ID AM498055; SV 2; linear; genomic RNA; STD; VRL; 1776 BP. XX AC AM498055; XX DT 15-JUL-2008 (Rel. 96, Created) DT 01-SEP-2008 (Rel. 97, Last updated, Version 5) XX DE Bluetongue virus 8 complete viral segment 5 XX KW complete genome; complete viral segment; non-structural protein NS1 (TuP); KW S5 gene. XX OS Bluetongue virus 8 OC Viruses; dsRNA viruses; Reoviridae; Sedoreovirinae; Orbivirus. XX RN [1] RC revised by [3] RA Maan S.; RT ; RL Submitted (02-MAR-2007) to the INSDC. RL Maan S., Department of Epidemiology, Institute for Animal Health, Pirbright RL Laboratory, Ash Road, Pirbright, Woking, Surrey GU24 0NF, United Kingdom. XX RN [2] RX DOI; 10.1016/j.virol.2008.04.028. RX PUBMED; 18570969. RA Maan S., Maan N.S., Ross-Smith N., Batten C.A., Shaw A.E., Anthony S.J., RA Samuel A.R., Darpel K.E., Veronesi E., Oura C.A.L., Singh K.P., Nomikou K., RA Potgieter A.C., Attoui H., van Rooij E., van Rijn P., De Clercq K., RA Vandenbussche F., Zientara S., Breard E., Beer M., Hoffman B., Mellor P.S., RA Mertens P.P.C.; RT "Sequence analysis of bluetongue virus serotype 8 from the Netherlands 2006 RT and comparison to other European strains"; RL Virology 377(2):308-318(2008). XX RN [3] RP 1-1776 RA Maan S.; RT ; RL Submitted (08-AUG-2008) to the INSDC. RL Maan S., Department of Epidemiology, Institute for Animal Health, Pirbright RL Laboratory, Ash Road, Pirbright, Woking, Surrey GU24 0NF, United Kingdom. XX CC Related entries AM498051-AM498054 and AM498056-AM498060. XX FH Key Location/Qualifiers FH FT source 1..1776 FT /organism="Bluetongue virus 8" FT /segment="5" FT /host="Ovis aries" FT /strain="BTV-8NT (NET2006/04)" FT /mol_type="genomic RNA" FT /country="Netherlands" FT /collection_date="2006" FT /db_xref="taxon:197780" FT CDS 35..1693 FT /gene="S5" FT /product="non-structural protein NS1 (TuP)" FT /function="forms tubules of unknown function within the FT cytoplasm of infected cells" FT /db_xref="InterPro:IPR002630" FT /db_xref="UniProtKB/TrEMBL:B4E552" FT /protein_id="CAM57246.2" FT /translation="MERFLRKYNISGDYANATRTFLAISPQWTCSHLKRNCLFNGMCVK FT QNFERAMIAATDAEEPAKAYKLVELAKEAMYDRETVWLQCFKSFSQPYEEDVEGKMKRC FT GVQLLEDYRKSGMMDEAVKQSALVNSERVRLDDSLSAMPYIYVPIKEGQIVNPTFISRY FT RQIAYYFYNPDAADDWIDPNLFGIRGQHNQIKREVERQINTCPYTGYKGRVFQVMFLPI FT QLINFLRMDDFAKHFNRYASMAIQQYLRVGYAEEVRYVQQLFGRVPTGEFPLHQMMLIR FT RDFPTRDRSIVEARVRRSGDENWQSWLLPMIIVREGLDHPDRWEWLIDYMDRKHTCQLC FT YLKHSKQIPTCGVIDVRASELTGCSPFKTVKIEEHVGNDSVFKTKLVRDEQIGRIGDHY FT YTTNCYTGAEALITTAIHIHRWIRGCGIWNDEGWQEGIFMLGRVLLRWELTKAQRSALL FT RLFCFVCYGYAPRADGTIPDWNNLGSFLDIILKGPELSEDEDERAYATMFEMVRCIITL FT CYAEKVHFAGFAAPACESGEVINLAARMSQMWMEY" XX SQ Sequence 1776 BP; 483 A; 328 C; 481 G; 484 T; 0 other; gttaaaaaag ttctctagtt ggcaaccacc aaacatggag cgctttttga gaaaatacaa 60 catcagtggg gattacgcaa atgccacgag aacttttttg gctatttcac cacaatggac 120 ttgcagtcat ctaaaaagga attgtttatt taatgggatg tgtgtcaaac aaaattttga 180 gagagcaatg atcgcggcga ccgatgcgga ggagccggcg aaagcgtata aattagttga 240 attggcaaag gaggcaatgt acgatcggga aacagtctgg cttcaatgtt tcaaaagctt 300 ctctcaacca tacgaagagg atgtcgaggg gaagatgaag cggtgcgggg tgcaactgct 360 cgaggattac cgcaagagtg ggatgatgga tgaggccgtg aagcaatccg cattggttaa 420 ttcggaaaga gttagattgg atgattctct ttcagcaatg ccttatatct atgtaccaat 480 caaagagggt caaattgtga atccaacatt tatatcgaga tatcgccaaa ttgcatacta 540 tttctataat ccggatgcgg ctgatgattg gatcgatcca aatctgtttg gcattcgcgg 600 acagcacaat cagatcaaac gtgaggttga gagacaaatt aatacatgcc cctacactgg 660 atacaaaggc agagtgtttc aagtgatgtt cttgccgatt cagctaatca atttcttgag 720 gatggatgat tttgcgaagc atttcaatag gtatgcttcg atggctatac aacaatatct 780 gagagttggt tacgctgaag aggtcagata tgtgcagcag ctttttggaa gggttccaac 840 aggtgagttt ccattacatc agatgatgct gataagacgc gatttcccaa cgcgcgatcg 900 cagcatcgtg gaagcgcggg tgaggagatc gggtgatgag aactggcaga gttggctgct 960 gcctatgatt attgttcgtg aagggttaga tcatccggat cggtgggaat ggcttattga 1020 ttacatggat agaaagcata catgccagct gtgctacctg aagcattcaa agcagatccc 1080 gacctgtggc gtaattgatg tacgcgcatc agagctaacg gggtgctcgc cattcaagac 1140 ggtgaagatc gaagagcatg tgggaaatga ttcggttttc aagacgaaat tggttcgcga 1200 tgaacaaatt ggcaggatcg gagatcatta ttatacaaca aattgctaca ctggagcgga 1260 ggctttgatt acaactgcaa tccacattca tcgctggatt agagggtgtg gcatctggaa 1320 cgatgaggga tggcaggagg gtatcttcat gctcggacgc gtactactga ggtgggagct 1380 gacgaaggca caacgcagtg cactgctcag gttgttctgc tttgtgtgct acggatatgc 1440 gccgcgcgcg gatgggacaa taccggattg gaataacctt ggaagttttt tggatatcat 1500 tctgaagggg ccggaactca gtgaagatga ggatgagagg gcttatgcta cgatgtttga 1560 aatggttcga tgcattatca ctctatgcta tgcagagaag gttcatttcg ctgggttcgc 1620 ggcgcctgcg tgtgagagcg gggaagttat caatctcgct gcgcgtatgt ctcagatgtg 1680 gatggagtat tagttactga cttctgtttt ctgttttttc attcttcttt ctacttctat 1740 tttctcttag cactctacta gaacttttca acttac 1776 //