ID AM498056; SV 2; linear; genomic RNA; STD; VRL; 1637 BP. XX AC AM498056; XX DT 15-JUL-2008 (Rel. 96, Created) DT 08-NOV-2008 (Rel. 97, Last updated, Version 4) XX DE Bluetongue virus 8 complete viral segment 6 XX KW complete genome; complete viral segment; outer capsid protein VP5; S6 gene. XX OS Bluetongue virus 8 OC Viruses; dsRNA viruses; Reoviridae; Sedoreovirinae; Orbivirus. XX RN [1] RC revised by [3] RA Maan S.; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL Maan S., Department of Epidemiology, Institute for Animal Health, Pirbright RL Laboratory, Ash Road, Pirbright, Woking, Surrey GU24 0NF, United Kingdom. XX RN [2] RX DOI; 10.1016/j.virol.2008.04.028. RX PUBMED; 18570969. RA Maan S., Maan N.S., Ross-Smith N., Batten C.A., Shaw A.E., Anthony S.J., RA Samuel A.R., Darpel K.E., Veronesi E., Oura C.A.L., Singh K.P., Nomikou K., RA Potgieter A.C., Attoui H., van Rooij E., van Rijn P., De Clercq K., RA Vandenbussche F., Zientara S., Breard E., Beer M., Hoffman B., Mellor P.S., RA Mertens P.P.C.; RT "Sequence analysis of bluetongue virus serotype 8 from the Netherlands 2006 RT and comparison to other European strains"; RL Virology 377(2):308-318(2008). XX RN [3] RP 1-1637 RA Maan S.; RT ; RL Submitted (07-NOV-2008) to the INSDC. RL Maan S., Department of Epidemiology, Institute for Animal Health, Pirbright RL Laboratory, Ash Road, Pirbright, Woking, Surrey GU24 0NF, United Kingdom. XX CC Related entries AM498051-AM498055 and AM498057-AM498060. XX FH Key Location/Qualifiers FH FT source 1..1637 FT /organism="Bluetongue virus 8" FT /segment="6" FT /host="Ovis aries" FT /strain="BTV-8NT (NET2006/04)" FT /mol_type="genomic RNA" FT /country="Netherlands" FT /collection_date="2006" FT /db_xref="taxon:197780" FT CDS 28..1608 FT /gene="S6" FT /product="outer capsid protein VP5" FT /function="variable protein, helps control virus serotype" FT /db_xref="GOA:B4E553" FT /db_xref="InterPro:IPR000145" FT /db_xref="UniProtKB/TrEMBL:B4E553" FT /protein_id="CAM57247.2" FT /translation="MGKIIKSLSRFGKKVGNALTSNTAKKIYSTIGKAAERFAESEIGS FT AAIDGLVQGSVHSLMTGESYGESVKQAVLLNVMGSGEELPDPLSPGERGMQTKIRELED FT EQRNELIRLKYNDKIKQKFGKELEEVYEFMNGVAKQEEDEEKHYDVLKKAVNSYDKILT FT EEEKQMRILATALQKEVKERTGTEAVMVKEYRNKIDALKEAIEVERDGMQEEAIQEIAG FT MTADVLEAASEEVPLIGAGMATAVATGRAIEGAYKLKKVINALSGIDLTHLRTPKIEPT FT IVSTVLDHKFKDIPDEMLAVSVLSKNRAIEENHKEIIHLKNEILPRFKKAMDEEKEICG FT IEDKKIHPKVMMKFKIPRTQQPQIHIYSAPWDSDDVFFFHCISHHHANESFFIGFDLGI FT DLVHYEDLTAHWHALGAAQAAVGRSLNEVYKEFLNLAINNTYSSQMHARRMIRSKTVHP FT IYLGSLHYDISFSTLRSNAQRIVYDEELQMHILRGPLHFQRRAILGAIKHGVKILGTEV FT DIPLFLRNA" XX SQ Sequence 1637 BP; 539 A; 277 C; 444 G; 377 T; 0 other; gttaaaaaag cgatcgctct cgcgaagatg gggaaaatca taaagtccct aagccgattc 60 ggaaagaaag ttggaaacgc cttaacatca aacacagcaa aaaagattta tagcacaatt 120 ggaaaagcgg ctgaacgatt tgcagaaagt gaaatcggct cagcggctat tgatgggtta 180 gttcagggga gtgtacattc gttgatgacg ggagagtctt acggcgagtc ggtaaaacaa 240 gctgtgctat taaatgtaat gggaagtggt gaagagcttc cagatccact aagtccgggt 300 gaacgtggaa tgcagacaaa gatccgtgaa ttggaggatg aacagcgtaa tgagttgatt 360 cggttgaagt ataatgataa gataaagcaa aaatttggga aagaattaga agaggtatat 420 gagtttatga atggggttgc gaagcaggag gaagacgaag agaaacatta tgatgttctc 480 aaaaaagcgg taaactcgta cgataaaatc ttaaccgagg aggaaaaaca aatgaggatt 540 ttagcaacag cgttacaaaa ggaggtgaag gagcggacgg ggacggaggc cgtcatggta 600 aaagagtatc gaaataagat cgatgcgtta aaagaggcca tagaggtaga gcgtgatgga 660 atgcaggaag aggcgattca ggagatagct ggaatgacgg cggacgtatt ggaggcggct 720 tcggaggaag tgccactaat aggtgcgggg atggcgacag ctgtagctac aggtagggcc 780 atcgaaggag cttacaaatt aaagaaggtt ataaacgctc tcagcggaat cgatttgact 840 cacttaagaa caccgaagat tgagcctacg atagtatcga ctgtgttgga tcataagttt 900 aaggatattc ctgatgagat gctcgcggta agcgttttat caaagaatag agccatcgaa 960 gagaaccata aagagattat acatcttaag aacgagatat tgcctagatt taagaaggcg 1020 atggacgagg agaaggagat atgtggaatc gaagacaaaa agatacatcc gaaagtcatg 1080 atgaaattca aaattccgcg aactcaacag ccccaaatcc atatatatag tgcaccgtgg 1140 gattccgacg acgttttctt ttttcattgt atatcgcatc accacgcgaa tgaatcattt 1200 tttattggat ttgacttagg catcgatctg gttcactacg aagatttgac tgctcattgg 1260 cacgctttgg gtgcggcgca ggcggcggtt gggaggagtc tgaatgaagt gtacaaagaa 1320 tttttgaacc tagcgattaa taacacgtat agctcgcaaa tgcacgctcg gaggatgata 1380 cgatcgaaga ctgtacaccc catatatcta ggctcactcc attatgatat ttcgttttcg 1440 acattacgga gcaatgcgca gagaattgtg tatgatgagg aattacagat gcacatattg 1500 aggggaccac tacatttcca aaggcgggcg atactaggcg cgataaaaca tggagttaaa 1560 atcttaggga cggaggttga tatcccactc ttcttaagaa atgcctgagc gcagcggagc 1620 caccgctttc cacttac 1637 //