ID AM922264; SV 1; circular; genomic DNA; STD; VRL; 618 BP. XX AC AM922264; XX DT 14-DEC-2008 (Rel. 98, Created) DT 14-DEC-2008 (Rel. 98, Last updated, Version 1) XX DE Barley dwarf virus complete genome defective form, isolate SA12EcoSm4 XX KW . XX OS Barley dwarf virus OC Viruses; ssDNA viruses; Geminiviridae; Mastrevirus; OC unclassified Mastrevirus. XX RN [1] RP 1-618 RA Schubert J.; RT ; RL Submitted (10-DEC-2007) to the INSDC. RL Schubert J., Institute of Resistance Research, Federal Centre for Breeding RL Research, Erwin-Baur-Str. 27, D-06484 Quedlinburg, GERMANY. XX RN [2] RA Schubert J., Habekuss A., Qui Y., Zhou X.; RT "Appearance of defective forms of Barley dwarf virus"; RL Unpublished. XX FH Key Location/Qualifiers FH FT source 1..618 FT /organism="Barley dwarf virus" FT /isolate="SA12EcoSm4" FT /mol_type="genomic DNA" FT /country="Germany:Saxony-Anhalt, Salzmuende" FT /isolation_source="Hordeum vulgare" FT /collected_by="A. Habekuss" FT /collection_date="12-Mar-2007" FT /identified_by="J. Schubert" FT /db_xref="taxon:497862" FT misc_feature join(384..618,1..92) FT /function="bidirectional promoter" FT /note="long intergenic region" FT /note="contains deletion" FT misc_feature 93..205 FT /function="promoter" FT /note="short intergenic region" FT /note="5' deletion" FT CDS complement(186..263) FT /pseudo FT /gene="truncated rep" FT /note="5'-terminal part of reading frame missing due to FT deletion" FT CDS complement(255..383) FT /gene="repA" FT /product="hypothetical protein" FT /function="defective repA" FT /note="most of the C-terminal part missing due to deletion" FT /db_xref="GOA:B7FDD5" FT /db_xref="InterPro:IPR022690" FT /db_xref="UniProtKB/TrEMBL:B7FDD5" FT /protein_id="CAP58254.1" FT /translation="MASSSAPRFRVYSKYLFLTYPQCILEPQYALDSLRTLLAKYV" XX SQ Sequence 618 BP; 165 A; 143 C; 175 G; 135 T; 0 other; accctgcgtg gtgggtcccg aggcgcactc ggcttttcgt gagtgcgccg aggattttgg 60 accacgtctt tatgtcatca catcaattat tgaagataaa ccaaactatg acatacaaca 120 cactcataac caaaacatcg aaaaaagaaa tacaaggggc gagatcacac aattttagaa 180 accgtagccg tccgcgctag gacagtcact gcgaagcagt gacattttcg ccgaaggcga 240 agaatgattc accctcatac atatttggcc aagagagtgc gaagagagtc caaggcgtac 300 tgtggctcta ggatgcattg aggatatgtt aggaagaggt atttggaata gacacggaac 360 ctgggtgcag atgaagaggc catagtagca agcagaagcc cggcaggtcc ttagcgaaaa 420 aacggggtgt gctcgcgccc tctactctct accctgcgtg ggagtgtgca gaattcacac 480 cgatgggctc ggtgtccacg gtttaaatat tgcaggttta ggtgggaacg cgggaccctg 540 tcttttcggc gcgaaagcga cgtgtggtcc cgcgtgtggt ttgtggctcg gggacccgcc 600 acgcaggaat ctaatatt 618 //