607121 (NID:g7311862)" FT misc_feature 17510894..17511058 FT /note="similar to Mus musculus EST BI145424 FT (NID:g14605412)" FT misc_feature 17510894..17510993 FT /note="similar to Mus musculus EST BG915846 FT (NID:g14296322)" FT misc_feature 17510894..17510984 FT /note="match to EST AA419009 (NID:g2078797) zv33f11.r1" FT misc_feature 17510894..17510957 FT /note="match to EST BE062793 (NID:g8407443)" FT misc_feature 17510894..17510918 FT /note="match to EST BF836006 (NID:g12187543)" FT misc_feature 17510894..17510919 FT /note="match to EST BE062800 (NID:g8407450)" FT misc_feature 17510903..17510986 FT /note="match to EST BI603125 (NID:g15496064)" FT misc_feature 17510984 FT /note="match to EST BE062800 (NID:g8407450)" FT repeat_region 17511068..17511368 FT /rpt_family="Alu" FT repeat_region 17511514..17511814 FT /rpt_family="MER1_type" FT misc_feature 17511557..17511598 FT /note="match to EST BI457986 (NID:g15248642)" FT repeat_region 17511833..17511897 FT /rpt_family="MIR" FT repeat_region 17512564..17512692 FT /rpt_family="L1" FT repeat_region 17513043..17513214 FT /rpt_family="MIR" FT misc_feature 17513573..17513859 FT /note="match to EST BI544438 (NID:g15431750)" FT misc_feature 17513573..17513849 FT /note="match to EST BI552951 (NID:g15440263)" FT misc_feature 17513573..17513837 FT /note="match to EST BI599707 (NID:g15492646)" FT misc_feature 17513573..17513833 FT /note="match to EST BI667389 (NID:g15581622)" FT /note="match to EST BG706904 (NID:g13982714)" FT /note="match to EST BG702530 (NID:g13973958)" FT misc_feature 17513573..17513835 FT /note="match to EST BI457986 (NID:g15248642)" FT misc_feature 17513573..17513783 FT /note="match to EST AI805221 (NID:g5391714) tu44f03.x1" FT misc_feature 17513573..17513765 FT /note="match to EST AI423525 (NID:g4269456) tf73a11.x1" FT misc_feature 17513573..17513713 FT /note="match to EST AU099185 (NID:g13550314)" FT misc_feature 17513573..17513715 FT /note="match to EST BI597954 (NID:g15490893)" FT /note="match to EST BI602370 (NID:g15495296)" FT /note="match to EST BI603125 (NID:g15496064)" FT /note="match to EST BG715928 (NID:g13995115)" FT /note="match to EST BI545371 (NID:g15432683)" FT misc_feature 17513573..17513696 FT /note="match to EST BG476260 (NID:g13408539)" FT misc_feature 17513573..17513666 FT /note="similar to Mus musculus EST AI536308 (NID:g4450443) FT ma85d01.y1" FT /note="similar to Mus musculus EST BG869117 FT (NID:g14219657)" FT misc_feature 17513573..17513659 FT /note="similar to Gallus gallus EST BI390378 FT (NID:g15083660)" FT misc_feature 17513573..17513643 FT /note="match to EST AV724186 (NID:g10828322)" FT misc_feature 17513573..17513622 FT /note="match to EST AL556877 (NID:g12899944)" FT misc_feature 17513573..17513614 FT /note="match to EST AW607121 (NID:g7311862)" FT misc_feature 17513620..17513724 FT /note="similar to Homo sapiens EST BE894624 FT (NID:g10357203)" FT repeat_region 17513727..17513751 FT /rpt_family="GC_rich" FT misc_feature 17513755 FT /note="match to EST BG476260 (NID:g13408539)" FT repeat_region 17513770..17513801 FT /rpt_family="GC_rich" FT misc_feature 17513855 FT /note="match to EST BI603125 (NID:g15496064)" FT /note="match to EST BI545371 (NID:g15432683)" FT repeat_region 17514179..17514231 FT /rpt_family="L1" FT repeat_region 17514331..17514544 FT /rpt_family="MER1_type" FT misc_feature 17514337..17514338 FT /note="match to EST BI544438 (NID:g15431750)" FT misc_feature 17514338 FT /note="match to EST BI597954 (NID:g15490893)" FT /note="match to EST BI602370 (NID:g15495296)" FT /note="match to EST BG715928 (NID:g13995115)" FT repeat_region 17514789..17514878 FT /rpt_family="MIR" FT repeat_region 17515168..17515226 FT /rpt_family="MIR" FT repeat_region 17515476..17515663 FT /rpt_family="Alu" FT repeat_region 17515610..17515630 FT /rpt_family="AT_rich" FT repeat_region 17517415..17517611 FT /rpt_family="MIR" FT repeat_region 17517736..17517831 FT /rpt_family="MIR" FT repeat_region 17518368..17518457 FT /rpt_family="L1" FT repeat_region 17518458..17519042 FT /rpt_family="ERV1" FT repeat_region 17519043..17519088 FT /rpt_family="L1" FT misc_feature 17519645..17520073 FT /note="match to EST AA481797 (NID:g2211349) aa93e05.s1" FT repeat_region 17520102..17520412 FT /rpt_family="Alu" FT repeat_region 17520384..17520418 FT /rpt_family="A-rich" FT repeat_region 17520535..17520580 FT /rpt_family="MIR" FT repeat_region 17521058..17521141 FT /rpt_family="MIR" FT repeat_region 17521492..17521515 FT /rpt_family="AT_rich" FT repeat_region 17521512..17521630 FT /rpt_family="Alu" FT repeat_region 17521651..17521672 FT /rpt_family="AT_rich" FT repeat_region 17521756..17521891 FT /rpt_family="L1" FT repeat_region 17522017..17522262 FT /rpt_family="L1" FT repeat_region 17522374..17522660 FT /rpt_family="Alu" FT repeat_region 17522639..17522663 FT /rpt_family="AT_rich" FT repeat_region 17523181..17523637 FT /rpt_family="ERV1" FT repeat_region 17523844..17523906 FT /rpt_family="MIR" FT repeat_region 17524825..17524855 FT /rpt_family="(T)n" FT repeat_region 17524826..17525105 FT /rpt_family="Alu" FT repeat_region 17525550..17525768 FT /rpt_family="MIR" FT repeat_region 17525828..17525859 FT /rpt_family="(TG)n" FT repeat_region 17526349..17526586 FT /rpt_family="Alu" FT repeat_region 17526694..17526860 FT /rpt_family="L1" FT repeat_region 17526977..17527289 FT /rpt_family="Alu" FT repeat_region 17527557..17527580 FT /rpt_family="AT_rich" FT repeat_region 17527587..17527621 FT /rpt_family="(GA)n" FT repeat_region 17527901..17528200 FT /rpt_family="Alu" FT repeat_region 17528903..17529054 FT /rpt_family="MIR" FT repeat_region 17529278..17529344 FT /rpt_family="MIR" FT repeat_region 17529351..17529388 FT /rpt_family="Mariner" FT repeat_region 17529471..17529549 FT /rpt_family="L2" FT repeat_region 17529597..17529895 FT /rpt_family="Alu" FT repeat_region 17530009..17530458 FT /rpt_family="ERVL" FT misc_feature complement(17530227..17709536) FT /note="Quality: Phrap Quality >=40 99.9% of Sequence; FT Estimated Total Number of Errors is 0.1.; STS Content:; FT SHGC-36184 G30090; WI-13901 G21191; SHGC-50339 G33480; FT SHGC-50545 G33619; WI-15951 G24340; SHGC-79088 G48789" FT misc_feature complement(17698794..17889337) FT /note="Quality: Phrap Quality >=40 99.6% of Sequence; FT Estimated Total Number of Errors is 0.2.; STS Content:; FT SHGC-16179 G19328; SHGC-60099 G34505; SHGC-60030 G34475; FT SHGC-36017 G30036; SHGC-101046 G55677" FT repeat_region 17887345..17887365 FT /rpt_family="AT_rich" FT repeat_region 17887645..17887674 FT /rpt_family="AT_rich" FT misc_feature 17887690..17888134 FT /note="match to EST BF327679 (NID:g11298427)" FT misc_feature 17887690..17887784 FT /note="match to EST BG612810 (NID:g13664193)" FT misc_feature 17887691..17887784 FT /note="match to EST AV725242 (NID:g10830433)" FT repeat_region 17888786..17889452 FT /rpt_family="L2" FT repeat_region 17889448..17889826 FT /rpt_family="L2" FT repeat_region 17890037..17890149 FT /rpt_family="L2" FT misc_feature 17890139..17890140 FT /note="match to EST BF327679 (NID:g11298427)" FT repeat_region 17891630..17891819 FT /rpt_family="L1" FT repeat_region 17891850..17891895 FT /rpt_family="L1" FT repeat_region 17891940..17892010 FT /rpt_family="L1" FT repeat_region 17892739..17892866 FT /rpt_family="MIR" FT repeat_region 17892882..17892989 FT /rpt_family="Alu" FT repeat_region 17892990..17893168 FT /rpt_family="L1" FT repeat_region 17893821..17893849 FT /rpt_family="(T)n" FT repeat_region 17894676..17894846 FT /rpt_family="L1" FT repeat_region 17894851..17894941 FT /rpt_family="L1" FT repeat_region 17895423..17895720 FT /rpt_family="Alu" FT misc_feature 17895560..17895564 FT /note="similar to Homo sapiens EST BG036339 FT (NID:g12431400)" FT repeat_region 17895748..17895824 FT /rpt_family="MER2_type" FT repeat_region 17895822..17895868 FT /rpt_family="MER2_type" FT repeat_region 17895838..17895892 FT /rpt_family="MER2_type" FT repeat_region 17895984..17896441 FT /rpt_family="MER1_type" FT repeat_region 17896633..17896665 FT /rpt_family="(TA)n" FT repeat_region 17896673..17897220 FT /rpt_family="L1" FT repeat_region 17897220..17897871 FT /rpt_family="L1" FT repeat_region 17897869..17897923 FT /rpt_family="CT-rich" FT repeat_region 17897920..17898203 FT /rpt_family="Alu" FT repeat_region 17898222..17898981 FT /rpt_family="L1" FT repeat_region 17898833..17898874 FT /rpt_family="(T)n" FT misc_feature 17898863..17898877 FT /note="match to EST BE464476 (NID:g9510251) hz17f07.x1" FT repeat_region 17898995..17899603 FT /rpt_family="L1" FT repeat_region 17899863..17900790 FT /rpt_family="L1" FT repeat_region 17900942..17901222 FT /rpt_family="L2" FT repeat_region 17901434..17901654 FT /rpt_family="MER2_type" FT repeat_region 17901454..17901482 FT /rpt_family="AT_rich" FT misc_feature 17901726..17902232 FT /note="match to EST AA595486 (NID:g2410836) no34h01.s1" FT repeat_region 17901951..17902146 FT /rpt_family="L2" FT repeat_region 17902234..17902563 FT /rpt_family="L1" FT misc_feature 17902803..17903161 FT /note="similar to Homo sapiens EST AI535993 (NID:g4450128)" FT repeat_region 17902980..17903026 FT /rpt_family="A-rich" FT repeat_region 17903702..17903887 FT /rpt_family="L2" FT misc_feature 17903980..17904293 FT /note="match to EST BE464476 (NID:g9510251) hz17f07.x1" FT repeat_region 17904694..17904746 FT /rpt_family="L2" FT repeat_region 17904758..17904779 FT /rpt_family="AT_rich" FT repeat_region 17904783..17904848 FT /rpt_family="L2" FT repeat_region 17905354..17905584 FT /rpt_family="CR1" FT repeat_region 17905598..17905652 FT /rpt_family="CR1" FT repeat_region 17905758..17905858 FT /rpt_family="CR1" FT repeat_region 17905985..17906561 FT /rpt_family="L1" FT repeat_region 17907007..17907146 FT /rpt_family="L1" FT misc_feature 17907319..17908029 FT /note="match to EST BE973933 (NID:g10587269)" FT repeat_region 17907338..17907696 FT /rpt_family="MER1_type" FT repeat_region 17907956..17908039 FT /rpt_family="L2" FT repeat_region 17908068..17908146 FT /rpt_family="MER1_type" FT repeat_region 17908312..17908603 FT /rpt_family="Alu" FT repeat_region 17908641..17908866 FT /rpt_family="CR1" FT repeat_region 17908938..17909109 FT /rpt_family="MIR" FT repeat_region 17909253..17909453 FT /rpt_family="MER1_type" FT repeat_region 17909656..17909953 FT /rpt_family="Alu" FT repeat_region 17910408..17910445 FT /rpt_family="AT_rich" FT misc_feature 17910714..17910968 FT /note="match to EST BG910549 (NID:g14291025)" FT misc_feature 17910717..17910968 FT /note="match to EST AV725242 (NID:g10830433)" FT misc_feature 17910717..17910958 FT /note="match to EST BG612810 (NID:g13664193)" FT misc_feature 17910730..17910970 FT /note="similar to Homo sapiens EST BG619375 FT (NID:g13670746)" FT misc_feature 17910915..17910968 FT /note="match to EST AV709165 (NID:g10726555)" FT misc_feature 17910966..17910968 FT /note="similar to Homo sapiens EST BG775691 FT (NID:g14046008)" FT repeat_region 17911025..17911053 FT /rpt_family="AT_rich" FT repeat_region 17911482..17911520 FT /rpt_family="AT_rich" FT repeat_region 17911484..17911679 FT /rpt_family="L1" FT misc_feature 17912294..17912296 FT /note="similar to Homo sapiens EST BE378522 (NID:g9323805)" FT repeat_region 17912382..17912498 FT /rpt_family="MER2_type" FT repeat_region 17912610..17912839 FT /rpt_family="MIR" FT repeat_region 17912924..17913246 FT /rpt_family="Mariner" FT misc_feature 17913246..17913533 FT /note="similar to Homo sapiens EST BG481244 FT (NID:g13413523)" FT misc_feature 17913246..17913390 FT /note="similar to Homo sapiens EST AW117401 (NID:g6085985) FT xd90g09.x1" FT misc_feature 17913247..17913858 FT /note="similar to Homo sapiens EST BE741787 FT (NID:g10155779)" FT misc_feature 17913249..17913533 FT /note="similar to Homo sapiens EST BG774442 FT (NID:g14044759)" FT /note="similar to Homo sapiens EST BG773765 FT (NID:g14043962)" FT misc_feature 17913253..17913533 FT /note="similar to Homo sapiens EST BG481872 FT (NID:g13414151)" FT misc_feature 17913261..17913568 FT /note="similar to Homo sapiens EST BG468987 FT (NID:g13401364)" FT misc_feature 17913261..17913559 FT /note="similar to Homo sapiens EST AW630163 (NID:g7376953) FT hh79c10.y1" FT misc_feature 17913261..17913533 FT /note="similar to Homo sapiens EST BG118351 FT (NID:g12611857)" FT /note="similar to Homo sapiens EST BG490663 FT (NID:g13452173)" FT misc_feature 17913261..17913408 FT /note="similar to Homo sapiens EST BG829744 FT (NID:g14177331)" FT misc_feature 17913266..17913544 FT /note="similar to Homo sapiens EST BE383009 (NID:g9328374)" FT /note="similar to Homo sapiens EST BI087344 FT (NID:g14505674)" FT misc_feature 17913266..17913533 FT /note="similar to Homo sapiens EST BF035836 FT (NID:g10743580)" FT misc_feature 17913273..17913875 FT /note="similar to Homo sapiens EST BE409825 (NID:g9346275)" FT misc_feature 17913276..17913331 FT /note="similar to Homo sapiens EST BE378641 (NID:g9324006)" FT misc_feature 17913279..17913829 FT /note="similar to Homo sapiens EST BE512650 (NID:g9719923)" FT misc_feature 17913279..17913552 FT /note="similar to Homo sapiens EST BE901805 FT (NID:g10391349)" FT misc_feature 17913279..17913377 FT /note="similar to Homo sapiens EST BE734440 FT (NID:g10148432)" FT misc_feature 17913280..17913552 FT /note="similar to Homo sapiens EST BE394618 (NID:g9339983)" FT misc_feature 17913280..17913330 FT /note="similar to Homo sapiens EST BF569874 FT (NID:g11643586)" FT misc_feature 17913285..17914102 FT /note="similar to Homo sapiens EST BE793500 FT (NID:g10214802)" FT misc_feature 17913285..17913974 FT /note="similar to Homo sapiens EST BE279658 (NID:g9154652)" FT misc_feature 17913288..17913533 FT /note="similar to Homo sapiens EST BG437347 FT (NID:g13343853)" FT misc_feature 17913302..17913533 FT /note="similar to Homo sapiens EST BE378522 (NID:g9323805)" FT misc_feature 17913397..17913535 FT /note="similar to Homo sapiens EST BF569874 FT (NID:g11643586)" FT misc_feature 17913452..17913544 FT /note="similar to Homo sapiens EST BE378641 (NID:g9324006)" FT misc_feature 17913473..17913541 FT /note="similar to Homo sapiens EST BG829744 FT (NID:g14177331)" FT misc_feature 17913476..17913533 FT /note="similar to Homo sapiens EST BG741162 FT (NID:g14051815)" FT /note="similar to Homo sapiens EST BE899261 FT (NID:g10366571)" FT misc_feature 17913478..17913545 FT /note="similar to Homo sapiens EST AW966119 (NID:g8155955)" FT misc_feature 17913482..17913533 FT /note="similar to Homo sapiens EST BG749157 FT (NID:g14059810)" FT /note="similar to Homo sapiens EST BG506521 FT (NID:g13468038)" FT misc_feature 17913491..17913533 FT /note="similar to Homo sapiens EST AA314409 (NID:g1966809)" FT misc_feature 17913507..17913533 FT /note="similar to Homo sapiens EST BE743713 FT (NID:g10157705)" FT misc_feature 17913508..17913544 FT /note="similar to Homo sapiens EST BE734440 FT (NID:g10148432)" FT misc_feature 17913554..17914305 FT /note="similar to Homo sapiens EST BG749157 FT (NID:g14059810)" FT misc_feature 17913554..17914283 FT /note="similar to Homo sapiens EST BG741162 FT (NID:g14051815)" FT misc_feature 17913554..17914178 FT /note="similar to Homo sapiens EST BG773765 FT (NID:g14043962)" FT misc_feature 17913554..17914177 FT /note="similar to Homo sapiens EST BE743713 FT (NID:g10157705)" FT /note="similar to Homo sapiens EST BG481872 FT (NID:g13414151)" FT misc_feature 17913554..17914095 FT /note="similar to Homo sapiens EST BE899261 FT (NID:g10366571)" FT misc_feature 17913554..17914081 FT /note="similar to Homo sapiens EST BG490663 FT (NID:g13452173)" FT misc_feature 17913554..17914072 FT /note="similar to Homo sapiens EST AA314409 (NID:g1966809)" FT misc_feature 17913554..17914027 FT /note="similar to Homo sapiens EST BG437347 FT (NID:g13343853)" FT misc_feature 17913554..17913995 FT /note="similar to Homo sapiens EST BG481244 FT (NID:g13413523)" FT misc_feature 17913554..17913972 FT /note="similar to Homo sapiens EST BG118351 FT (NID:g12611857)" FT /note="similar to Homo sapiens EST BF035836 FT (NID:g10743580)" FT misc_feature 17913554..17913862 FT /note="similar to Homo sapiens EST BG506521 FT (NID:g13468038)" FT misc_feature 17913554..17913847 FT /note="similar to Homo sapiens EST BE378522 (NID:g9323805)" FT misc_feature 17913554..17913784 FT /note="similar to Homo sapiens EST BG774442 FT (NID:g14044759)" FT misc_feature 17913554..17913736 FT /note="similar to Homo sapiens EST BF569874 FT (NID:g11643586)" FT misc_feature 17913557..17913955 FT /note="similar to Homo sapiens EST AA316488 (NID:g1969058)" FT misc_feature 17913565..17914396 FT /note="similar to Homo sapiens EST BG832145 FT (NID:g14179732)" FT misc_feature 17913567..17914063 FT /note="similar to Homo sapiens EST BG829744 FT (NID:g14177331)" FT misc_feature 17913569..17914178 FT /note="similar to Homo sapiens EST BE734440 FT (NID:g10148432)" FT misc_feature 17913569..17914125 FT /note="similar to Homo sapiens EST BF033249 FT (NID:g10740961)" FT misc_feature 17913569..17914120 FT /note="similar to Homo sapiens EST BE378641 (NID:g9324006)" FT misc_feature 17913569..17914018 FT /note="similar to Homo sapiens EST BI087344 FT (NID:g14505674)" FT misc_feature 17913569..17913964 FT /note="similar to Homo sapiens EST BE383009 (NID:g9328374)" FT misc_feature 17913569..17913943 FT /note="similar to Homo sapiens EST AW966119 (NID:g8155955)" FT misc_feature 17913570..17914158 FT /note="similar to Homo sapiens EST BE392057 (NID:g9337422)" FT misc_feature 17913578..17913800 FT /note="similar to Homo sapiens EST BE394618 (NID:g9339983)" FT misc_feature 17913578..17913715 FT /note="similar to Homo sapiens EST BE901805 FT (NID:g10391349)" FT misc_feature 17913588..17913858 FT /note="similar to Homo sapiens EST BG468987 FT (NID:g13401364)" FT misc_feature 17913590..17913979 FT /note="similar to Homo sapiens EST AA146737 (NID:g1716144) FT zo35c12.r1" FT misc_feature 17913716..17914585 FT /note="similar to Homo sapiens EST BG775691 FT (NID:g14046008)" FT misc_feature 17913731 FT /note="similar to Homo sapiens EST BE742360 FT (NID:g10156352)" FT misc_feature 17913743..17914257 FT /note="similar to Homo sapiens EST BE393344 (NID:g9338805)" FT misc_feature 17913756..17914575 FT /note="similar to Homo sapiens EST BG751861 FT (NID:g14062514)" FT misc_feature 17913771..17913977 FT /note="similar to Homo sapiens EST AV661619 (NID:g9882633)" FT misc_feature 17913772..17914116 FT /note="similar to Homo sapiens EST AA172216 (NID:g1751320) FT zo98b03.r1" FT misc_feature 17913780..17914535 FT /note="similar to Homo sapiens EST BE742360 FT (NID:g10156352)" FT misc_feature 17913783..17914587 FT /note="similar to Homo sapiens EST BE617776 (NID:g9888714)" FT misc_feature 17913809..17914375 FT /note="similar to Homo sapiens EST AI905436 (NID:g6495823)" FT misc_feature 17913836..17914320 FT /note="similar to Homo sapiens EST BE383185 (NID:g9328550)" FT misc_feature 17913838..17914105 FT /note="similar to Homo sapiens EST T87390 (NID:g715742) FT yd83g05.r1" FT misc_feature 17913882..17913885 FT /note="similar to Homo sapiens EST BE378522 (NID:g9323805)" FT misc_feature 17913895..17914389 FT /note="similar to Homo sapiens EST AI905508 (NID:g6495895)" FT misc_feature 17913901..17914659 FT /note="similar to Homo sapiens EST AA642196 (NID:g2567414) FT nr74e08.s1" FT misc_feature 17913916..17914589 FT /note="similar to Homo sapiens EST BF568794 FT (NID:g11642174)" FT misc_feature 17913943..17914269 FT /note="similar to Homo sapiens EST BE901805 FT (NID:g10391349)" FT misc_feature 17913951..17914659 FT /note="similar to Homo sapiens EST AI080485 (NID:g3416736) FT os71d09.x1" FT misc_feature 17913953..17914574 FT /note="similar to Homo sapiens EST BE538970 (NID:g9767615)" FT misc_feature 17913962..17914641 FT /note="similar to Homo sapiens EST BG113369 FT (NID:g12606875)" FT misc_feature 17913973..17914140 FT /note="similar to Homo sapiens EST AA132993 (NID:g1694562) FT zo22a02.r1" FT misc_feature 17913975..17914456 FT /note="similar to Homo sapiens EST AA007468 (NID:g1463434) FT zh98c04.r1" FT misc_feature 17913980..17914601 FT /note="similar to Homo sapiens EST AV745535 FT (NID:g10864982)" FT misc_feature 17913982..17914304 FT /note="similar to Mus musculus EST W82117 (NID:g1539660) FT me98c12.r1" FT misc_feature 17913997..17914151 FT /note="similar to Bos taurus EST BF045923 (NID:g10762978)" FT misc_feature 17914021..17914446 FT /note="similar to Homo sapiens EST BG878310 FT (NID:g14255400)" FT misc_feature 17914022..17914399 FT /note="similar to Homo sapiens EST BG479127 FT (NID:g13411406)" FT misc_feature 17914030..17914172 FT /note="similar to Homo sapiens EST AV661619 (NID:g9882633)" FT misc_feature 17914036..17914410 FT /note="similar to Homo sapiens EST BI012900 FT (NID:g14416971)" FT misc_feature 17914038..17914343 FT /note="similar to Homo sapiens EST BF087383 FT (NID:g10893093)" FT misc_feature 17914057..17914071 FT /note="similar to Homo sapiens EST AI381559 (NID:g4194340) FT te76g02.x1" FT misc_feature 17914144..17914674 FT /note="similar to Homo sapiens EST AA404622 (NID:g2058850) FT zt43c05.s1" FT misc_feature 17914172..17914296 FT /note="similar to Homo sapiens EST AI431647 (NID:g4304647) FT tg74g04.x1" FT misc_feature 17914173..17914674 FT /note="similar to Homo sapiens EST BE741375 FT (NID:g10155367)" FT misc_feature 17914184..17914662 FT /note="similar to Homo sapiens EST AI381559 (NID:g4194340) FT te76g02.x1" FT misc_feature 17914247..17914656 FT /note="similar to Homo sapiens EST AA131023 (NID:g1692531) FT zo15d01.r1" FT misc_feature 17914297..17914299 FT /note="similar to Homo sapiens EST BE392057 (NID:g9337422)" FT misc_feature 17914339..17914660 FT /note="similar to Homo sapiens EST AI431647 (NID:g4304647) FT tg74g04.x1" FT misc_feature 17914343..17914669 FT /note="similar to Homo sapiens EST AW246016 (NID:g6589009)" FT misc_feature 17914351..17914507 FT /note="similar to Mus musculus EST W82117 (NID:g1539660) FT me98c12.r1" FT misc_feature 17914360..17914399 FT /note="similar to Homo sapiens EST BG749157 FT (NID:g14059810)" FT misc_feature 17914372..17914666 FT /note="similar to Homo sapiens EST BG036339 FT (NID:g12431400)" FT misc_feature 17914393..17914631 FT /note="similar to Homo sapiens EST BG978087 FT (NID:g14380822)" FT misc_feature 17914449..17914674 FT /note="similar to Homo sapiens EST AA132485 (NID:g1693976) FT zo17c03.s1" FT misc_feature 17914454..17914575 FT /note="similar to Homo sapiens EST AW117401 (NID:g6085985) FT xd90g09.x1" FT misc_feature 17914454..17914507 FT /note="similar to Homo sapiens EST AW173173 (NID:g6439121) FT xj84c06.x1" FT misc_feature 17914483..17914894 FT /note="match to EST AF000594 (NID:g2316029)" FT misc_feature 17914655 FT /note="similar to Homo sapiens EST AV661619 (NID:g9882633)" FT repeat_region 17914665..17915623 FT /rpt_family="Mariner" FT misc_feature 17915403..17915407 FT /note="similar to Homo sapiens EST AA132485 (NID:g1693976) FT zo17c03.s1" FT repeat_region 17916478..17916626 FT /rpt_family="MaLR" FT repeat_region 17916675..17916791 FT /rpt_family="CT-rich" FT repeat_region 17916779..17917086 FT /rpt_family="MaLR" FT repeat_region 17917091..17917467 FT /rpt_family="MaLR" FT repeat_region 17917468..17917563 FT /rpt_family="MaLR" FT repeat_region 17917564..17918000 FT /rpt_family="ERV1" FT misc_feature 17917933..17917937 FT /note="similar to Homo sapiens EST AA131023 (NID:g1692531) FT zo15d01.r1" FT repeat_region 17918001..17918266 FT /rpt_family="MaLR" FT repeat_region 17918267..17918290 FT /rpt_family="(T)n" FT repeat_region 17918558..17918595 FT /rpt_family="MaLR" FT repeat_region 17918596..17918810 FT /rpt_family="Alu" FT repeat_region 17918812..17918841 FT /rpt_family="(TTTTG)n" FT repeat_region 17918813..17919110 FT /rpt_family="Alu" FT repeat_region 17919113..17919154 FT /rpt_family="MaLR" FT repeat_region 17919156..17919286 FT /rpt_family="MaLR" FT repeat_region 17919403..17919534 FT /rpt_family="L1" FT repeat_region 17919564..17919599 FT /rpt_family="(CAAAA)n" FT repeat_region 17919645..17920605 FT /rpt_family="L1" FT repeat_region 17920610..17921073 FT /rpt_family="L1" FT repeat_region 17921098..17921245 FT /rpt_family="MER2_type" FT repeat_region 17921257..17921511 FT /rpt_family="ERV1" FT repeat_region 17921517..17921972 FT /rpt_family="ERV1" FT repeat_region 17921980..17922636 FT /rpt_family="MER2_type" FT repeat_region 17922637..17922947 FT /rpt_family="Alu" FT repeat_region 17922640..17922665 FT /rpt_family="AT_rich" FT repeat_region 17922948..17923273 FT /rpt_family="MER2_type" FT repeat_region 17923275..17923805 FT /rpt_family="ERVL" FT repeat_region 17923806..17924986 FT /rpt_family="ERVL" FT repeat_region 17924987..17925262 FT /rpt_family="Alu" FT repeat_region 17925263..17925485 FT /rpt_family="ERVL" FT repeat_region 17925490..17925545 FT /rpt_family="ERVL" FT repeat_region 17927213..17927531 FT /rpt_family="Alu" FT repeat_region 17927502..17927531 FT /rpt_family="(A)n" FT misc_feature 17927511..17927529 FT /note="similar to Homo sapiens EST BG036339 FT (NID:g12431400)" FT repeat_region 17927794..17928372 FT /rpt_family="ERVL" FT repeat_region 17928373..17929611 FT /rpt_family="MER2_type" FT repeat_region 17929627..17929747 FT /rpt_family="L1" FT repeat_region 17929748..17930050 FT /rpt_family="Alu" FT repeat_region 17930051..17931842 FT /rpt_family="L1" FT repeat_region 17931844..17931959 FT /rpt_family="Alu" FT repeat_region 17931984..17932115 FT /rpt_family="L1" FT repeat_region 17932363..17932413 FT /rpt_family="L1" FT repeat_region 17932469..17933477 FT /rpt_family="L1" FT repeat_region 17933572..17934164 FT /rpt_family="L1" FT repeat_region 17934279..17934471 FT /rpt_family="MER1_type" FT repeat_region 17934477..17935307 FT /rpt_family="L1" FT repeat_region 17935474..17935669 FT /rpt_family="L1" FT repeat_region 17935722..17936004 FT /rpt_family="L1" FT repeat_region 17937004..17937437 FT /rpt_family="MaLR" FT repeat_region 17937203..17937250 FT /rpt_family="polypyrimidine" FT repeat_region 17937923..17938103 FT /rpt_family="MIR" FT repeat_region 17937984..17938010 FT /rpt_family="(A)n" FT repeat_region 17939515..17939555 FT /rpt_family="AT_rich" FT repeat_region 17939607..17939644 FT /rpt_family="AT_rich" FT repeat_region 17939623..17939928 FT /rpt_family="Alu" FT repeat_region 17940033..17940334 FT /rpt_family="Alu" FT repeat_region 17940669..17941165 FT /rpt_family="L1" FT repeat_region 17941517..17941811 FT /rpt_family="(TA)n" FT repeat_region 17941925..17942422 FT /rpt_family="MER1_type" FT repeat_region 17942067..17942146 FT /rpt_family="(TA)n" FT repeat_region 17942224..17942260 FT /rpt_family="AT_rich" FT repeat_region 17942718..17942905 FT /rpt_family="Alu" FT repeat_region 17942907..17942967 FT /rpt_family="(TA)n" FT repeat_region 17942968..17943094 FT /rpt_family="Alu" FT repeat_region 17944395..17944736 FT /rpt_family="MER1_type" FT repeat_region 17945842..17945962 FT /rpt_family="L1" FT repeat_region 17945949..17946311 FT /rpt_family="L1" FT repeat_region 17946414..17946522 FT /rpt_family="MaLR" FT misc_feature 17947437..17947445 FT /note="similar to Homo sapiens EST AA404622 (NID:g2058850) FT zt43c05.s1" FT repeat_region 17948498..17949318 FT /rpt_family="L1" FT misc_feature 17949671..17949876 FT /note="match to EST AW803375 (NID:g7855245)" FT repeat_region 17949973..17950085 FT /rpt_family="L2" FT repeat_region 17950408..17950617 FT /rpt_family="L2" FT repeat_region 17953097..17953452 FT /rpt_family="L2" FT repeat_region 17954036..17954056 FT /rpt_family="AT_rich" FT repeat_region 17954038..17954336 FT /rpt_family="Alu" FT repeat_region 17954346..17955033 FT /rpt_family="L1" FT misc_feature 17954727..17955285 FT /note="match to EST AW939152 (NID:g8114598)" FT repeat_region 17955340..17955504 FT /rpt_family="L2" FT repeat_region 17955505..17955812 FT /rpt_family="Alu" FT repeat_region 17955788..17955820 FT /rpt_family="(CAAA)n" FT repeat_region 17955813..17957038 FT /rpt_family="L2" FT repeat_region 17957040..17957209 FT /rpt_family="L2" FT repeat_region 17957302..17957573 FT /rpt_family="L2" FT repeat_region 17957588..17958563 FT /rpt_family="L1" FT repeat_region 17958551..17958571 FT /rpt_family="AT_rich" FT repeat_region 17958568..17958806 FT /rpt_family="L2" FT repeat_region 17958971..17959205 FT /rpt_family="L2" FT misc_feature 17959476..17959689 FT /note="match to EST AA737633 (NID:g2768390) oa52e10.s1" FT repeat_region 17960389..17960503 FT /rpt_family="L2" FT repeat_region 17961049..17961150 FT /rpt_family="MIR" FT repeat_region 17962267..17962377 FT /rpt_family="Alu" FT misc_feature 17963372..17963762 FT /note="match to EST AA281895 (NID:g1924573) zt07d04.r1" FT misc_feature 17963526..17963655 FT /note="match to EST AV725242 (NID:g10830433)" FT /note="match to EST AV709165 (NID:g10726555)" FT /note="match to EST BG910549 (NID:g14291025)" FT misc_feature 17963579..17963619 FT /note="similar to Homo sapiens EST BG619375 FT (NID:g13670746)" FT misc_feature 17964411..17964413 FT /note="match to EST BG910549 (NID:g14291025)" FT misc_feature 17964593..17964672 FT /note="match to EST AV725242 (NID:g10830433)" FT /note="match to EST AV709165 (NID:g10726555)" FT repeat_region 17964756..17964776 FT /rpt_family="AT_rich" FT repeat_region 17965240..17965274 FT /rpt_family="AT_rich" FT repeat_region 17966126..17966147 FT /rpt_family="AT_rich" FT misc_feature 17967112..17967619 FT /note="match to EST BG941731 (NID:g14341103) ax16f04.x1" FT repeat_region 17967308..17967419 FT /rpt_family="MIR" FT repeat_region 17967721..17967813 FT /rpt_family="L1" FT repeat_region 17967834..17968171 FT /rpt_family="L1" FT repeat_region 17968259..17969172 FT /rpt_family="L1" FT repeat_region 17969168..17969205 FT /rpt_family="AT_rich" FT repeat_region 17969260..17969382 FT /rpt_family="L1" FT repeat_region 17969408..17969467 FT /rpt_family="Mariner" FT repeat_region 17969469..17969498 FT /rpt_family="(TTTTC)n" FT repeat_region 17969470..17969779 FT /rpt_family="Alu" FT repeat_region 17969825..17969878 FT /rpt_family="Mariner" FT repeat_region 17970216..17970526 FT /rpt_family="MER1_type" FT repeat_region 17972731..17972759 FT /rpt_family="AT_rich" FT repeat_region 17972793..17972872 FT /rpt_family="L1" FT repeat_region 17973030..17973054 FT /rpt_family="AT_rich" FT repeat_region 17973392..17973424 FT /rpt_family="AT_rich" FT repeat_region 17973472..17973500 FT /rpt_family="AT_rich" FT repeat_region 17974049..17974164 FT /rpt_family="(TTTAA)n" FT repeat_region 17974233..17974337 FT /rpt_family="AT_rich" FT repeat_region 17974418..17974441 FT /rpt_family="AT_rich" FT misc_feature 17974443..17974508 FT /note="match to EST AV725242 (NID:g10830433)" FT /note="match to EST AV709165 (NID:g10726555)" FT misc_feature 17974473..17974504 FT /note="similar to Homo sapiens EST BG619375 FT (NID:g13670746)" FT repeat_region 17975389..17975558 FT /rpt_family="MER2_type" FT repeat_region 17975848..17975980 FT /rpt_family="L1" FT repeat_region 17976031..17976188 FT /rpt_family="L1" FT repeat_region 17976217..17977017 FT /rpt_family="L1" FT repeat_region 17976322..17976345 FT /rpt_family="AT_rich" FT repeat_region 17977018..17977317 FT /rpt_family="Alu" FT repeat_region 17977318..17977555 FT /rpt_family="L1" FT repeat_region 17977573..17978150 FT /rpt_family="L1" FT repeat_region 17978184..17978225 FT /rpt_family="AT_rich" FT repeat_region 17978340..17978571 FT /rpt_family="L1" FT repeat_region 17978629..17979660 FT /rpt_family="L1" FT repeat_region 17979065..17979085 FT /rpt_family="AT_rich" FT repeat_region 17979690..17979855 FT /rpt_family="L1" FT repeat_region 17979937..17980218 FT /rpt_family="Alu" FT repeat_region 17980405..17980537 FT /rpt_family="L1" FT repeat_region 17980526..17980556 FT /rpt_family="AT_rich" FT repeat_region 17980538..17980786 FT /rpt_family="L1" FT repeat_region 17980787..17981032 FT /rpt_family="L1" FT repeat_region 17981141..17981177 FT /rpt_family="AT_rich" FT repeat_region 17981358..17981820 FT /rpt_family="MaLR" FT repeat_region 17982307..17982627 FT /rpt_family="MER1_type" FT repeat_region 17982665..17983071 FT /rpt_family="L1" FT repeat_region 17983098..17983349 FT /rpt_family="Alu" FT repeat_region 17983723..17983768 FT /rpt_family="(TG)n" FT repeat_region 17986707..17986736 FT /rpt_family="AT_rich" FT repeat_region 17988835..17988942 FT /rpt_family="L1" FT repeat_region 17988943..17989569 FT /rpt_family="L1" FT repeat_region 17989575..17989920 FT /rpt_family="MaLR" FT repeat_region 17989921..17990100 FT /rpt_family="Alu" FT repeat_region 17990056..17990076 FT /rpt_family="AT_rich" FT repeat_region 17990328..17990615 FT /rpt_family="Alu" FT repeat_region 17990650..17990978 FT /rpt_family="L1" FT repeat_region 17991344..17991719 FT /rpt_family="MaLR" FT repeat_region 17991720..17991739 FT /rpt_family="(T)n" FT repeat_region 17992021..17992099 FT /rpt_family="MaLR" FT repeat_region 17992140..17992185 FT /rpt_family="MaLR" FT repeat_region 17992191..17992264 FT /rpt_family="MER1_type" FT misc_feature 17992262..17992286 FT /note="similar to Homo sapiens EST AW152118 (NID:g6200016) FT xf74g07.x1" FT misc_feature 17992349..17992423 FT /note="similar to Homo sapiens EST AW152118 (NID:g6200016) FT xf74g07.x1" FT misc_feature 17992500..17992654 FT /note="similar to Homo sapiens EST AW152118 (NID:g6200016) FT xf74g07.x1" FT repeat_region 17992722..17992746 FT /rpt_family="AT_rich" FT repeat_region 17993694..17994056 FT /rpt_family="MaLR" FT repeat_region 17994602..17994737 FT /rpt_family="L2" FT repeat_region 17994739..17994806 FT /rpt_family="MER1_type" FT repeat_region 17994811..17994847 FT /rpt_family="AT_rich" FT repeat_region 17994835..17995126 FT /rpt_family="Alu" FT repeat_region 17995235..17995475 FT /rpt_family="L2" FT repeat_region 17996288..17996424 FT /rpt_family="L2" FT repeat_region 17996423..17996561 FT /rpt_family="L2" FT misc_feature 17996682..17997214 FT /note="match to EST BG926043 (NID:g14320566)" FT misc_feature 17996872..17997248 FT /note="match to EST AA804753 (NID:g2876108) ob98e06.s1" FT repeat_region 17996990..17997102 FT /rpt_family="MER1_type" FT misc_feature 17997439..17997781 FT /note="match to EST AV714820 (NID:g10796337)" FT repeat_region 17997447..17997632 FT /rpt_family="MIR" FT misc_feature 17997836..17998082 FT /note="match to EST AV714820 (NID:g10796337)" FT repeat_region 17999552..18000311 FT /rpt_family="MER2_type" FT repeat_region 17999953..17999990 FT /rpt_family="AT_rich" FT repeat_region 18000038..18000079 FT /rpt_family="AT_rich" FT repeat_region 18000312..18000609 FT /rpt_family="Alu" FT repeat_region 18000588..18000608 FT /rpt_family="(A)n" FT repeat_region 18000609..18000653 FT /rpt_family="(TA)n" FT repeat_region 18000610..18000814 FT /rpt_family="MER2_type" FT repeat_region 18000815..18001093 FT /rpt_family="Alu" FT repeat_region 18001094..18001212 FT /rpt_family="MER2_type" FT misc_feature 18001613..18001632 FT /note="match to EST BE067265 (NID:g8411915)" FT misc_feature 18001754..18002104 FT /note="match to EST BE067265 (NID:g8411915)" FT repeat_region 18001792..18001834 FT /rpt_family="L2" FT repeat_region 18002101..18002533 FT /rpt_family="L1" FT repeat_region 18002648..18002812 FT /rpt_family="Alu" FT repeat_region 18002835..18002945 FT /rpt_family="MIR" FT repeat_region 18003001..18003165 FT /rpt_family="L2" FT repeat_region 18003315..18003386 FT /rpt_family="MIR" FT repeat_region 18003457..18003484 FT /rpt_family="AT_rich" FT repeat_region 18003523..18003603 FT /rpt_family="(TA)n" FT repeat_region 18004257..18004294 FT /rpt_family="AT_rich" FT repeat_region 18004287..18004411 FT /rpt_family="L1" FT repeat_region 18004845..18005146 FT /rpt_family="L2" FT repeat_region 18005151..18005203 FT /rpt_family="Mariner" FT repeat_region 18005891..18006250 FT /rpt_family="MaLR" FT repeat_region 18006551..18006840 FT /rpt_family="Alu" FT repeat_region 18008109..18008468 FT /rpt_family="MaLR" FT repeat_region 18008731..18008823 FT /rpt_family="L2" FT repeat_region 18008832..18008948 FT /rpt_family="MIR" FT repeat_region 18008946..18008966 FT /rpt_family="AT_rich" FT misc_feature 18009909..18010097 FT /note="match to EST BF959121 (NID:g12376305)" FT repeat_region 18010154..18010356 FT /rpt_family="MIR" FT repeat_region 18010541..18010665 FT /rpt_family="L1" FT repeat_region 18010664..18010901 FT /rpt_family="L1" FT repeat_region 18011640..18011661 FT /rpt_family="AT_rich" FT repeat_region 18011985..18012086 FT /rpt_family="(TATG)n" FT repeat_region 18011986..18012086 FT /rpt_family="ERV1" FT repeat_region 18012088..18012373 FT /rpt_family="Alu" FT repeat_region 18013048..18013068 FT /rpt_family="AT_rich" FT repeat_region 18013270..18013474 FT /rpt_family="MER1_type" FT repeat_region 18014496..18015062 FT /rpt_family="L2" FT repeat_region 18015441..18015729 FT /rpt_family="Alu" FT misc_feature 18016393..18016685 FT /note="match to EST H64129 (NID:g1018930) yr57a02.s1" FT misc_feature 18017250..18017618 FT /note="match to EST H64074 (NID:g1018875) yr57a02.r1" FT repeat_region 18017801..18018021 FT /rpt_family="MIR" FT repeat_region 18018141..18018418 FT /rpt_family="MER1_type" FT repeat_region 18018563..18019705 FT /rpt_family="L1" FT misc_feature 18019742 FT /note="match to EST T05262 (NID:g316414)" FT misc_feature 18020004..18020303 FT /note="match to EST T05262 (NID:g316414)" FT repeat_region 18020482..18020544 FT /rpt_family="(CATATA)n" FT misc_feature 18020674..18020678 FT /note="match to EST BE067265 (NID:g8411915)" FT repeat_region 18020753..18020983 FT /rpt_family="Alu" FT repeat_region 18022364..18022394 FT /rpt_family="(TG)n" FT misc_feature 18022436..18024273 FT /note="CpG_island (%GC=68.1, o/e=0.90, #CpGs=197)" FT repeat_region 18022613..18022668 FT /rpt_family="GC_rich" FT repeat_region 18023067..18023092 FT /rpt_family="GC_rich" FT repeat_region 18023180..18023210 FT /rpt_family="GC_rich" FT misc_feature 18023221..18023298 FT /note="match to EST AV725242 (NID:g10830433)" FT /note="match to EST AV709165 (NID:g10726555)" FT repeat_region 18023310..18023350 FT /rpt_family="(CGG)n" FT misc_feature 18024332..18024774 FT /note="match to EST AW070336 (NID:g6025334) xa10d01.x1" FT repeat_region 18024387..18024508 FT /rpt_family="L2" FT misc_feature 18024540..18024773 FT /note="match to EST AI216705 (NID:g3785746) qg67h06.x1" FT misc_feature 18024936..18024937 FT /note="match to EST AI216705 (NID:g3785746) qg67h06.x1" FT repeat_region 18025073..18025467 FT /rpt_family="MaLR" FT repeat_region 18025689..18025730 FT /rpt_family="(TC)n" FT repeat_region 18025731..18025762 FT /rpt_family="(CA)n" FT repeat_region 18025750..18025791 FT /rpt_family="MaLR" FT repeat_region 18025792..18026172 FT /rpt_family="MaLR" FT repeat_region 18026173..18026217 FT /rpt_family="MaLR" FT repeat_region 18026372..18026721 FT /rpt_family="MaLR" FT repeat_region 18026722..18027243 FT /rpt_family="MaLR" FT repeat_region 18027244..18027320 FT /rpt_family="MaLR" FT repeat_region 18027604..18027907 FT /rpt_family="Alu" FT misc_feature 18027885..18027903 FT /note="similar to Homo sapiens EST AW173173 (NID:g6439121) FT xj84c06.x1" FT repeat_region 18027887..18027907 FT /rpt_family="(A)n" FT repeat_region 18028050..18028462 FT /rpt_family="MaLR" FT repeat_region 18028921..18028944 FT /rpt_family="AT_rich" FT repeat_region 18030118..18030298 FT /rpt_family="MIR" FT repeat_region 18030333..18030500 FT /rpt_family="MIR" FT repeat_region 18031717..18031746 FT /rpt_family="AT_rich" FT repeat_region 18031897..18032218 FT /rpt_family="MaLR" FT repeat_region 18032234..18032362 FT /rpt_family="MaLR" FT repeat_region 18032452..18033960 FT /rpt_family="L1" FT repeat_region 18034025..18034090 FT /rpt_family="L2" FT repeat_region 18034078..18034106 FT /rpt_family="(TGAA)n" FT repeat_region 18034138..18034206 FT /rpt_family="L2" FT repeat_region 18034323..18034589 FT /rpt_family="Alu" FT repeat_region 18034599..18034627 FT /rpt_family="(CAAA)n" FT repeat_region 18034684..18035039 FT /rpt_family="MaLR" FT repeat_region 18035219..18035521 FT /rpt_family="MER1_type" FT repeat_region 18035313..18035344 FT /rpt_family="AT_rich" FT repeat_region 18036262..18036284 FT /rpt_family="AT_rich" FT repeat_region 18036567..18036637 FT /rpt_family="L2" FT repeat_region 18036667..18036916 FT /rpt_family="MaLR" FT repeat_region 18036958..18037320 FT /rpt_family="MaLR" FT repeat_region 18037520..18037903 FT /rpt_family="L2" FT repeat_region 18037949..18038095 FT /rpt_family="L1" FT repeat_region 18038115..18038422 FT /rpt_family="Alu" FT repeat_region 18038398..18038422 FT /rpt_family="(TAAA)n" FT repeat_region 18038644..18039024 FT /rpt_family="MaLR" FT repeat_region 18039048..18039230 FT /rpt_family="L1" FT repeat_region 18039564..18039808 FT /rpt_family="L1" FT repeat_region 18039657..18039680 FT /rpt_family="AT_rich" FT repeat_region 18039809..18040185 FT /rpt_family="MaLR" FT repeat_region 18040186..18040881 FT /rpt_family="L1" FT repeat_region 18040345..18040373 FT /rpt_family="AT_rich" FT repeat_region 18040987..18041053 FT /rpt_family="(TC)n" FT repeat_region 18041243..18041285 FT /rpt_family="MaLR" FT repeat_region 18041489..18041645 FT /rpt_family="Alu" FT repeat_region 18041631..18041676 FT /rpt_family="(TAAA)n" FT repeat_region 18042068..18042234 FT /rpt_family="Alu" FT repeat_region 18042760..18043090 FT /rpt_family="MaLR" FT repeat_region 18043188..18043364 FT /rpt_family="MER1_type" FT repeat_region 18043486..18043566 FT /rpt_family="L2" FT repeat_region 18043926..18044046 FT /rpt_family="Mariner" FT repeat_region 18044313..18044450 FT /rpt_family="L1" FT repeat_region 18044954..18045155 FT /rpt_family="L2" FT repeat_region 18045390..18045413 FT /rpt_family="AT_rich" FT repeat_region 18045698..18046280 FT /rpt_family="MaLR" FT repeat_region 18046264..18046293 FT /rpt_family="AT_rich" FT repeat_region 18046418..18047250 FT /rpt_family="L1" FT repeat_region 18047251..18047546 FT /rpt_family="Alu" FT repeat_region 18047547..18047703 FT /rpt_family="L1" FT repeat_region 18047714..18048085 FT /rpt_family="MaLR" FT repeat_region 18048086..18048669 FT /rpt_family="L1" FT repeat_region 18048691..18049104 FT /rpt_family="L1" FT repeat_region 18049535..18050354 FT /rpt_family="L2" FT repeat_region 18050363..18050536 FT /rpt_family="MaLR" FT repeat_region 18050528..18050612 FT /rpt_family="MaLR" FT repeat_region 18050613..18050857 FT /rpt_family="L2" FT repeat_region 18051090..18051441 FT /rpt_family="MaLR" FT repeat_region 18051442..18051728 FT /rpt_family="Alu" FT repeat_region 18051729..18051858 FT /rpt_family="MaLR" FT repeat_region 18051867..18051999 FT /rpt_family="L2" FT repeat_region 18052055..18052341 FT /rpt_family="Alu" FT repeat_region 18052963..18053466 FT /rpt_family="ERVL" FT repeat_region 18053411..18053440 FT /rpt_family="AT_rich" FT repeat_region 18053729..18053923 FT /rpt_family="ERVL" FT repeat_region 18054006..18054362 FT /rpt_family="L2" FT repeat_region 18056598..18056621 FT /rpt_family="AT_rich" FT repeat_region 18056834..18056933 FT /rpt_family="L1" FT repeat_region 18056983..18057071 FT /rpt_family="(TTCC)n" FT repeat_region 18057871..18057952 FT /rpt_family="L2" FT repeat_region 18058286..18058460 FT /rpt_family="MIR" FT repeat_region 18058890..18059189 FT /rpt_family="Alu" FT repeat_region 18059733..18059769 FT /rpt_family="AT_rich" FT repeat_region 18060155..18060200 FT /rpt_family="AT_rich" FT repeat_region 18060325..18060346 FT /rpt_family="AT_rich" FT repeat_region 18060469..18060516 FT /rpt_family="ERVL" FT repeat_region 18060508..18060566 FT /rpt_family="(TCTA)n" FT repeat_region 18060564..18061026 FT /rpt_family="ERVL" FT repeat_region 18061063..18061095 FT /rpt_family="AT_rich" FT repeat_region 18061301..18061334 FT /rpt_family="AT_rich" FT repeat_region 18061387..18061967 FT /rpt_family="MER2_type" FT repeat_region 18062221..18062533 FT /rpt_family="L1" FT repeat_region 18062719..18063107 FT /rpt_family="L1" FT repeat_region 18063108..18063388 FT /rpt_family="Alu" FT repeat_region 18063389..18063490 FT /rpt_family="L1" FT repeat_region 18063470..18063799 FT /rpt_family="L1" FT repeat_region 18063816..18064103 FT /rpt_family="Alu" FT repeat_region 18064104..18064625 FT /rpt_family="L1" FT repeat_region 18064641..18065484 FT /rpt_family="L1" FT repeat_region 18065485..18066098 FT /rpt_family="ERV1" FT repeat_region 18066099..18067260 FT /rpt_family="L1" FT repeat_region 18067756..18067815 FT /rpt_family="(TTTTC)n" FT repeat_region 18067787..18068096 FT /rpt_family="Alu" FT repeat_region 18068167..18068256 FT /rpt_family="CT-rich" FT repeat_region 18068380..18068537 FT /rpt_family="L1" FT repeat_region 18068693..18069157 FT /rpt_family="L2" FT repeat_region 18069439..18069656 FT /rpt_family="MIR" FT repeat_region 18069661..18070284 FT /rpt_family="L2" FT repeat_region 18070276..18070670 FT /rpt_family="L2" FT repeat_region 18071365..18071697 FT /rpt_family="ERVL" FT repeat_region 18071723..18071773 FT /rpt_family="(CA)n" FT repeat_region 18071769..18071817 FT /rpt_family="ERVL" FT repeat_region 18071963..18072211 FT /rpt_family="L2" FT repeat_region 18073022..18074042 FT /rpt_family="L1" FT repeat_region 18074032..18074061 FT /rpt_family="AT_rich" FT repeat_region 18074048..18074867 FT /rpt_family="L1" FT repeat_region 18074198..18074241 FT /rpt_family="AT_rich" FT repeat_region 18074885..18075891 FT /rpt_family="L1" FT repeat_region 18075871..18075907 FT /rpt_family="AT_rich" FT repeat_region 18075915..18076166 FT /rpt_family="L1" FT repeat_region 18076142..18076192 FT /rpt_family="AT_rich" FT repeat_region 18076425..18076463 FT /rpt_family="GA-rich" FT repeat_region 18077214..18077244 FT /rpt_family="(CAAA)n" FT repeat_region 18077337..18077398 FT /rpt_family="MIR" FT repeat_region 18077462..18078006 FT /rpt_family="ERVL" FT repeat_region 18078149..18078250 FT /rpt_family="MER1_type" FT repeat_region 18078445..18078732 FT /rpt_family="Alu" FT repeat_region 18079644..18079703 FT /rpt_family="MIR" FT repeat_region 18080516..18080706 FT /rpt_family="MIR" FT repeat_region 18081163..18081432 FT /rpt_family="MIR" FT repeat_region 18081569..18081681 FT /rpt_family="L2" FT repeat_region 18081683..18081788 FT /rpt_family="MER1_type" FT repeat_region 18081800..18082173 FT /rpt_family="L2" FT repeat_region 18082267..18082645 FT /rpt_family="MaLR" FT repeat_region 18082866..18083165 FT /rpt_family="Alu" FT repeat_region 18083343..18083432 FT /rpt_family="MIR" FT repeat_region 18083441..18083606 FT /rpt_family="MaLR" FT repeat_region 18084074..18084202 FT /rpt_family="MIR" FT repeat_region 18085566..18085675 FT /rpt_family="MIR" FT repeat_region 18085693..18085876 FT /rpt_family="L2" FT repeat_region 18085883..18086240 FT /rpt_family="ERV1" FT repeat_region 18086522..18087347 FT /rpt_family="L2" FT repeat_region 18087365..18087495 FT /rpt_family="L1" FT repeat_region 18087611..18089922 FT /rpt_family="L1" FT repeat_region 18090074..18090096 FT /rpt_family="AT_rich" FT repeat_region 18090098..18090299 FT /rpt_family="L1" FT repeat_region 18090294..18090320 FT /rpt_family="AT_rich" FT repeat_region 18090300..18090608 FT /rpt_family="Alu" FT repeat_region 18090609..18090683 FT /rpt_family="L1" FT repeat_region 18090744..18091175 FT /rpt_family="MER1_type" FT repeat_region 18091286..18091504 FT /rpt_family="MER1_type" FT repeat_region 18091474..18091497 FT /rpt_family="AT_rich" FT repeat_region 18098404..18098449 FT /rpt_family="A-rich" FT repeat_region 18098445..18098723 FT /rpt_family="L1" FT repeat_region 18099140..18099807 FT /rpt_family="L2" FT repeat_region 18099808..18100267 FT /rpt_family="L1" FT repeat_region 18100268..18100646 FT /rpt_family="MaLR" FT repeat_region 18100647..18100764 FT /rpt_family="L1" FT repeat_region 18100772..18101088 FT /rpt_family="L2" FT repeat_region 18101240..18101282 FT /rpt_family="(TAAA)n" FT repeat_region 18102883..18103889 FT /rpt_family="AcHobo" FT repeat_region 18103037..18103065 FT /rpt_family="AT_rich" FT repeat_region 18103761..18103782 FT /rpt_family="AT_rich" FT repeat_region 18103991..18104284 FT /rpt_family="AcHobo" FT repeat_region 18104329..18104473 FT /rpt_family="L2" FT repeat_region 18104676..18104776 FT /rpt_family="L2" FT repeat_region 18104848..18105089 FT /rpt_family="MIR" FT repeat_region 18105190..18105282 FT /rpt_family="MIR" FT repeat_region 18105797..18105844 FT /rpt_family="AT_rich" FT repeat_region 18106366..18106400 FT /rpt_family="(TAGA)n" FT repeat_region 18106508..18106549 FT /rpt_family="(TTTA)n" FT repeat_region 18106537..18106578 FT /rpt_family="L1" FT repeat_region 18106643..18106665 FT /rpt_family="AT_rich" FT repeat_region 18107577..18107604 FT /rpt_family="(T)n" FT repeat_region 18108063..18108566 FT /rpt_family="MaLR" FT repeat_region 18108730..18109251 FT /rpt_family="ERVL" FT repeat_region 18110763..18110844 FT /rpt_family="L2" FT repeat_region 18111166..18111199 FT /rpt_family="AT_rich" FT repeat_region 18111187..18111319 FT /rpt_family="MIR" FT repeat_region 18112607..18112869 FT /rpt_family="MIR" FT repeat_region 18112969..18113154 FT /rpt_family="MIR" FT repeat_region 18113729..18113751 FT /rpt_family="AT_rich" FT repeat_region 18113854..18113878 FT /rpt_family="AT_rich" FT repeat_region 18115196..18115353 FT /rpt_family="L2" FT repeat_reg