ID AL111168; SV 1; circular; genomic DNA; STD; PRO; 1641481 BP. XX AC AL111168; AL139074-AL139079; XX PR Project:PRJNA8; XX DT 14-AUG-2006 (Rel. 88, Created) DT 18-AUG-2011 (Rel. 109, Last updated, Version 7) XX DE Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome. XX KW complete genome. XX OS Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 OC Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales; OC Campylobacteraceae; Campylobacter. XX RN [1] RX DOI; 10.1038/35001088. RX PUBMED; 10688204. RA Parkhill J., Wren B.W., Mungall K., Ketley J.M., Churcher C., Basham D., RA Chillingworth T., Davies R.M., Feltwell T., Holroyd S., Jagels K., RA Karlyshev A., Moule S., Pallen M.J., Penn C.W., Quail M., Rajandream M.A., RA Rutherford K.M., VanVliet A., Whitehead S., Barrell B.G.; RT "The genome sequence of the food-borne pathogen Campylobacter jejuni RT reveals hypervariable sequences"; RL Nature 403(6770):665-668(2000). XX RN [2] RC revised by [4] RP 1-1641481 RA Parkhill J.; RT ; RL Submitted (09-FEB-2000) to the INSDC. RL Submitted on behalf of the Campylobacter sequencing team, Sanger Centre, RL Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail: RL parkhill@sanger.ac.uk XX RN [3] RX DOI; 10.1186/1471-2164-8-162. RX PUBMED; 17565669. RA Gundogdu O., Bentley S.D., Holden M.T., Parkhill J., Dorrell N., Wren B.W.; RT "Re-annotation and re-analysis of the Campylobacter jejuni NCTC11168 genome RT sequence"; RL BMC Genomics 8:162-162(2007). XX RN [4] RP 1-1641481 RA Gundogdu O.; RT ; RL Submitted (07-AUG-2006) to the INSDC. RL Submitted on behalf of the Campylobacter sequencing team, Sanger Centre, RL Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA. In Collaboration RL with the Pathogen Molecular Biology Department at The London School of RL Hygiene & Tropical Medicine, London, Keppel Street, WC1E 7HT. RL E-mail:ozan.gundogdu@lshtm.ac.uk XX DR ENA; ERS000062. DR GR; AL111168_GR. DR RFAM; RF00001; 5S_rRNA. DR RFAM; RF00005; tRNA. DR RFAM; RF00010; RNaseP_bact_a. DR RFAM; RF00023; tmRNA. DR RFAM; RF00059; TPP. DR RFAM; RF00169; Bacteria_small_SRP. DR RFAM; RF00177; SSU_rRNA_bacteria. DR RFAM; RF01069; purD. DR RFAM; RF01118; PK-G12rRNA. DR SILVA-LSU; AL111168. DR SILVA-SSU; AL111168. DR StrainInfo; 6328; 0. XX CC Notes: CC Details of C. jejuni sequencing at the Sanger Centre CC are available on the World Wide Web. CC (URL, http://www.sanger.ac.uk/Projects/C_jejuni/) XX FH Key Location/Qualifiers FH FT source 1..1641481 FT /organism="Campylobacter jejuni subsp. jejuni NCTC 11168 = FT ATCC 700819" FT /sub_species="jejuni" FT /strain="NCTC 11168" FT /mol_type="genomic DNA" FT /db_xref="taxon:192222" FT CDS 1..1323 FT /transl_table=11 FT /gene="dnaA" FT /locus_tag="Cj0001" FT /product="chromosomal replication initiator protein" FT /note="Original (2000) note: Cj0001, dnaA, probable FT chromosomal replication initiator protein, len: 440 aa; FT similar to many e.g. DNAA_ECOLI (467 aa), fasta scores; FT opt: 839 z-score: 949.6 E(): 0, 32.3% identity in 470 aa FT overlap. 39.9% identity to HP1529. Contains PS00017 FT ATP/GTP-binding site motif A (P-loop) and Pfam match to FT entry PF00308 bac_dnaA, Bacterial dnaA protein, score FT 419.90, E-value 4e-141" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity score. Appropriate FT motifs present. Putative not added to product function. FT Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:6234204, PMID:9417934, PMID:160000" FT /db_xref="GOA:Q9PJB0" FT /db_xref="InterPro:IPR001957" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR010921" FT /db_xref="InterPro:IPR013159" FT /db_xref="InterPro:IPR013317" FT /db_xref="InterPro:IPR018312" FT /db_xref="InterPro:IPR020591" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJB0" FT /inference="protein motif:Pfam:PF00308" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34182.1" FT /translation="MNPSQILENLKKELSENEYENYLSNLKFNEKQSKADLLVFNAPNE FT LMAKFIQTKYGKKIAHFYEVQSGNKAIINIQAQSAKQSNKSTKIDIAHIKAQSTILNPS FT FTFESFVVGDSNKYAYGACKAIAHKDKLGKLYNPIFVYGPTGLGKTHLLQAVGNASLEM FT GKKVIYATSENFINDFTSNLKNGSLDKFHEKYRNCDVLLIDDVQFLGKTDKIQEEFFFI FT FNEIKNNDGQIIMTSDNPPNMLKGITERLKSRFAHGIIADITPPQLDTKIAIIRKKCEF FT NDINLSNDIINYIATSLGDNIREIEGIIISLNAYATILGQEITLELAKSVMKDHIKEKK FT ENITIDDILSLVCKEFNIKPSDVKSNKKTQNIVTARRIVIYLARALTALTMPQLANYFE FT MKDHTAISHNVKKITEMIENDASLKAKIEELKNKILVKSQS" FT misc_feature 301..1239 FT /note="HMMPfam hit to PF00308, Bacterial dnaA protein,score FT 4.2e-124" FT /inference="protein motif:Pfam:PF00308" FT misc_feature 427..450 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 1483..2550 FT /transl_table=11 FT /gene="dnaN" FT /locus_tag="Cj0002" FT /product="DNA polymerase III, beta chain" FT /EC_number="2.7.7.7" FT /note="Original (2000) note: Cj0002, dnaN, probable DNA FT polymerase III, beta chain, len: 355 aa; similar to e.g. FT DP3B_ECOLI DNA polymerase III, beta chain (EC 2.7.7.7) (366 FT aa), fasta scores; opt: 349 z-score: 372.3 E(): 1.7e-13, FT 19.6% identity in 367 aa overlap. 34.2% identity to HP0500. FT Contains Pfam match to entry PF00712 DNA_pol3_beta, DNA FT polymerase III beta subunit, score 119.80, E-value 5.2e-32" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however, identity score was marginal. FT Alignment matched full sequence length and appropriate FT motifs were present. Thus, putative not added to product FT function. Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:6234204, PMID:12832762, PMID:1575709" FT /db_xref="GOA:Q0PCC3" FT /db_xref="InterPro:IPR001001" FT /db_xref="InterPro:IPR022634" FT /db_xref="InterPro:IPR022635" FT /db_xref="InterPro:IPR022637" FT /db_xref="InterPro:IPR024693" FT /db_xref="UniProtKB/TrEMBL:Q0PCC3" FT /inference="protein motif:Pfam:PF00712" FT /protein_id="CAL34183.1" FT /translation="MKLSINKNTLESAVILCNAYVEKKDSSTITSHLFFHADEDKLLIK FT ASDYEIGINYKIKKIRVESSGFATANAKSIADVIKSLNNEEVVLETIDNFLFVRQKSTK FT YKLPMFNHEDFPNFPNTEGKNQFDIDSSDLSRSLKKILPSIDTNNPKYSLNGAFLDIKT FT DKINFVGTDTKRLAIYTLEKANNQEFSFSIPKKAIMEMQKLFYEKIEIFYDQNMLIAKN FT ENFEFFTKLINDKFPDYEKVIPKTFKQELSFSTEDFIDSLKKISVVTEKMRLHFNKDKI FT IFEGISLDNMEAKTELEIQTGVSEEFNLTIKIKHLLDFLTSIEEEKFTLSVNEPNSAFI FT VKSQGLSMIIMPMIL" FT misc_feature 1483..1839 FT /note="HMMPfam hit to PF00712, DNA polymerase III beta FT subunit, N-te, score 1.9e-11" FT /inference="protein motif:Pfam:PF00712" FT misc_feature 1864..2196 FT /note="HMMPfam hit to PF02767, DNA polymerase III beta FT subunit, cent, score 4e-11" FT /inference="protein motif:Pfam:PF02767" FT misc_feature 2200..2544 FT /note="HMMPfam hit to PF02768, DNA polymerase III beta FT subunit, C-te, score 2.7e-05" FT /inference="protein motif:Pfam:PF02768" FT CDS 2579..4888 FT /transl_table=11 FT /gene="gyrB" FT /locus_tag="Cj0003" FT /product="DNA gyrase subunit B" FT /EC_number="5.99.1.3" FT /note="Original (2000) note: Cj0003, gyrB, probable DNA FT gyrase subunit B, len: 769 aa; similar to many e.g. FT GYRB_BACSU DNA gyrase subunit B (EC 5.99.1.3) (638 FT aa),fasta scores; opt: 2130 z-score: 3165.8 E(): 0, 47.7% FT identity in 773 aa overlap. 61.2% identity to HP0501. FT Contains PS00177 DNA topoisomerase II signature and Pfam FT matches to entry PF00204 DNA_topoisoII, DNA topoisomerase FT II (N-terminal region), score 915.20, E-value 1.9e-271,and FT to entry PF00986 DNA_gyraseB_C, DNA gyrase B FT subunit,carboxyl terminus, score 154.00, E-value 2.6e-42" FT /note="Updated (2006) note: Characterised within FT Escherichia coli and Bacillus subtilis with acceptable FT identity scores. Thus, putative not added to product FT function. Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:160000, PMID:9817874, PMID:2987847" FT /db_xref="GOA:O87667" FT /db_xref="InterPro:IPR001241" FT /db_xref="InterPro:IPR002288" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR006171" FT /db_xref="InterPro:IPR011557" FT /db_xref="InterPro:IPR013506" FT /db_xref="InterPro:IPR013759" FT /db_xref="InterPro:IPR013760" FT /db_xref="InterPro:IPR014721" FT /db_xref="InterPro:IPR018522" FT /db_xref="InterPro:IPR020568" FT /db_xref="UniProtKB/Swiss-Prot:O87667" FT /inference="protein motif:Pfam:PF00986" FT /inference="protein motif:Pfam:PF00204" FT /inference="protein motif:Prosite:PS00177" FT /protein_id="CAL34184.1" FT /translation="MQENYGASNIKVLKGLEAVRKRPGMYIGDTNIGGLHHMIYEVVDN FT SIDEAMAGHCDTIDVEITTEGSCIVSDNGRGIPVDMHPTENMPTLTVVLTVLHAGGKFD FT KDTYKVSGGLHGVGVSVVNALSKKLVATVERNGEIYRQEFSEGKVISEFGVIGKSKKTG FT TTIEFWPDDQIFEVTEFDYEILAKRFRELAYLNPKITINFKDNRVGKHESFHFEGGISQ FT FVTDLNKKEALTKAIFFSVDEEDVNVEVALLYNDTYSENLLSFVNNIKTPDGGTHEAGF FT RMGLTRVISNYIEANASAREKDNKITGDDVREGLIAIVSVKVPEPQFEGQTKGKLGSTY FT VRPIVSKASFEYLTKYFEENPIEAKAIMNKALMAARGREAAKKARELTRKKESLSVGTL FT PGKLADCQSKDPSESEIYLVEGDSAGGSAKQGRERSFQAILPLRGKILNVEKARLDKIL FT KSEQIQNMITAFGCGIGEDFDLSKLRYHKIIIMTDADVDGSHIQTLLLTFFFRFMNELV FT ANGHIYLAQPPLYLYKKAKKQIYLKDEKALSEYLIETGIEGLNYEGIGMNDLKDYLKIV FT AAYRAILKDLEKRFNVISVIRYMIENSNLVKGNNEELFSVIKQFLETQGHNILNHYINE FT NEIRAFVQTQNGLEELVINEELFTHPLYEEASYIFDKIKDRSLEFDKDILEVLEDVETN FT AKKGATIQRYKGLGEMNPEQLWETTMDPSVRRLLKITIEDAQSANDTFNLFMGDEVEPR FT RDYIQAHAKDVKHLDV" FT misc_feature 2666..3097 FT /note="HMMPfam hit to PF02518, Histidine kinase-, DNA FT gyrase B-, and H, score 1.1e-30" FT /inference="protein motif:Pfam:PF02518" FT misc_feature 3233..3739 FT /note="HMMPfam hit to PF00204, DNA gyrase B, score 6.7e-81" FT /inference="protein motif:Pfam:PF00204" FT misc_feature 3818..4153 FT /note="HMMPfam hit to PF01751, Toprim domain, score 1e-08" FT /inference="protein motif:Pfam:PF01751" FT misc_feature 3830..3856 FT /note="PS00177 DNA topoisomerase II signature" FT /inference="protein motif:Prosite:PS00177" FT misc_feature 3962..3994 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 4652..4852 FT /note="HMMPfam hit to PF00986, DNA gyrase B FT subunit,carboxyl terminus, score 3.1e-43" FT /inference="protein motif:Pfam:PF00986" FT CDS complement(4916..5257) FT /transl_table=11 FT /locus_tag="Cj0004c" FT /product="monohaem cytochrome C" FT /note="Original (2000) note: Cj0004c, possible periplasmic FT protein, len: 113 aa. No Hp match. Contains possible FT N-terminal signal sequence" FT /note="Updated (2006) note: NCTC11168 Cj0004c encodes a FT monohaem cytochrome C (PMID:15632441). Together with Cj0005 FT (molybdopterin oxidoreductase), they are homologous to FT sulphite:cytochrome C oxidoreductase (SOR) of Starkeya FT novella (PMID:11557133). Cj0004 mutants showed wild-type FT rates of formate-dependent respiration but were unable to FT respire with sulphite or metabisulphite as electron donors. FT Periplasmic extracts of wild-type NCTC11168 showed a FT symmetrical absorption peak (552nm) after addition of FT sulphite, demonstrating the reduction of cytochrome C. No FT cytochrome C reduction was observed after addition of FT sulphite to periplasmic extracts of the Cj0004c mutant FT (PMID:15632441). Characterised within Campylobacter jejuni, FT so putative not added to product function. Functional FT classification - Energy metabolism -Respiration - Electron FT transport" FT /note="PMID:15632441" FT /db_xref="GOA:Q0PCC1" FT /db_xref="InterPro:IPR009056" FT /db_xref="UniProtKB/TrEMBL:Q0PCC1" FT /protein_id="CAL34185.1" FT /translation="MKKIILILALFLSASWAQNLEINPDTGLIIDPDSPLVEANCLACH FT GSNLITNMHASRKAWLAAIRWMQDSEGLWEIEPEDEEKILNYLEKYYGEKYDTRRRIPL FT AILLQNKTH" FT misc_feature complement(5120..5137) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT sig_peptide complement(5207..5257) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000000_4916_5257 by SignalP 2.0 HMM FT (Signal peptide probability 0.973) with cleavage site FT probability 0.940 between residues 17 and 18" FT CDS complement(5260..6498) FT /transl_table=11 FT /locus_tag="Cj0005c" FT /product="molydopterin containing oxidoreductase" FT /note="Original (2000) note: Cj0005c, possible molybdenum FT containing oxidoreductase, len: 412 aa; similar to many FT eukaryotic oxidoreductases e.g. SUOX_HUMAN sulfite oxidase FT precursor (488 aa), fasta scores; opt: 543 z-score: 338.2 FT E(): 1.4e-11, 29.8% identity in 372 aa overlap and FT NIA_PETHY nitrate reductase from Petunia hybrida (909 FT aa),fasta scores; opt: 281 z-score: 312.5 E(): 3.8e-10, FT 28.9% identity in 395 aa overlap. No Hp match. Contains FT Pfam match to entry PF00174 oxidored_molyb, Oxidoreductase FT molybdopterin binding domain, score 45.20, E-value 1e-12" FT /note="Updated (2006) note: Pfam domain PF03404 Mo-co FT oxidoreductase dimerisation domain identified within CDS. FT One probable transmembrane helix predicted by TMHMM2.0. FT Further support given to product function. Supporting paper FT identified showing interaction with Cj0004c FT (PMID:15632441). Product function modified to more specific FT family member based on characterisation paper. Functional FT classification - Misc" FT /note="PMID:15632441" FT /db_xref="GOA:Q0PCC0" FT /db_xref="InterPro:IPR000572" FT /db_xref="InterPro:IPR005066" FT /db_xref="InterPro:IPR006311" FT /db_xref="InterPro:IPR008335" FT /db_xref="InterPro:IPR014756" FT /db_xref="UniProtKB/TrEMBL:Q0PCC0" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03404" FT /inference="protein motif:Pfam:PF00174" FT /protein_id="CAL34186.1" FT /translation="MKQNDQKENRRDFLKNIGLGLFGISVLSNFSFENFLGSKALAKEL FT PDFKIEGKKDLIYHGEKPLTAETEIYALDSDFTKPENFFVRNNGLPPSLETIKERLHKG FT WTLEIDGESIINKKSYTIEDLKKKFKTYTYALTVECGGNGRSEVIPSTKGTQWGYGAVA FT CGRWTGVRLKDILKDCGIKNDAVYIGYYGIDTKLNGEETSPISRGVPISKALQDETLIA FT WAYEGKDIPLVNGYPLRLVCGGYPASTSGKWLYKISVRNKIHDGEKMEGSYKVPVNPVK FT PGDFNYKGEMKIIESMPIRSVITNIKNGSEIKANKKFEVRGKAWAGELEVSEVYVSNDY FT GVTWTKAKVEKPLNRLAWQKWSAQISIPTKGYYEIWARAIDSQGNSQPMVLAQWNPGGY FT INNACHRVNVYGV" FT misc_feature complement(5263..5628) FT /note="HMMPfam hit to PF03404, Mo-co oxidoreductase FT dimerisation doma, score 6.8e-19" FT /inference="protein motif:Pfam:PF03404" FT misc_feature complement(5707..6375) FT /note="HMMPfam hit to PF00174, Oxidoreductase molybdopterin FT binding d, score 2.1e-14" FT /inference="protein motif:Pfam:PF00174" FT misc_feature complement(6007..6039) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT sig_peptide complement(6373..6498) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000001_5260_6498 by SignalP 2.0 HMM FT (Signal peptide probability 0.861) with cleavage site FT probability 0.853 between residues 42 and 43" FT misc_feature complement(6403..6462) FT /note="1 probable transmembrane helix predicted for Cj0005c FT by TMHMM2.0 at aa 13-32" FT /inference="protein motif:TMHMM:2.0" FT CDS 6703..8010 FT /transl_table=11 FT /locus_tag="Cj0006" FT /product="putative Na+/H+ antiporter family protein" FT /note="Original (2000) note: Cj0006, probable integral FT membrane protein, len: 435 aa; similar to e.g. Y325_HAEIN FT hypothetical protein HI0325 (450 aa), fasta scores; opt: FT 757 z-score: 1654.9 E(): 0, 44.0% identity in 450 aa FT overlap. 47.2% identity to HP0758" FT /note="Updated (2006) note: Pfam domain PF03553 Na+/H+ FT antiporter family identified within CDS. Product modified FT to more specific family member due to motif match. FT Also,eleven probable transmembrane helices predicted by FT TMHMM2.0 giving further support to product function. No FT specific characterisation with acceptable identity score FT has been carried out yet. Thus, putative kept within FT product function. Functional classification FT -Transport/binding proteins - Cations" FT /db_xref="GOA:Q0PCB9" FT /db_xref="InterPro:IPR018461" FT /db_xref="UniProtKB/TrEMBL:Q0PCB9" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03553" FT /protein_id="CAL34187.1" FT /translation="MILTLLTNPIIISVVLMTLLCLFRFNVLLSLLISALVAGVFSHLE FT LVDTMNILISGMKENLKTALSYILLGAIAAAISKTNLTAYLIKIVSHFISHKKYLLLLS FT IALISCFSQNLIPIHVAFIPLLIPPLLSLFNKLKIDRRAVACALTFGLTTPYMVLPVGF FT GLTFQDLLKDNLNANNVSASLNDVTNTMYFAAICMIAGLFLALFVFYRKPREYQEVEIA FT KVDLENLEMTRKEWGVLAGLVLTLILQILTMNLPLSGLLGFVLMVILGGVEFSKVNEVF FT DDGLKMMGFIAFVILVAAGYGEVLKESGSVVDLVNSVVPWMEQSKFLAVFFMLLIGLII FT TMGIGTSFGTIPIIATLFCPICLELGFSTALIIFILGVAGALGDAGSPASETTMGTTVG FT LNADKQHDHIKDTCIPTFIFYNGPLLILGSIIAMFL" FT sig_peptide 6703..6813 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000002_6703_8010 by SignalP 2.0 HMM FT (Signal peptide probability 0.887) with cleavage site FT probability 0.659 between residues 37 and 38" FT misc_feature order(6730..6834,6895..6963,7045..7104,7138..7206, FT 7264..7332,7408..7461,7471..7527,7564..7617,7681..7749, FT 7783..7851,7936..8004) FT /note="11 probable transmembrane helices predicted for FT Cj0006 by TMHMM2.0 at aa 10-44, 65-87, 115-134, FT 146-168,188-210, 236-253, 257-275, 288-305, 327-349, FT 361-383 and 412-434" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 7000..7032 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 7141..7989 FT /note="HMMPfam hit to PF03553, Na+/H+ antiporter FT family,score 4.4e-90" FT /inference="protein motif:Pfam:PF03553" FT CDS 8144..12634 FT /transl_table=11 FT /gene="gltB" FT /locus_tag="Cj0007" FT /product="glutamate synthase (NADPH) large subunit" FT /EC_number="1.4.1.13" FT /note="Original (2000) note: Cj0007, gltB, probable FT glutamate synthase (NADPH) large subunit, len: 1496 aa; FT similar to many e.g. GLTB_ECOLI glutamate synthase (NADPH) FT large chain (1517 aa), fasta scores; opt: 3846 z-score: FT 3828.3 E(): 0, 42.5% identity in 1488 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domains PF00310 Glutamine FT amidotransferases class-II, PF04898 Glutamate synthase FT central domain, PF01645 Conserved region in glutamate FT synthase and PF01493 GXGXG motif were all identified within FT CDS. Further support given to product function. FT Characterised within Bacillus subtilis with acceptable FT identity score. Thus, putative not added to product FT function. Functional classification - Central intermediary FT metabolism - General" FT /note="PMID:2548995, PMID:11029411" FT /db_xref="GOA:Q0PCB8" FT /db_xref="InterPro:IPR000583" FT /db_xref="InterPro:IPR002489" FT /db_xref="InterPro:IPR002932" FT /db_xref="InterPro:IPR006982" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR017932" FT /db_xref="UniProtKB/TrEMBL:Q0PCB8" FT /inference="protein motif:Pfam:PF01493" FT /inference="protein motif:Pfam:PF01645" FT /inference="protein motif:Pfam:PF04898" FT /inference="protein motif:Pfam:PF00310" FT /protein_id="CAL34188.1" FT /translation="MDLENILENNQSIGLYHPKNEHDACGIAAVANIRGIASYKVICDA FT LEILMNLEHRGGTGAEENSGDGAGILIQIPHDFFKTQELGFELPKKGDYAVAQMFLSPN FT TDAKEEAKEIFLQGLKDKKLEFLGFREVPFNPSDIGASALKAMPYFLQAFVKKPSKISA FT GLEFERVLYSTRRLIEKRAINVPKFYFSSFSSRTIVYKGMLLSTQLSDFYLDFKDVNMK FT SAIALVHSRFSTNTFPSWERAHPNRYMVHNGEINTIRGNVDSIRAREGLMQSEYFENLD FT EIFPIIAKLSSDSAMFDNTLEFLALNGRTLEEAFMMMVPEPWHKNENMESKKRAFYEYH FT SLLMEPWDGPAAIVFTDGVIMGASLDRNGFRPSRYYLTKDDMLILSSETGALKLDEKNI FT KAKKRLEPGKLLLVDTARGRVIADNEIKEHYANAKPYKKWLKNLVELEKQKSGVYKHQF FT LKEDEVLKLQKAFGWSYDELKMSVAAMAQNGKEAIAAMGVDTPLAILSKTYQPLYNYFK FT QLFAQVTNPPLDAIREEIVTSTRIYLGSEGNLLKPDENNAKRVKIALPVISNEELFEVK FT ALNKFQVKEFSILYDYSKKTLEKALDELCVKIEDEVKKGVSIIILSDKGVDEKNAYIPA FT LLAVSGVHNHLVRKNLRTHTSLIIESGEPREIHHFACLLGYGATVINPYLVYESIQKLI FT ANKDLNLSYEKAVENFIKASSSGIVKIASKMGVSTLQSYNGSALFECLGLSSKVIDKYF FT TSTTSRIEGMDLEDFEKELIALHKHAFNDTHKALDSKGIHGFRSAKEEHLIDPLVIFNL FT QQACRNKDYKSFKKYSALVDEKQVNLRSLMEFDFSEAISIDKVESVESIVKRFRTGAMS FT YGSISKEAHECLAQAMNKIGAKSNSGEGGEDEERYEIKEGVDKNSAIKQVASGRFGVDL FT NYLSHAKEIQIKVAQGAKPGEGGQLMGFKVYPWIAKARHSTAGVTLISPPPHHDIYSIE FT DLAQLIYDLKHANKDAKISVKLVSENGIGTVAAGVAKAGANLILVSGYDGGTGASPRTS FT IPHAGIPWELGLAETHQTLILNKLRDRVRLETDGKLMNGRDLAIAALLGAEEFGFATAP FT LIVLGCTMMRVCHLNTCPFGIATQDTELRDRFKGKVDDVINFMYFIAEELREYMARLGF FT ERLDDMIGRVDKLRQKSVQGKAGKLNLDKILKSLPTYNRTAVHFKDYKDNKLEKTIDYR FT ILLPLCKNAVEKKEPIKLSLEVGNQSRTFATMLSSEILKTYGKDALDEDSIHIKAIGNA FT GNSFGAFLLKGIKLEIIGDSNDYLGKGLSGGKIIAKISNEATFSPEENIIAGNACLYGA FT TKGEVYLDGIAGERFCVRNSGALAVVLGTGVHGCEYMTGGQVVVLGDVGANFAAGMSGG FT VVYIFGRHNEAHVNTELVDIKDLNAKDEKELKAVIEKHITYTDSKKAKDILEKFDKKDF FT FKVMPRDYEKMLKMLDLCKNEKDPNLAAFLKITQK" FT misc_feature 8216..9310 FT /note="HMMPfam hit to PF00310, Glutamine amidotransferases FT class-II, score 5.9e-222" FT /inference="protein motif:Pfam:PF00310" FT misc_feature 9533..10381 FT /note="HMMPfam hit to PF04898, Glutamate synthase central FT domain, score 1.8e-181" FT /inference="protein motif:Pfam:PF04898" FT misc_feature 10547..11644 FT /note="HMMPfam hit to PF01645, Conserved region in FT glutamate synthas, score 1e-224" FT /inference="protein motif:Pfam:PF01645" FT misc_feature 11450..11482 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 11870..12451 FT /note="HMMPfam hit to PF01493, GXGXG motif, score 4.1e-72" FT /inference="protein motif:Pfam:PF01493" FT misc_feature 11987..12043 FT /note="PS00095 C-5 cytosine-specific DNA methylases FT C-terminal signature" FT /inference="protein motif:Prosite:PS00095" FT CDS 12644..14395 FT /transl_table=11 FT /locus_tag="Cj0008" FT /product="conserved hypothetical protein Cj0008" FT /note="Original (2000) note: Cj0008, unknown, len: 583 aa; FT similar to Y686_METJA hypothetical protein MJ0686 (580 aa), FT fasta scores; opt: 171 z-score: 228.3 E(): 1.9e-05,22.8% FT identity in 609 aa overlap. 37.5% identity in N-term to FT HP0938, 30.0% identity in C-term to HP0937" FT /note="Updated (2006) note: Pfam PF03235 Protein of unknown FT function (DUF262), was present within CDS. Conserved added FT to product function as motif was identified. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="InterPro:IPR004919" FT /db_xref="InterPro:IPR018651" FT /db_xref="UniProtKB/TrEMBL:Q0PCB7" FT /inference="protein motif:Pfam:PF03235" FT /protein_id="CAL34189.1" FT /translation="MAGFQSPITINEAMQRIKNNEYLLPAFQREYVWEPWQIEELFDSL FT IRGYPISSMLFWKVKDESKTAWKFYRFLEYYRESYHTHNDYFNTSNHKDFYAILDGQQR FT LTSLYFALFGNYDIHRSYNKWENNDRYFKICHFYFNLTQSKKPENENIEYEFLWLDKLE FT TKEQNIYIDKYQQKWFKCQYLYQYDSGRVRKIAKEFNLNENEEDRLDLLHQKIFDKNLI FT NFYLEEEQDPDKAVNIFIRINSNGEPLDYSDILFSIAIANWNKIDARTEINNLVDKINE FT NFDISKDLILKGFLYLFHNNIKFQINSFDKNFIESIEAKWEGIKNAFIETFRLLRSFGF FT EAKTLSSNNAILPILYFIYHKNLTNNIVDSVKCNENRAIIKKWLLRAIILKPFGGSSDT FT VLSNMRKAFIKDFKQNSGFFDREIELFPLEEIEKEAKYIQTIDEEYLENNVIECRKNSP FT EAFAVLSLLYPNLDYKNNNFHKDHLHPESAYKEYEKLYKATDNCISFNIYDSLPNLQML FT DANENESKNNKPLKQWVNEKCNGNRKEFLGKHLIPDVDLSLENFNNFIEERKKIIIDKL FT KSILNKE" FT misc_feature 12668..13450 FT /note="HMMPfam hit to PF03235, Protein of unknown function FT DUF262, score 0.00029" FT /inference="protein motif:Pfam:PF03235" FT CDS 14398..15843 FT /transl_table=11 FT /gene="gltD" FT /locus_tag="Cj0009" FT /product="glutamate synthase (NADPH) small subunit" FT /EC_number="1.4.1.13" FT /note="Original (2000) note: Cj0009, gltD, probable FT glutamate synthase (NADPH) small subunit, len: 481 aa; FT similar to many e.g. GLTD_ECOLI glutamate synthase (NADPH) FT small chain (EC 1.4.1.13) (471 aa), fasta scores; opt: 807 FT z-score: 909.0 E(): 0, 33.0% identity in 482 aa overlap. No FT Hp match" FT /note="Updated (2006) note: Pfam domain PF00070 Pyridine FT nucleotide-disulphide oxidoreductase, PF07992 Pyridine FT nucleotide-disulphide oxidoreductase, PF03486 HI0933-like FT protein, PF01266 FAD dependent oxidoreductase, PF00890 FAD FT binding domain and PF01593 Flavin containing amine FT oxidoreductase were identified within CDS. All Pfam matches FT were identified by carrying out individual Pfam search. FT Further support given to product function. Characterised FT within Escherichia coli with acceptable identity score. FT Thus, putative not added to product function. Functional FT classification - Central intermediary metabolism - General" FT /note="PMID:10481090" FT /db_xref="GOA:Q0PCB6" FT /db_xref="InterPro:IPR001327" FT /db_xref="InterPro:IPR006005" FT /db_xref="InterPro:IPR009051" FT /db_xref="InterPro:IPR012285" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR023753" FT /db_xref="UniProtKB/TrEMBL:Q0PCB6" FT /inference="protein motif:Pfam:PF01593" FT /inference="protein motif:Pfam:PF00890" FT /inference="protein motif:Pfam:PF01266" FT /inference="protein motif:Pfam:PF03486" FT /inference="protein motif:Pfam:PF07992" FT /inference="protein motif:Pfam:PF00070" FT /protein_id="CAL34190.1" FT /translation="MGNARGFLDFKRMDFKKIAPKERILNYKEFTIPLDKKEQEVQGGR FT CMDCGVAFCHTGVMSEGKDVGCPLNNLIPEWNDLVYRSLWKEAYERLDLTNPFPEFTGR FT VCPAPCEDSCVCAINGVSVSIKNNELSIIENAFKENLVRVNKPKQYNGKKIAVIGSGPA FT GLACANTLNSLGYKVSVFERSDKIGGLLMYGIPDMKLDKSIVQRRVDLLKKSGIEFKVN FT ENIDSKDKVSKLLKEFDALVLCTGASKPIDLDIEGRKLKGVEFALDFLTQNTKTLLKTG FT KGADMAKGKNVLVIGSGDTSVDCIAVATRQGAKSIVRFERSPKRPLQRSQNNPWPLKAD FT IFTTDYGLEEAIAVYGKDPREYQKMTKKFLGKTHVEGVEANDLKREFKEGKAINVEISN FT SKKTYKADLVLLAMGFSGCEEAISKNFGVKLDEKNNISTENFQTTHKKIFACGDARKGQ FT SLVVWAIKDGIECALSLHQNLAK" FT misc_feature 14857..15774 FT /note="HMMPfam hit to PF00070, Pyridine FT nucleotide-disulphide oxidoreducta, score 2.4e-23" FT /inference="protein motif:Pfam:PF00070" FT misc_feature 14866..14898 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 15619..15651 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(15844..16419) FT /transl_table=11 FT /gene="rnhB" FT /locus_tag="Cj0010c" FT /product="ribonuclease HII" FT /EC_number="3.1.26.4" FT /note="Original (2000) note: Cj0010c, rnhB, probable FT ribonuclease HII, len: 191 aa; similar to many e.g. FT RNH2_ECOLI ribonuclease HII (EC 3.1.26.4) (198 aa), fasta FT scores; opt: 303 z-score: 506.7 E(): 5.7e-21, 38.6% FT identity in 176 aa overlap. 42.7% identity to HP1323" FT /note="Updated (2006) note: Pfam PF01351 Ribonuclease HII FT was identified within CDS. Further support given to product FT function. Characterised within Escherichia coli with FT acceptable identity score. Thus, putative not added to FT product function. Functional classification -Degradation of FT macromolecules" FT /note="PMID:2172991, PMID:9888800" FT /db_xref="GOA:Q9PJA1" FT /db_xref="InterPro:IPR001352" FT /db_xref="InterPro:IPR012337" FT /db_xref="InterPro:IPR022898" FT /db_xref="InterPro:IPR024567" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJA1" FT /inference="protein motif:Pfam:PF01351" FT /protein_id="CAL34191.1" FT /translation="MKTLFDTKELLNEFDINLIGIDEAGRGALAGPMMMAACKLNKQLD FT GLCDSKKLSEKKREELYEIIIKNSNYLILAFSSEQIDALGLSTCLKKGLKLIKKHFKTE FT NNFLYDGNTNLGINGIKTQIKADTSILQVSAASILAKVSKDRVMNFLAKDFPCYEFEKN FT KAYGTKAHKEFIAKFGICKLHRKSFKLL" FT misc_feature complement(15847..16365) FT /note="HMMPfam hit to PF01351, Ribonuclease HII, score FT 7.2e-39" FT /inference="protein motif:Pfam:PF01351" FT misc_feature complement(16306..16338) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(16452..16691) FT /transl_table=11 FT /locus_tag="Cj0011c" FT /product="putative non-specific DNA binding protein. FT Functional classification-Synthesis and modification of FT macromolecules-DNA replication,restriction/modification, FT recombination and repair" FT /note="Updated (2006) note: Characterisation work carried FT out within Bacillus subtilis, however, sequence alignment FT was only partial. Putative kept within product function" FT /note="Original (2000) note: Cj0011c, possible non-specific FT DNA binding protein, len: 79 aa; similar to the C-terminus FT of CME1_BACSU comE operon protein 1 (comeA) (205 aa), fasta FT scores; opt: 223 z-score: 359.5 E(): 9e-13, 56.9% identity FT in 65 aa overlap. No Hp match. Contains Pfam match to entry FT PF00633 HHH,Helix-hairpin-helix motif., score 31.80, FT E-value 1.6e-05" FT /note="PMID:7968523, PMID:7768800" FT /db_xref="GOA:Q0PCB4" FT /db_xref="InterPro:IPR003583" FT /db_xref="InterPro:IPR004509" FT /db_xref="InterPro:IPR010994" FT /db_xref="UniProtKB/TrEMBL:Q0PCB4" FT /inference="protein motif:Pfam:PF00633" FT /protein_id="CAL34192.1" FT /translation="MKKLLFLFFALTAFLFGAVNINTATLKELKSLNGIGEAKAKAILE FT YRKEANFTSIDDLKKVKGIGDKLFEKIKNDITIE" FT misc_feature complement(16467..16553) FT /note="HMMPfam hit to PF00633, Helix-hairpin-helix FT motif,score 2.1" FT /inference="protein motif:Pfam:PF00633" FT misc_feature complement(16554..16643) FT /note="HMMPfam hit to PF00633, Helix-hairpin-helix FT motif,score 1.5e-06" FT /inference="protein motif:Pfam:PF00633" FT misc_feature complement(16614..16682) FT /note="1 probable transmembrane helix predicted for Cj0011c FT by TMHMM2.0 at aa 4-26" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(16614..16691) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000004_16452_16691 by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.572 between residues 26 and 27" FT CDS complement(16756..17403) FT /transl_table=11 FT /gene="rrc" FT /locus_tag="Cj0012c" FT /product="non-haem iron protein" FT /note="Original (2000) note: Cj0012c, non-haem iron FT protein, len: 215 aa; has three possible iron-binding FT domains; C-terminus is similar to rubrerythrins e.g. FT RUBY_DESVH rubrerythrin (191 aa), fasta scores; opt: 454 FT z-score: 746.8 E(): 0, 39.5% identity in 190 aa FT overlap,with the iron-binding residues of both the FT rubredoxin-like center non-sulfur oxo-bridged di-iron FT center conserved. N-terminal 33 aa are simialar to the FT iron-bindingdomain of desulfoferrodoxins e.g. DESR_DESVH FT desulfoferrodoxin (125 aa), fasta scores; opt: 161 z-score: FT 275.8 E(): 4.2e-08,68.8% identity in 32 aa overlap, with FT the iron-binding residues conserved. No Hp match" FT /note="Updated (2006) note: Pfam domains PF00301 FT Rubredoxin, PF02915 Rubrerythrin and PF06397 FT Desulfoferrodoxin, N-terminal domain were all identified FT within CDS. Further support given to product function. FT Characterisation paper within Campylobacter also identified FT allowing gene name to be designated as Rrc (Rbo/Rbr-like FT protein of C. jejuni) protein. Thus,putative not added to FT product function. Functional classification - FT Transport/binding proteins - Cations" FT /note="PMID:15158262" FT /db_xref="GOA:Q0PCB3" FT /db_xref="InterPro:IPR003251" FT /db_xref="InterPro:IPR004039" FT /db_xref="InterPro:IPR004462" FT /db_xref="InterPro:IPR009040" FT /db_xref="InterPro:IPR009078" FT /db_xref="InterPro:IPR012347" FT /db_xref="InterPro:IPR024934" FT /db_xref="UniProtKB/TrEMBL:Q0PCB3" FT /inference="protein motif:Pfam:PF06397" FT /inference="protein motif:Pfam:PF02915" FT /inference="protein motif:Pfam:PF00301" FT /protein_id="CAL34193.1" FT /translation="MRQYETYKCQKCGNEVEVQNVGGGKLSCCGEEMKCITTDLTAVNL FT MKAFAGESMARNKYDLFADVAEEEGWHAVARHFREAAENEKWHARAEFKAYHEIVDGKP FT LEVTTKNLVTAAEGENYEHTTMYPNFAKIAEDEGKKAIARLFTAIGKVEIEHEREYLAL FT KKMLEEEEFFNSEVEELWVCEVCGHIHRGKKAPAACPLCKAPKEYFKREFLG" FT misc_feature complement(16777..16872) FT /note="HMMPfam hit to PF00301, Rubredoxin, score 1.9e-05" FT /inference="protein motif:Pfam:PF00301" FT misc_feature complement(16903..17283) FT /note="HMMPfam hit to PF02915, Rubrerythrin, score 6e-43" FT /inference="protein motif:Pfam:PF02915" FT misc_feature complement(17296..17403) FT /note="HMMPfam hit to PF06397, Desulfoferrodoxin,N-terminal FT domain, score 4.4e-20" FT /inference="protein motif:Pfam:PF06397" FT CDS 17563..19239 FT /transl_table=11 FT /gene="ilvD" FT /locus_tag="Cj0013" FT /product="dihydroxy-acid dehydratase" FT /EC_number="4.2.1.9" FT /note="Original (2000) note: Cj0013, ilvD, probable FT dihydroxy-acid dehydratase, len: 558 aa; highly similar to FT e.g. ILVD_ECOLI dihydroxy-acid dehydratase (EC 4.2.1.9) FT (605 aa), fasta scores; opt: 1091 z-score: 2191.4 E(): FT 0,46.9% identity in 597 aa overlap. 32.0% identity to FT HP1100 (6-phosphogluconate dehydratase). Contains PS00886 FT and PS00887 Dihydroxy-acid and 6-phosphogluconate FT dehydratases signatures 1 and 2, and Pfam match to entry FT PF00920 ILVD_EDD, Dehydratase family, score 784.10, E-value FT 5.5e-232" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Appropriate motifs present. Thus, putative not added to FT product function. Functional classification - Amino acid FT biosynthesis - Branched chain family" FT /note="PMID:3897211, PMID:790150, PMID:1646790" FT /db_xref="GOA:Q9PJ98" FT /db_xref="InterPro:IPR000581" FT /db_xref="InterPro:IPR004404" FT /db_xref="InterPro:IPR015928" FT /db_xref="InterPro:IPR020558" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ98" FT /inference="protein motif:Pfam:PF00920" FT /inference="protein motif:Prosite:PS00887" FT /inference="protein motif:Prosite:PS00886" FT /protein_id="CAL34194.1" FT /translation="MRSDAIKKGHLRAPNRSLLRACGLKDEDFDKPFIGVANSYIDIIP FT GHYFLNDYAKIIKDEIRKNGCVPFEFNTIGVDDGIAMGHEGMLYSLPSRELIANSIETV FT MNAHQLDALICIPNCDKITPGMLMGALRVNVPTIFVSGGPMASGVTKKGEKISLSSVFE FT AVGAYESKKISEEEFKDIECSACPSGGSCSGMFTANSMNTLCEAMGIALEGNGTILALS FT KEREELLRKAARRICEIALDERFKIRNIITQKAVRNAMVVDMAMGGSSNTVLHMLAISR FT EAGVALDIKDLNFISSKVAHIAKIAPSLNSVYMDDIHKAGGVSAVMAEISSRQGHILEL FT DALTITGESLKERLKNAKIKDENIIRKVDNAYSKVGGLAILFGNLAKQGCVIKTAGIIG FT ERKFKGKAVCFNSQDEAIKGIIKGKVQKGNVCVIRYEGPKGGPGMQEMLSPTSLLMGMG FT LGADVALITDGRFSGATRGLSVGHISPEAAEGGLIGLLKDGDEIEIDVDAYTIHANVSE FT EEIAKRKKEFALPQKEVSSRWLRMYQKLVSNASKGAVLDME" FT misc_feature 17653..19230 FT /note="HMMPfam hit to PF00920, Dehydratase family, score 0" FT /inference="protein motif:Pfam:PF00920" FT misc_feature 17917..17949 FT /note="PS00886 Dihydroxy-acid and 6-phosphogluconate FT dehydratases signature 1" FT /inference="protein motif:Prosite:PS00886" FT misc_feature 18952..18987 FT /note="PS00887 Dihydroxy-acid and 6-phosphogluconate FT dehydratases signature 2" FT /inference="protein motif:Prosite:PS00887" FT CDS complement(19251..19775) FT /transl_table=11 FT /locus_tag="Cj0014c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0014c, probable integral FT membrane protein, len: 174 aa; similar to YAGU_ECOLI FT hypothetical 23.0 kd protein in intF-eaeH intergenic region FT (204 aa), fasta scores; opt: 402 z-score: 821.6 E(): 0, FT 45.1% identity in 184 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF07274 Protein of FT unknown function (DUF1440) identified within CDS. FT Also,three probable transmembrane helices identified by FT TMHMM2.0. Further support given to product function. No FT specific characterisation has been carried out yet. FT Thus,putative kept within product function. Functional FT classification - Central intermediary metabolism -General" FT /db_xref="InterPro:IPR009898" FT /db_xref="UniProtKB/TrEMBL:Q0PCB1" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF07274" FT /protein_id="CAL34195.1" FT /translation="MKKYFQKRYTLAFFIGILAGIFGAIVKWGWEVPFPPRNPNVFWPA FT DALERVTPPKIFLEQLGLPTDWTYMFSGMQMPLSIFIVHVGFSIIFGVAYCMIAEKWHR FT ITMWQGAVFGFFVYLFAHVIIMPLIAEVPPLSEIPFDEHLSEIFGHIVWLWGMEIVRRD FT IRNRITKEIEE" FT misc_feature complement(19296..19730) FT /note="HMMPfam hit to PF07274, Protein of unknown function FT (DUF1440), score 1.1e-96" FT /inference="protein motif:Pfam:PF07274" FT misc_feature complement(join(19674..19742,19482..19550,19386..19445)) FT /note="3 probable transmembrane helices predicted for FT Cj0014c by TMHMM2.0 at aa 12-34, 76-98 and 111-130" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(19704..19775) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000005_19251_19775 by SignalP 2.0 HMM FT (Signal peptide probability 0.976) with cleavage site FT probability 0.268 between residues 24 and 25" FT CDS complement(19867..21093) FT /transl_table=11 FT /locus_tag="Cj0015c" FT /product="hypothetical protein Cj0015c" FT /note="Original (2000) note: Cj0015c, unknown, len: 408 aa; FT 35.4% identity to HP0711" FT /note="Updated (2006) note: Literature search identified FT paper (PMID:15647906) giving potential clues to product FT functionality. Functional classification - Conserved FT hypothetical proteins" FT /note="PMID:15647906" FT /db_xref="InterPro:IPR023279" FT /db_xref="UniProtKB/TrEMBL:Q0PCB0" FT /protein_id="CAL34196.1" FT /translation="MINIKLIEHIFKAASISRWNDYPRMANLVELDKQAHKFIIAYFIA FT KMEKDVDMRVIIEGGIFEFLSRVVVTDIRPDVYHEIVRQKKAEVNAWVLSKIEPMIEDI FT EDGEFLKRFEAYLNGNAYAKERLILKAASYFATRWEFNIVYQTSAFLNDIDEIKNKVEE FT ELEDYYELIGARKIALNQKIAKIIDLSGRLRFQKRWAQTPRIPETAVLGHMLVVAILGY FT FYSLKIKACDKRLENNFYCALFHDLPESLTRDIISPVKYGIDGLHDIINDYEMKLINER FT ILPFVPEGLRAEFSYILGIREGRNGESNFVKNEFENRTYKNAKIELCSGSLSSFNENEF FT GAIDGKALKYCDKIAAYIEAGLSISYGVKSKELESGFLGMHEFFKENPTIDGVNFFEIC FT ESLREYFKI" FT CDS 21159..21833 FT /transl_table=11 FT /locus_tag="Cj0016" FT /product="putative transcriptional regulatory protein" FT /note="Original (2000) note: Cj0016, possible FT transcriptional regulatory protein, len: 224 aa; similar to FT many hypothetical proteins and to TR:Q52925 (EMBL:Z50189) FT Rhizobium meliloti succinoglycan biosynthesis regulator FT exsB (234 aa), fasta scores; opt: 284 z-score: 395.5 E(): FT 9e-15, 33.5% identity in 191 aa overlap. 33.9% identity to FT HP0639 conserved hypothetical protein" FT /note="Updated (2006) note: Pfam domain PF06508 ExsB FT identified within CDS. Further support given to product FT function. Characterisation work carried out within FT Pseudomonas aeruginosa, however, identity scores were not FT acceptable. Thus, putative kept within product function. FT Functional classification - Broad regulatory functions" FT /note="PMID:9045825, PMID:8544814" FT /db_xref="GOA:P0C634" FT /db_xref="InterPro:IPR014729" FT /db_xref="InterPro:IPR018317" FT /db_xref="UniProtKB/Swiss-Prot:P0C634" FT /inference="protein motif:Pfam:PF06508" FT /protein_id="CAL34197.1" FT /translation="MSKKALCIISGGMDSTLCAYLAKKEGYEIIALHFDYEQRTQEKEK FT ECFKQICKALKVEKSYILDVSFIKDIGGNALTDKSIDIPKNELCTSDTPPITYVPFRNG FT IFLSIAGSLAEKENCESIFIGVVEEDGSGYPDCTDEFIQKAQEFINEGTSKNFKVCIKT FT PLVRLNKAKIVELALKENVPLELTWSCYESEDEACGECDSCLLRLRGFEKAGFKDKIKY FT KS" FT misc_feature 21369..21593 FT /note="HMMPfam hit to PF06508, ExsB, score 4.4e-41" FT /inference="protein motif:Pfam:PF06508" FT CDS complement(21854..23380) FT /transl_table=11 FT /gene="dsbI" FT /locus_tag="Cj0017c" FT /product="disulphide bond formation protein" FT /note="Original (2000) note: Cj0017c, probable ATP/GTP FT binding protein, len: 508 aa; 37.4% identity to HP0595 FT hypothetical protein. Contains PS00017 ATP/GTP-binding site FT motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF02600 Disulfide FT bond formation protein DsbB identified within CDS. Gram FT negative bacterial cells have disulfide bond formation FT occuring in the oxidative environment of the periplasm and FT are catalysed by Dsb (disulfide bond) proteins found in the FT periplasm and in the inner membrane. Supporting paper FT (PMID:15632440) demonstrates via deletion and FT complementation that Cj0017c is part of the DsbB family and FT has been designated as dsbI. There is also strong evidence FT that Cj0017c and upstream ORF Cj0018c are co-transcribed FT (PMID:15632440). This information along with motif FT identification has led to a new product function FT designation. In addition, this coding sequence has 100% FT amino acid identity with DsbI from C. jejuni 81-176 FT (CJJ81-176_0044). Characterisation paper within FT Campylobacter jejuni has led to putative being removed from FT product function. Functional classification -Synthesis and FT modification of macromolecules - Protein translation and FT modification" FT /note="PMID:15632440" FT /db_xref="GOA:Q0PCA8" FT /db_xref="InterPro:IPR003752" FT /db_xref="InterPro:IPR023380" FT /db_xref="UniProtKB/TrEMBL:Q0PCA8" FT /inference="protein motif:Pfam:PF02600" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34198.1" FT /translation="MNEINKTKNFYTLMCLAGFLIILLPVGIANLIFGYMLGDSPCTLC FT WGQREAMIFIGVMALFIVRYGMKGKYLAALLIMTAVGLYQSFAHYGNHAHRDLDQGFGL FT AVFGIHTYFWAEVVFWAVVLLLGVIFAFAPKFNAFEAELNGEKFRKYTKFSFAAVLISA FT IIVASNVFQAFVSTGIPPYVGQGDPVRFSLNPKYIIWSKEGWNGLWQNISFLGKRDVKA FT PDYAFAPASEKLGIKFDNDINNAPFAKINDELKITNEQTINFDKAINTLDYINNEFVAS FT SKWDVAFLDNNFSVKEGFELDPYFSASIDPIIGIIPYMNDKFILMGSNKSFLRFAKNPN FT ASEEDIAKQYADFVKGNDKFKGQGESLGRGRLDTVRAKFNHVASMTTDGNYLYLATVPN FT NKDAKTFVISKVSLKDRVLSGEFTPKANLKEGKTLGDLYVTSMTFKDGEIYALSKNHNV FT IAVIDPVKEEVVKTIAFPSSITNARSIFFKDGKINILSYQDGANKLYTLN" FT misc_feature complement(22082..22105) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature complement(join(23276..23344,23180..23233,23108..23167, FT 22982..23050,22853..22921)) FT /note="5 probable transmembrane helices predicted for FT Cj0017c by TMHMM2.0 at aa 13-35, 50-67, 72-91, 111-133 and FT 154-176" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(22862..23365) FT /note="HMMPfam hit to PF02600, Disulfide bond formation FT protein DsbB, score 1.9e-17" FT /inference="protein motif:Pfam:PF02600" FT sig_peptide complement(23288..23380) FT /note="Signal peptide predicted for dsbI by SignalP 2.0 HMM FT (Signal peptide probability 0.820) with cleavage site FT probability 0.405 between residues 31 and 32" FT CDS complement(23392..23559) FT /transl_table=11 FT /gene="dba" FT /locus_tag="Cj0018c" FT /product="disulphide bond formation protein" FT /note="Original (2000) note: Cj0018c, small hydrophobic FT protein, len: 55 aa; similar to TR:E1314390 (EMBL:AL031184) FT small hydrophobic protein SC2A11.18 from Streptomyces FT coelicolor (55 aa), fasta scores; opt: 72 z-score: 141.4 FT E(): 1.3, 32.7% identity in 49 aa overlap. 49.1% identity FT to HP0594 hypothetical protein" FT /note="Updated (2006) note: Gram negative bacterial cells FT have disulfide bond formation occuring in the oxidative FT environment of the periplasm and are catalysed by Dsb FT (disulfide bond) proteins found in the periplasm and in the FT inner membrance. Supporting paper (PMID:15632440) FT speculates Dba has a supportive role as dba is FT co-transcribed with dsbI. This information has led to a new FT product function designation. Dba has 100% amino acid FT identity with Dba from 81-176 (CJJ81176_0045). FT Characterisation paper within Campylobacter jejuni has led FT to putative being removed from product function. Functional FT classification - Synthesis and modification of FT macromolecules - Protein translation and modification" FT /note="PMID:15632440" FT /db_xref="UniProtKB/TrEMBL:Q0PCA7" FT /protein_id="CAL34199.1" FT /translation="MEFLELLLVLIALILIIKKPEKENLAFGLVMVAWLLMVFFYVGHK FT TGALLTIMNL" FT misc_feature complement(23428..23487) FT /note="1 probable transmembrane helix predicted for Cj0018c FT by TMHMM2.0 at aa 25-44" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(23665..25443) FT /transl_table=11 FT /locus_tag="Cj0019c" FT /product="putative MCP-domain signal transduction protein" FT /note="Original (2000) note: Cj0019c, probable MCP-domain FT signal transduction protein, len: 592 aa; similar to other FT proteins containing the MCP domain e.g. HLYB_VIBCH FT hemolysin secretion protein precursor (548 aa), fasta FT scores; opt: 418 z-score: 492.5 E(): 3.5e-20, 22.7% FT identity in 565 aa overlap, and AER_ECOLI aerotaxis FT receptor (506 aa), fasta scores; opt: 299 z-score: 391.2 FT E(): 1.6e-14, 25.5% identity in 357 aa overlap. 27.5% FT identity to HP0103. Contains N-terminal signal sequence and FT transmembrane anchor around aa 250. Also contains Pfam FT match to entry PF00015 MCPsignal, Methyl-accepting FT chemotaxis protein (MCP) signaling domain, score FT 104.90,E-value 1.7e-28" FT /note="Updated (2006) note: Pfam domain PF00672 HAMP domain FT identified within CDS. Two probable transmembrace helices FT identified by TMHMM2.0. Further support given to product FT function. No specific characterisation with acceptable FT identity scores has yet been carried out. Thus,putative FT kept within product function. Functional classification - FT Signal transduction" FT /db_xref="GOA:Q0PCA6" FT /db_xref="InterPro:IPR003660" FT /db_xref="InterPro:IPR004089" FT /db_xref="InterPro:IPR004090" FT /db_xref="UniProtKB/TrEMBL:Q0PCA6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00672" FT /inference="protein motif:Pfam:PF00015" FT /protein_id="CAL34200.1" FT /translation="MTNKKSSFLIKFIILSTLVLAFILVLLGIIFNNYSSSKDNKELIN FT IVQQLEISDEKINSVFQNSFNFINYDPSVQAIKKMQENFTKLKTFGIDINKAEEIFNAK FT LIQLNYFKSANSIAVNSKLYLFELAKNYFEELEQNHETNKNNYKTMSSMLSVLSTENIL FT QKTTLNQLNNLMKEIKNDTKSENLQLFLKHYNMIVKQISIMQDNSSIYENNSLMKELKQ FT LNTFTQNTIEQSNLFKFYIALAVFGITLVLFVFFILLTLKKVIMPIHTLEKLSANLASK FT EANLHSRLNIDPKSELGQSAQYINSFISTVQNSIIEAIENAKSSHQNSQKLKNNSMMLE FT NSSNSQHEQIQGVKEITHVLDDHINLAGNLAQESIENMQDMHILMDKVELTLSELVNLI FT NENNEKEQNIVANMDNLTQSADNIIEITNSIKDIADQTNLLALNAAIEAARAGEHGRGF FT AVVADEVGQLADKTSKSLLNINATVNTIVQQINDNKALMDLIHDSMKETSSKTNDLQQE FT LVNSMHKLESSIESTQTMKDKSMEVKDKMLILGTNIDKVNELANSVKDLSCEINNISQN FT VLNGASKLSEKLSSFQ" FT misc_feature complement(23668..24375) FT /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis FT protein (MCP) s, score 5.5e-10" FT /inference="protein motif:Pfam:PF00015" FT misc_feature complement(24505..24720) FT /note="HMMPfam hit to PF00672, HAMP domain, score 1.8e-06" FT /inference="protein motif:Pfam:PF00672" FT misc_feature complement(join(25348..25416,24661..24729)) FT /note="2 probable transmembrane helices predicted for FT Cj0019c by TMHMM2.0 at aa 10-32 and 239-261" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(25333..25443) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000008_23665_25443 by SignalP 2.0 HMM FT (Signal peptide probability 1.000) with cleavage site FT probability 0.852 between residues 37 and 38" FT CDS complement(25433..26347) FT /transl_table=11 FT /locus_tag="Cj0020c" FT /product="cytochrome C551 peroxidase" FT /EC_number="1.11.1.5" FT /note="Original (2000) note: Cj0020c, probable cytochrome FT C551 peroxidase, len: 304 aa; similar to CCPR_PSEAE FT cytochrome C551 peroxidase precursor (EC 1.11.1.5) (346 FT aa), fasta scores; opt: 775 z-score: 1167.7 E(): 0, 42.3% FT identity in 298 aa overlap. No Hp ortholog. Contains 2x FT PS00190 Cytochrome c family heme-binding site signature and FT probable N-terminal signal sequence" FT /note="Updated (2006) note: Characterisation has been FT carried out within Pseudomonas aeruginosa with acceptable FT identity score. Appropriate motifs also identified. FT Putative not added to product function. Functional FT classification - Cell processes - Detoxification" FT /note="PMID:7781769, PMID:8591033, PMID:1657179" FT /db_xref="GOA:Q0PCA5" FT /db_xref="InterPro:IPR003088" FT /db_xref="InterPro:IPR004852" FT /db_xref="InterPro:IPR009056" FT /db_xref="UniProtKB/TrEMBL:Q0PCA5" FT /inference="protein motif:Prosite:PS00190" FT /protein_id="CAL34201.1" FT /translation="MKKIIMILCLSYANIVFAVDMITPIPNSISYDKEKAKLGKSLYMD FT KSLSKDGKVSCNTCHRLDQHGVDGLEFSIGVDNQLDKPFNTPTTFNSVFNFVQFWNGRA FT KDLAEQATVPFFNPKEMGLSPELLLQKVNSNENYVKTFKKLYGEVTVENIALAVAEFEK FT TLITPNSPFDRYLSGDQNAISTQAKKGYEDFKANGCISCHQGQNIGGNMFQKIGIFEEY FT PNQEDLGRYEITKREADKMVFKVPSLRNIAKTAPYFHDGSIPTLDACVQFMAYYQLGKF FT LDQETVDNIVAFLESLTGEYHDK" FT misc_feature complement(25454..25786) FT /note="HMMPfam hit to PF00034, Cytochrome c, score 0.0083" FT /inference="protein motif:Pfam:PF00034" FT misc_feature complement(25736..25753) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT misc_feature complement(25799..26311) FT /note="HMMPfam hit to PF03150, Di-haem cytochrome c FT peroxidase, score 3.8e-69" FT /inference="protein motif:Pfam:PF03150" FT misc_feature complement(26165..26182) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT sig_peptide complement(26294..26347) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000009_25433_26347 by SignalP 2.0 HMM FT (Signal peptide probability 0.836) with cleavage site FT probability 0.680 between residues 18 and 19" FT CDS complement(26411..27289) FT /transl_table=11 FT /locus_tag="Cj0021c" FT /product="putative fumarylacetoacetate (FAA) hydrolase FT family protein" FT /note="Original (2000) note: Cj0021c, unknown, len: 292 aa; FT similar to hypothetical proteins e.g. TR:O06724 FT (EMBL:Z99109) B. subtilis yisK (301 aa), fasta scores; opt: FT 665 z-score: 1018.0 E(): 0, 43.1% identity in 255 aa FT overlap, and to C-terminal half of HPCE_ECOLI FT 2-hydroxyhepta-2,4-diene-1,7-dioate FT isomeraase/5-carboxymethyl-2-oxo-hex-3-ene-1,7-dioate FT decarboxylase (405 aa), fasta scores; opt: 328 z-score: FT 381.2 E(): 5.6e-14, 31.2% identity in 199 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF01557 FT Fumarylacetoacetate (FAA) hydrolase family identified FT within CDS. Product modified to more specific family member FT due to motif match. No specific characterisation with FT acceptable identity score has been carried out yet. Thus, FT putative kept within product function. Functional FT classification - Misc" FT /db_xref="GOA:Q0PCA4" FT /db_xref="InterPro:IPR002529" FT /db_xref="InterPro:IPR011234" FT /db_xref="UniProtKB/TrEMBL:Q0PCA4" FT /inference="protein motif:Pfam:PF01557" FT /protein_id="CAL34202.1" FT /translation="MKFVNFIQGQKPNLGVLNSSGKIVSFDDLGIETNDMNEFIIHFDK FT FKHKLTDLDSKIAYEIPQENYLAPIIEPRQDIICLGINFLDHAKESAKFKGEKFEEREY FT PVYFGKRCNQATAPFGDIPLHADVTSQLDYECELAFILSKDAYKIKAKDAKDYIFGYTI FT INEISARELQKRHKQFYRAKSLEGSTIMGPYITSVDEISYPPKLQLQSYVNDELRQNSN FT TQLFIFDIAYVLEELSAGMLLKAGSIISMGTPSGVGMGLNPPTFLKSGDKVRCVIENLG FT ELCNKIKNINY" FT misc_feature complement(26504..27007) FT /note="HMMPfam hit to PF01557, Fumarylacetoacetate (FAA) FT hydrolase fam, score 1.4e-44" FT /inference="protein motif:Pfam:PF01557" FT CDS complement(27402..28304) FT /transl_table=11 FT /locus_tag="Cj0022c" FT /product="putative ribosomal pseudouridine synthase" FT /EC_number="4.2.1.70" FT /note="Original (2000) note: Cj0022c, possible ribosomal FT pseudouridine synthase, len: 300 aa; similar to e.g. FT RLUD_ECOLI ribosomal large subunit pseudouridine synthase D FT (EC 4.2.1.70) (326 aa), fasta scores; opt: 344 z-score: FT 412.1 E(): 1.2e-15, 29.6% identity in 243 aa overlap. 41.1% FT identity to HP0347. Contains PS01129 Hypothetical FT yabO/yceC/sfhB family signature and Pfam match to entry FT PF00849 YABO, Hypothetical yabO/yceC/sfhB family, score FT 182.90, E-value 5e-51. Also similar to Cj1280c (31.0% FT identity) and Cj0708 (28.0% identity)" FT /note="Updated (2006) note: Characterisation has been FT carried out within Escherichia coli, however, identity FT score was marginal. Pfam domain PF00849 RNA pseudouridylate FT synthase was identified within CDS. This Pfam motif has FT been updated from the previous designation. Further support FT given to product function. Putative kept within product FT function. Functional classification -Synthesis and FT modification of macromolecules - Ribosome maturation and FT modification" FT /note="PMID:11453071, PMID:11087118, FT PMID:9814761,PMID:14501142" FT /db_xref="GOA:Q0PCA3" FT /db_xref="InterPro:IPR002942" FT /db_xref="InterPro:IPR006145" FT /db_xref="InterPro:IPR006224" FT /db_xref="InterPro:IPR020103" FT /db_xref="UniProtKB/TrEMBL:Q0PCA3" FT /inference="protein motif:Pfam:PF00849" FT /inference="protein motif:Prosite:PS01129" FT /protein_id="CAL34203.1" FT /translation="MAYIKIKLSNNGKKAFQVLMENLKISINEAQKLIDKKRLFCDGIL FT VEEKNKILNGLVELIVYENNPKGVEIVFENEDFAILEKESGILSHPNGRHCKYSLSDEI FT WHLWGKEACVAHRLDKETSGLILIAKNKKAQIDLKSLFEKKLVQKEYLALAHGKIEENF FT IVDKAINLTKNYDDVKTRMQICKEGKQAITEFEILEYFPKINATLLLCKPLTGRQHQIR FT VHLHYKNHTILGDPLYGLSKQQIESILDEKLNPKERLKLTGALRLCLHSYRLKFQYKNQ FT NFDINSKINIKEIFNNSIK" FT misc_feature complement(27624..28076) FT /note="HMMPfam hit to PF00849, RNA pseudouridylate FT synthase, score 7.1e-43" FT /inference="protein motif:Pfam:PF00849" FT misc_feature complement(27918..27962) FT /note="PS01129 Rlu family of pseudouridine synthase FT signature" FT /inference="protein motif:Prosite:PS01129" FT CDS 28382..29710 FT /transl_table=11 FT /gene="purB" FT /locus_tag="Cj0023" FT /product="adenylosuccinate lyase" FT /EC_number="4.3.2.2" FT /note="Original (2000) note: Cj0023, purB, probable FT adenylosuccinate lyase, len: 442 aa; similar to e.g. FT PUR8_BACSU adenylosuccinate lyase (EC 4.3.2.2) (431 FT aa),fasta scores; opt: 1369 z-score: 2264.2 E(): 0, 49.9% FT identity in 439 aa overlap. 67.9% identity to HP1112. FT Contains PS00163 Fumarate lyases signature and Pfam match FT to entry PF00206 lyase_1, Lyases, score 199.60, E-value FT 4.7e-56" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity scores. Thus, putative FT not added to product function. Functional classification FT -Purine ribonucleotide biosynthesis" FT /note="PMID:1608947, PMID:10926519, PMID:3036807" FT /db_xref="GOA:Q0PCA2" FT /db_xref="InterPro:IPR000362" FT /db_xref="InterPro:IPR003031" FT /db_xref="InterPro:IPR004769" FT /db_xref="InterPro:IPR008948" FT /db_xref="InterPro:IPR019468" FT /db_xref="InterPro:IPR020557" FT /db_xref="InterPro:IPR022761" FT /db_xref="InterPro:IPR024083" FT /db_xref="UniProtKB/TrEMBL:Q0PCA2" FT /inference="protein motif:Pfam:PF00206" FT /inference="protein motif:Prosite:PS00163" FT /protein_id="CAL34204.1" FT /translation="MVERYSREIMAKKWDMQAKYDAWLKVELAAVKAWNKLGLIDDTDC FT EKILKNAKFDIARIDEIEKTTKHDVIAFLTSVSESLGEESRFVHYAMTSSDCIDTAVAL FT QIKESLELILEDVSLLLEAIKKRALEHKNTLMVGRSHGIHGEPITFGLVLAIWYDEISH FT AKELLEHAKEVISYGKISGAMGNFAHAPLEFEEEVCKNLGLKAAPVSNQVIQRDRYAQV FT ISAIAILASSCEQIAVAIRHFQRTEVYEAEEYFSVGQKGSSAMPHKRNPVLSENITGLC FT RVLRSFVTPALENVALWHERDISHSSVERFILPDAFITADFMLMRLTNLIDKLLVYPEN FT MMKNLNLTGGLVFSGRVLLELPFKGISREEAYKIVQRNAMKVWADLQNGKAAINEKNES FT LFLLALLSDEDLRKSLSEEDVRKCFDYNYYTKNVDAIFKRTFK" FT misc_feature 28388..29239 FT /note="HMMPfam hit to PF00206, Lyase, score 3.7e-45" FT /inference="protein motif:Pfam:PF00206" FT misc_feature 29048..29080 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 29162..29191 FT /note="PS00163 Fumarate lyases signature" FT /inference="protein motif:Prosite:PS00163" FT CDS 29726..32095 FT /transl_table=11 FT /gene="nrdA" FT /locus_tag="Cj0024" FT /product="ribonucleoside-diphosphate reductase alpha chain" FT /EC_number="1.17.4.1" FT /note="Original (2000) note: Cj0024, FT nrdA,ribonucleoside-diphosphate reductase alpha chain, len: FT 789 aa; similar to e.g. RIR3_YEAST FT ribonucleoside-diphosphate reductase large chain 2 (869 FT aa), fasta scores; opt: 909 z-score: 1663.2 E(): 0, 33.0% FT identity in 813 aa overlap,and RIR1_ECOLI FT ribonucleoside-diphosphate reductase 1 alpha chain (EC FT 1.17.4.1) (761 aa), fasta scores; opt: 795 z-score: 1160.2 FT E(): 0, 28.5% identity in 811 aa overlap. 68.9% identity to FT HP0680. Contains PS00089 Ribonucleotide reductase large FT subunit signature and 3x Pfam match to entry PF00317 FT ribonucleo_red, Ribonucleotide reductase,scores 371.50, FT E-value 5.1e-139, 133.70, E-value 4.5e-50 and 44.10, FT E-value 1.5e-16" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis and Escherichia coli. Identity scores were FT marginal. Appropriate motifs were identified. Putative not FT added to product function. Functional classification FT -2'-deoxyribonucleotide biosynthesis" FT /note="PMID:6087316, PMID:3098730" FT /db_xref="GOA:Q0PCA1" FT /db_xref="InterPro:IPR000788" FT /db_xref="InterPro:IPR005144" FT /db_xref="InterPro:IPR008926" FT /db_xref="InterPro:IPR013346" FT /db_xref="InterPro:IPR013509" FT /db_xref="UniProtKB/TrEMBL:Q0PCA1" FT /inference="protein motif:Pfam:PF00317" FT /inference="protein motif:Prosite:PS00089" FT /protein_id="CAL34205.1" FT /translation="MKVIKRNGRTEELDVSKIKKCTSDAVKDLEGVNLSELELDAKIQF FT RDGISTEEIQKTLIKTAVDKIDIDCPNWTFVAARLFLFDLYKKVNGMNRYNHLREYFQK FT GEKEGRILLGLKEKYDLDDLNAYIKPERDMQFTYLGIKTLYDRYLIKDSKGMPIELPQQ FT MFMAIAMFLAQNEFNPQEWAKKFYDLISKFELMLATPTLSNARTTRHQLSSCYIGSTPD FT NIEGIFDSYQEMALLSKFGGGIGWDWSKVRAMGGSIDGHKNAAGGIIPFLKITNDIAVA FT VDQLGTRKGAIAVYIEPWHMDISDFIDLRKNSGEERRRAHELFPALWINDLFMKRVRAN FT DKWTLFDPADTADLCDLYGEAFEKRYEEYEKDESITKEIVEAKELWKKILLNYFETGLP FT FLCFKDSANRANPNAHVGIIRSSNLCTEIFQNTEPNYYQIKVVFENGDELHFDEEQKVV FT IDGGYEKPAKKISTLDSIEGNKVYIVEKYKNDGKTAVCNLASINLSKVYTKEDIERVVP FT TAIRMLDNVIDLNFYPHRKVKDTNLKSRAIGLGVMGEAQMLAEAKIHWGSDEHLNKIDE FT IMEQISFEAINASSNLALEKGSYEDFEGSNWSKGIFPIDVASPKAKALTLREGLFDQSE FT CDWVKLREKVKKDGMRNGYLMAIAPTSSISILVGTTQTIEPVYKRKWFEQNLSGMIPVV FT VPNLSLDTWQYYTPAYELDQKILVKAAAVRGKWIDQGQSLNIFLSLDKASGGYLNEIYQ FT LAWELGVKSTYYLRSESPDSEKVNVADRSIECEGCQ" FT misc_feature 29726..29995 FT /note="HMMPfam hit to PF03477, ATP cone domain, score FT 6.2e-18" FT /inference="protein motif:Pfam:PF03477" FT misc_feature 30125..30355 FT /note="HMMPfam hit to PF00317, Ribonucleotide FT reductase,all-alpha d, score 3.2e-35" FT /inference="protein motif:Pfam:PF00317" FT misc_feature 30359..32035 FT /note="HMMPfam hit to PF02867, Ribonucleotide FT reductase,barrel doma, score 7.5e-129" FT /inference="protein motif:Pfam:PF02867" FT misc_feature 31637..31705 FT /note="PS00089 Ribonucleotide reductase large subunit FT signature" FT /inference="protein motif:Prosite:PS00089" FT CDS complement(32134..33519) FT /transl_table=11 FT /locus_tag="Cj0025c" FT /product="putative sodium:dicarboxylate family FT transmembrane symporter" FT /note="Original (2000) note: Cj0025c, probable FT transmembrane symporter (possibly glutamate), len: 461 aa; FT similar to many e.g. YB54_HAEIN hypothetical symporter FT HI1154 (440 aa), fasta scores; opt: 650 z-score: 890.6 E(): FT 0, 33.7% identity in 454 aa overlap, and TR:Q46202 FT (EMBL:X86516) Clostridium perfringens gluT-R gene FT (fragment) (132 aa), fasta scores; opt: 406 z-score: 569.0 FT E(): 1.9e-24, 49.6% identity in 119 aa overlap. No Hp FT match. Contains Pfam match to entry PF00375 FT SDF,Sodium:dicarboxylate symporter family, score FT 142.20,E-value 9.4e-39" FT /note="Updated (2006) note: Pfam domain PF00375 FT Sodium:dicarboxylate symporter family identified within FT CDS. Eleven probable transmembrane helices predicted by FT TMHMM2.0. Product modified to more specific family member FT due to motif match. No specific characterisation with FT acceptable identity score has been carried out yet. FT Thus,putative kept within product function. Functional FT classification - Transport/binding proteins - Other" FT /db_xref="GOA:Q0PCA0" FT /db_xref="InterPro:IPR001991" FT /db_xref="UniProtKB/TrEMBL:Q0PCA0" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00375" FT /protein_id="CAL34206.1" FT /translation="MDKQFFQDFLMLSQAHTIATLAILCVVFYALKKMRDIKINFSLRM FT LFALLMGLGFGFALQYLANFPDAEEASNILWYSETKHWFAFVSSVFVAFIKMLVVPLVS FT ICIIKVIIEIDKNIKISSLLGISLFWILFSTAIAATLGIFLGYSFDLGSNFAIYEGDKQ FT IREIQTFSNIILGLIPSNIITAINKENIIAIVIFSFFIGISAKKISKKEEYEQAFKSFH FT NFILTFYNIMMNMTATVIRFMPYAVVCMMANVLLSNGFEAIKTAGLFIMLIYIAMFIMF FT GVHFLLLASQGLNPIKYAKKAFPVWLFAFSSRSSLGTLPMTTSTLQNKFGVNSAIANFV FT ASIGTTTGLNGCAGYFPALAAVFVAFATHTHIDFTFALMIVLVAVIGSLGIAGVPGSAT FT MAASIMLAGIGFGNNFVMLSLILAIDPIIDMARTASNVSGAMTSALCTAKNLKALDKEI FT YNS" FT misc_feature complement(32170..33399) FT /note="HMMPfam hit to PF00375, Sodium:dicarboxylate FT symporter family, score 2.4e-40" FT /inference="protein motif:Pfam:PF00375" FT misc_feature complement(join(33433..33492,33331..33399,33205..33273, FT 33076..33144,32908..32976,32779..32847,32653..32721, FT 32548..32616,32437..32505,32332..32400,32251..32319)) FT /note="11 probable transmembrane helices predicted for FT Cj0025c by TMHMM2.0 at aa 10-29, 41-63, 83-105, FT 126-148,182-204, 225-247, 267-289, 302-324, 339-361, FT 374-396 and 401-423" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(33639..34262) FT /transl_table=11 FT /gene="thyX" FT /locus_tag="Cj0026c" FT /product="thymidylate synthase" FT /EC_number="2.1.1.148" FT /note="Original (2000) note: Cj0026c, unknown, len: 207 aa; FT similar to hypothetical proteins e.g. YDAP_BRELA FT hypothetical 28.0 kd protein (250 aa), fasta scores; opt: FT 221 z-score: 388.7 E(): 2.1e-14, 27.4% identity in 190 aa FT overlap. 56.3% identity to HP1533" FT /note="Updated (2006) note: Pfam domain PF02511 Thymidylate FT synthase complementing protein identified within CDS. FT Characterisation work has been carried out within FT Campylobacter jejuni and Helicobacter pylori. Two forms of FT microbial thymidylate synthase are known: ThyA and ThyX . FT This family describes ThyX, a homotetrameric flavoprotein. FT Both enzymes convert dUMP to dTMP. Under oxygen-limiting FT conditions, ThyX can complement a thyA mutation FT (PMID:9665876, PMID:15046578). Functional classification - FT Misc" FT /note="PMID:12423760, PMID:9665876, FT PMID:15046578,PMID:12029065" FT /db_xref="GOA:Q9PJ85" FT /db_xref="InterPro:IPR003669" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ85" FT /inference="protein motif:Pfam:PF02511" FT /protein_id="CAL34207.1" FT /translation="MQITLLFHTPLSVCSHATRTCWQSFEKGDCGGEKDKELIDRVGNK FT FKHASTLEHLNYTFYIQGISRACLQEVARHRHTSPSVKSTRYTLKELRNEAEFKIGDFE FT NASRYLVLCGNEEVDNASIKALENLRTILQKSISLDIAKYCLPESYKTELTLTINARSL FT QNFISLRSSKSALWEIRNLANALFEALPQEHKFIFEHCLHKDIE" FT misc_feature complement(33663..34262) FT /note="HMMPfam hit to PF02511, Thymidylate synthase FT complementing protein, score 6.3e-43" FT /inference="protein motif:Pfam:PF02511" FT CDS 34382..36013 FT /transl_table=11 FT /gene="pyrG" FT /locus_tag="Cj0027" FT /product="CTP synthase" FT /EC_number="6.3.4.2" FT /note="Original (2000) note: Cj0027, pyrG, CTP FT synthase,len: 543 aa; highly similar to many e.g. FT PYRG_ECOLI CTP synthase (EC 6.3.4.2) (544 aa), fasta FT scores; opt: 1892 z-score: 2236.1 E(): 0, 52.6% identity in FT 540 aa overlap. 62.6% identity to HP0349. Contains PS00442 FT Glutamine amidotransferases class-I active site" FT /note="Updated (2006) note: Pfam domain PF06418 CTP FT synthase N-terminus and PF00117 Glutamine amidotransferase FT class-I were identified within CDS. Further support given FT to product function. Characterised within Escherichia coli FT with acceptable identity score. Thus, putative not added to FT product function. Functional classification -Pyrimidine FT ribonucleotide biosynthesis" FT /note="PMID:3298209, PMID:8385490, PMID:11336655" FT /db_xref="GOA:Q9PJ84" FT /db_xref="InterPro:IPR004468" FT /db_xref="InterPro:IPR017456" FT /db_xref="InterPro:IPR017926" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ84" FT /inference="protein motif:Pfam:PF00117" FT /inference="protein motif:Pfam:PF06418" FT /inference="protein motif:Prosite:PS00442" FT /protein_id="CAL34208.1" FT /translation="MKQTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPY FT INVDPGTMSPFEHGEVFVTDDGAETDLDLGHYERFLDESLSQDNNFTTGRVYQSVIEKE FT RRGEYLGKTIQVIPHIVGEIKDRIKKAGEGKDILIVEIGGTVGDIEGLPFLEAIRALRL FT EVGKNNAMNIHLTLVPFIKAAGELKTKPTQHSVGELRRIGISPDMIICRSEKALDRDLK FT DKIAISCGVEKNCVIESVDAASIYQIPLNFLKQDILSPIAEILDLKNLKPNMENWDSLV FT KRVIAPSNEVKIAFVGKYVDLKESYKSLTEAIIHAGAALDTKVELKWVDSEKLENMESS FT EVFKDVSGILVAGGFGYRGVEGKIKAIQYARENKIPFLGICLGMQLALVEFARNVLKLK FT DVNSSEFNEKCQNPVVYLIDEFMDTNGEKQIRTAKTPLGGTMRLGAYKCDIKEKSLLAK FT VYNEVKSVKERHRHRYEANPKYRADFEKYGLIVSGESKGLIEAVELNCHPFFLAVQFHP FT EFTSRLEHVNPVICSFIKAAINYEDN" FT sig_peptide 34382..34453 FT /note="Signal peptide predicted for pyrG by SignalP 2.0 HMM FT (Signal peptide probability 0.989) with cleavage site FT probability 0.881 between residues 24 and 25" FT misc_feature 34391..35218 FT /note="HMMPfam hit to PF06418, CTP synthase FT N-terminus,score 4.3e-204" FT /inference="protein motif:Pfam:PF06418" FT misc_feature 34400..34468 FT /note="1 probable transmembrane helix predicted for Cj0027 FT by TMHMM2.0 at aa 7-29" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 35282..35989 FT /note="HMMPfam hit to PF00117, Glutamine amidotransferase FT class-I, score 3.5e-57" FT /inference="protein motif:Pfam:PF00117" FT misc_feature 35507..35542 FT /note="PS00442 Glutamine amidotransferases class-I active FT site" FT /inference="protein motif:Prosite:PS00442" FT CDS 36000..37571 FT /transl_table=11 FT /gene="recJ" FT /locus_tag="Cj0028" FT /product="putative single-stranded-DNA-specific FT exonuclease" FT /EC_number="3.1.-.-" FT /note="Original (2000) note: Cj0028, recJ, probable FT single-stranded-DNA-specific exonuclease, len: 523 aa; FT similar to e.g. RECJ_ECOLI single-stranded-DNA-specific FT exonuclease (EC 3.1.-.-) (577 aa), fasta scores; opt: 385 FT z-score: 861.6 E(): 0, 29.8% identity in 526 aa overlap. FT 39.0% identity to HP0348" FT /note="Updated (2006) note: Pfam domain HMMPfam PF01368 DHH FT family and HMMPfam PF02272 DHHA1 domain were identified FT within CDS. Further support given to product function. FT Characterised within Escherichia coli, however,marginal FT identity score was obtained. Putative kept within product FT function. Functional classification - Synthesis and FT modification of macromolecules - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:2649886" FT /db_xref="GOA:Q0PC97" FT /db_xref="InterPro:IPR001667" FT /db_xref="InterPro:IPR003156" FT /db_xref="InterPro:IPR004610" FT /db_xref="UniProtKB/TrEMBL:Q0PC97" FT /inference="protein motif:Pfam:PF02272" FT /inference="protein motif:Pfam:PF01368" FT /protein_id="CAL34209.1" FT /translation="MKIINKNEIKKILASRFEKDLHTKLCDLPLPCCLKDAYKAANRIK FT EAVEKNEKVAIVGDYDVDGIISCVIMAEFFDDIGFDYIIRIPNRFKDGYGLNAEIINEL FT DVNLIITVDNGIAALEAAKLCKEKNIDLIITDHHMPQDILPDAFAIINPKQKDCDFPEI FT EICGAQVAWYLIAALKEVCKLKYDMCKFLELLAIAIVADMMELRDLNRALVRRGIDHIN FT KSKRAAFRAIKHYYQKDKFALDNIGFLIAPLINSAGRMDDASISYEFLHTKDFNKALEY FT LEQIVSFNESRKDEEKQLFEDSLNQIDENDSCIVVSGLNWHEGVLGIVASRLAKHFNKP FT AFVFSQNEEHLKGSARSVGKIDILALISKTNSILSNYGGHKGAAGISLNSENFEQFKNK FT IKKECSQISESEFLDTDEILGILEPSEIDFEMLEILESFEPFGHKNPRPFFVLENLCVK FT NKKLLGKDEKHLKLVLTKENKTIEALFFNFDKEPELNQNISLLGSISKNEFRGMVTPQF FT VVKEIL" FT misc_feature 36138..36599 FT /note="HMMPfam hit to PF01368, DHH family, score 1e-48" FT /inference="protein motif:Pfam:PF01368" FT misc_feature 37011..37205 FT /note="HMMPfam hit to PF02272, DHHA1 domain, score 1.5e-16" FT /inference="protein motif:Pfam:PF02272" FT CDS 37667..38662 FT /transl_table=11 FT /gene="ansA" FT /locus_tag="Cj0029" FT /product="cytoplasmic L-asparaginase" FT /EC_number="3.5.1.1" FT /note="Original (2000) note: Cj0029, ansA, probable FT cytoplasmic L-asparaginase, len: 331 aa; similar to many FT e.g. ASG2_ECOLI L-asparaginase II precursor (EC 3.5.1.1) FT (348 aa), fasta scores; opt: 1044 z-score: 1510.6 E(): FT 0,52.0% identity in 327 aa overlap, but with no signal FT sequence. 45.8% identity to HP0723. Contains PS00144 and FT PS00917 Asparaginase/glutaminase active site signatures 1 FT and 2 and Pfam match to entry PF00710 FT Asparaginase,Asparaginase, score 449.90, E-value 2.2e-131" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Degradation - Amino acids" FT /note="PMID:2407723, PMID:1287659, PMID:8706862" FT /db_xref="GOA:Q0PC96" FT /db_xref="InterPro:IPR004550" FT /db_xref="InterPro:IPR006034" FT /db_xref="InterPro:IPR020827" FT /db_xref="PDB:3NXK" FT /db_xref="UniProtKB/TrEMBL:Q0PC96" FT /inference="protein motif:Pfam:PF00710" FT /inference="protein motif:Prosite:PS00917" FT /inference="protein motif:Prosite:PS00144" FT /protein_id="CAL34210.1" FT /translation="MKKAKSRIAILGTGGTIAGFIDSTIATTGYAAGAIDIDVLIKAVP FT QIRDLADISWEQIANIDSSNMCDEIWLRLAKKIAKLFAEGIDGVVITHGTDTMEETAYF FT LNLTIKSDKPVVLVGAMRPSTAISADGPKNLYNAVALVVNKEAKNKGVMVAINDKILSA FT RGVVKTHSLNVDAFSSPDFGDLGYIVDGKVFFYNNVIKAHTKNAPFDVSKLTSLPKVDI FT LYSYSNDGSGVAAKALFEHGTKGIVVAGSGAGSIHKNQKDVLKELLKKGLKVVVSSRVV FT AGCVAVSDSDEKLGFISAEDLNPQKARVLLMLALTKTSDPKKIQEYFLKY" FT sig_peptide 37667..37759 FT /note="Signal peptide predicted for ansA by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.939 between residues 31 and 32" FT misc_feature 37694..37720 FT /note="PS00144 Asparaginase / glutaminase active site FT signature 1" FT /inference="protein motif:Prosite:PS00144" FT misc_feature 37712..38644 FT /note="HMMPfam hit to PF00710, Asparaginase, score FT 1.5e-132" FT /inference="protein motif:Pfam:PF00710" FT misc_feature 37928..37960 FT /note="PS00917 Asparaginase / glutaminase active site FT signature 2" FT /inference="protein motif:Prosite:PS00917" FT rRNA 39249..40761 FT /note="16S rRNA" FT tRNA 40866..40941 FT /gene="tRNA-Ala" FT /note="tRNA Ala anticodon TGC, Cove score 92.14" FT tRNA 40950..41026 FT /gene="tRNA-Ile" FT /note="tRNA Ile anticodon GAT, Cove score 93.24" FT rRNA 41568..44457 FT /note="23S rRNA" FT rRNA 44741..44860 FT /note="5S rRNA" FT CDS 44966..46363 FT /transl_table=11 FT /locus_tag="Cj0030" FT /product="hypothetical protein Cj0030" FT /note="Original (2000) note: Cj0030, unknown, len: 465 aa. FT No Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PC95" FT /protein_id="CAL34211.1" FT /translation="MEKFIERLLEEDIKFEKDVNNGLSDINIFDALNIETKENYHSKFI FT AYLIDINKDHYQKNFAKVFLEKLGKSLVNTKFENLNIEDIKSVETEACIKDNRRIDILI FT TLSDKRYIIIENKIYAKDQKNQLKDYINFVRKNIKNIKDCYKNILTIYLHQDECASPSD FT YSLGNFTIKTNLIKDKNENNVSYYLKMDYMWIKEWIDECIKIYEEKSTKDQKFILDIQN FT IIFTLNQYKSILQWYIADEYTQRDDVLEFIFQDIIKMQNLKNAMILYRYNKNKSELKNL FT NEEKYKKAKDIIQHKWSNICEYIIEEFFDSFEHKEIKIGDITFIGNKIEENRVNHGVFI FT FYPVDYKNESIYPCIYIYFKKKYYDIIGLTFEISNDDEEDIENEKYKECLKLFKDVKEE FT NVRKYQNHYYCDKLINNEKLEGEYAFIYWLIENQNSKKDFIQILNDFFIKKPIQEAYKG FT INDILNS" FT CDS join(46424..49000,49002..50156) FT /transl_table=11 FT /locus_tag="Cj0031" FT /product="putative type IIS restriction/modification FT enzyme" FT /note="Original (2000) note: Cj0031, probable DNA FT restriction/modification enzyme, N-terminal half, len: 867 FT aa; similar to N-terminus of T257_ECOLI type IIS FT restriction enzyme Eco57I (which contains an FT adenine-specific methyltransferase activity) (997 aa),fasta FT scores; opt: 126 z-score: 218.0 E(): 6.9e-05, 24.0% FT identity in 516 aa overlap. 40.9% identity to N-terminus of FT HP1517. Some similarity to N-terminus of Cj0690c (24.8% FT identity in 858 aa overlap). Contains PS00092 N-6 FT Adenine-specific DNA methylases signature. Note that there FT is a polymorphic poly-G tract at the C-terminus of this ORF FT with 8, 9, or 10 bases. G10 (the most common in our FT shotgun) causes a termination here, G9 causes a termination FT 6 aa earlier. G8 allows translation to continue into FT Cj0032" FT /note="Original (2000) note: Cj0032, probable DNA FT restriction/modification enzyme, C-terminal half, len: 867 FT aa; similar to C-terminus of MTB3_BACAR modification FT methylase BanIII (580 aa), fasta scores; opt: 132 z-score: FT 220.8 E(): 4.9e-05, 24.6% identity in 402 aa overlap. 47.4% FT identity to C-terminus of HP1517. Note that there is a FT polymorphic poly-G tract at the N-terminus of this ORF with FT 8, 9, or 10 bases. G10 (the most common in our shotgun) or FT G9 will not allow translation into this ORF,G8 allows FT translation to continue from Cj0031. Alternative downstram FT start at 49059" FT /note="Updated (2006) note: Coding sequences have been FT merged to reflect the complete amino acid sequence for this FT gene regardless of phase. Previous annotation gave FT N-terminal and C-terminal portions as seperate CDS. Merging FT of these CDSs has lead to loss of the downstream CDS. FT Functional classification - Synthesis and modification of FT macromolecules - DNA replication,restriction/modification, FT recombination and repair" FT /db_xref="GOA:Q0PC94" FT /db_xref="InterPro:IPR002052" FT /db_xref="InterPro:IPR002296" FT /db_xref="InterPro:IPR011639" FT /db_xref="UniProtKB/TrEMBL:Q0PC94" FT /inference="protein motif:Prosite:PS00092" FT /protein_id="CAL34212.1" FT /translation="MHFTLLNEKDFFNPYYRKKQIMQNEFDIFSKALMQYLERLESSQS FT ENEDYLVANALSPFLTMLNFKTHIKTKQKGKSEIDLSISKDEFSKDLEVLIEAKKPNSK FT EFITHTKVNSKALHETILYYFRNREYSFSLKFIIITDFYKFYIFKISEFEELFYKNPSF FT KKLFEEFCNPNSLFKGNTEEFYKEVAKLIENSKENLKGFLIDLTFLKDKQKSNFKNLAS FT IYKTFHRDFLLSEFNPNDANSLNNAFYKELLYILGLYESKQNSKLIIAKSEESKEEQGT FT FYTAINSKLKEENFETILKLLILWLNRILFLKLIESNLVRFNDDKNLKFLNFKKIPDFD FT KLSELFFEVLAKEKSTRKKSEFTYLPYLNSSLFEKQSIENTLEISSLSNDLKLFYYKNT FT VLKDDKCKAKKGQVGLLEYLFEFLDSFDFGSDDEQSEILSQKELISSSVLGNVFEKLNG FT YKEGSFYTPSFITSYMCKESITKVVLDKFNAQFDLDAKDISELRKSLRKEDKKAQKELL FT NSIKICDPAVGSGHFLVSALNVMLSIYDELNLFDEEFYLEVQNDEILITGRKGEFIEYK FT RPSTPKDKTHLIQQELFHTKKDIIENNLFGVDINPNSCEITKLRLWIELLKHSFYQSFD FT DGNYHDLKTLPNIDINIKCGNSLVSYFETGKSLNHYPNIKERMGKYKRIVKDYKEGFYT FT DKSHINQEIKNLKISFKNFCFADKFKKEMKSFNDKCEKYSKKYGNFLAVDDENLKFFVS FT ANLTLFDFDEKEAIKEFANLKKEYDNIFNLESNHPFEWRFEFPEILDDDGNFKGFDLII FT GNPPYIRQEELKELKPHLAKNYKVYKGTSDIYTYFYELGFNVLKDRGGVLSYITSNKYT FT RAGYGEALREFLLKNVKFLEYTDLNGIKVFDSATVDTSILCFEKSKSKDNKFKYLALSN FT EILKTCAYDIGLYKDFAEFSQNSLSKESFTFSDENTSALKAKIERIGTPLKEWYGLNIN FT YGIKTGLNEAFIITTEKRNEILANCKDEAEKERTAKLIRKMLRGRDIKRYSYEWAGLWV FT IGTFPSLKIDIEQYPALKQYLSQFLPHIEQSGEKGCRKKTSNKWFETQDNIAYYEEFEK FT EKIVWAEMTKEACFVYDNSNFFTNQTCYFFTHCDYKYLLAILNSRLIVYYMQYISSHLG FT QGAFRWIRQYIEKLPIPKINSKNEKLADELINLVDEILKAKEQDKNANTQELENKINSL FT VYKLYNLTEEEIKIIEGK" FT CDS 50156..51937 FT /transl_table=11 FT /locus_tag="Cj0033" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0033, probable integral FT membrane protein, len: 593 aa; contains 6 possible FT transmembrane domains in C-terminal half. No Hp match. FT Functional classification - Membranes, lipoproteins and FT porins" FT /db_xref="UniProtKB/TrEMBL:Q0PC93" FT /protein_id="CAL34213.1" FT /translation="MEELTKEQRQIIEEEIKKEIKKANTFLKPELINKIIQDIIGDIKG FT KINNKFKCPKNLEEILSSIPQKVYVSLGKEEIKQILKLDFCCFVDNVFYIDSAPKIEPY FT EHNQNKTAIEEQRIIQCSYDDLLYLFKTYPLIFNHCIFDYKIDKKTPIEQIKKLSFLNC FT NFKKEVYLNFQECLDSFQMDNCVFEDRVTIKGKFNDNVYFNNSIFKNYADFHECEFEKT FT ANFYGVRFNKTPNFSQAIFRGNLNAVNANLNFTFDDLQERIKQEYEDFNKNIENKKSLD FT KFANDFRDSFRTFKNALIKDNNLLDASNFHKYELYCKEIELKQNWDKRGENVKNTTDLE FT KNVSRIRDFMDFLLLGFYRKLCDHHTDFLKVFNNLILLIALYALFVFGFTWLHDDKLED FT TRAILTLFGFFDKFRLYFDIISTIFVVFGCGFFVCKLDSYEKKNNVSKKQNINFIYIIG FT DFLNLIKSLLFASFIPCVFYVLFSLFGFFLNLGKDFGYSLLINTLFVSLYICLVYTKSL FT FFGRYVVLIFSYIVFIIMLIKQPNVIHPLIGKIANESDKFFNYPSLIVLNILYTILLAL FT VLFSLQKTARKNSIVPS" FT misc_feature order(51266..51334,51398..51457,51554..51622,51635..51694, FT 51707..51766,51824..51892) FT /note="6 probable transmembrane helices predicted for FT Cj0033 by TMHMM2.0 at aa 371-393, 415-434, 467-489,494-513, FT 518-537 and 557-579" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 51410..51442 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(51967..52668) FT /transl_table=11 FT /locus_tag="Cj0034c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0034c, probable periplasmic FT protein, len: 233 aa; similar to e.g. TR:O50817 FT (EMBL:AE000788) Borrelia burgdorferi conserved hypothetical FT protein BBK13 (238 aa), fasta scores; opt: 306 z-score: FT 257.5 E(): 4.4e-07, 28.1% identity in 231 aa overlap. No Hp FT match. Contains possible N-terminal signal sequence. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /db_xref="InterPro:IPR007497" FT /db_xref="InterPro:IPR016907" FT /db_xref="UniProtKB/TrEMBL:Q0PC92" FT /protein_id="CAL34214.1" FT /translation="MKTNNIFMALAIVLASLILAFGFNKALSDFKTLERSVSVKGLSQK FT EVEADTLILPIKFTRSNNNLTNLYEELEQDKENIIKFLEKQGIKEDEISYNSPNIIDRL FT SDPYSNDTQAAYRYIGTANLLIYTQNVKLGKSILENISSLAKFGIVTKIDDYDIEYLYT FT KLNDIKPQMIEEATLNARNAAIKFAQDSNSHLGKIKKASQGQFSISNRDKNTPYIKTIR FT VVSTIEYYLKD" FT misc_feature complement(51973..52572) FT /note="HMMPfam hit to PF04402, Protein of unknown function FT (DUF541), score 2.4e-60" FT /inference="protein motif:Pfam:PF04402" FT misc_feature complement(52600..52656) FT /note="1 probable transmembrane helix predicted for Cj0034c FT by TMHMM2.0 at aa 5-23" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(52603..52668) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000015_51967_52668 by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.425 between residues 22 and 23" FT CDS complement(52665..53867) FT /transl_table=11 FT /locus_tag="Cj0035c" FT /product="putative efflux protein" FT /note="Original (2000) note: Cj0035c, possible efflux FT protein, len: 400 aa; similar to many members of the FT bcr/cmlA subfamily of the major facilitator family e.g. FT BCR_ECOLI bicyclomycin resistance protein (396 aa), fasta FT scores; opt: 717 z-score: 1046.3 E(): 0, 28.1% identity in FT 398 aa overlap. No Hp ortholog. Contains 12 possible FT transmembrane domains. Also similar to Cj1375 (25.5% FT identity in 373 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF07690 Major FT Facilitator Superfamily was identified within CDS. Further FT support given to product function. Some characterisation FT work within different bacteria, however, identity scores FT were marginal. Thus, putative kept within product function. FT Functional classification - Antibiotic resistance" FT /note="PMID:2694948, PMID:8486276" FT /db_xref="GOA:Q0PC91" FT /db_xref="InterPro:IPR004812" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR016196" FT /db_xref="InterPro:IPR020846" FT /db_xref="UniProtKB/TrEMBL:Q0PC91" FT /inference="protein motif:Pfam:PF07690" FT /protein_id="CAL34215.1" FT /translation="MQKHTKIHGFAKFKLIVILALMSSIAPLSTDMYLPALSHVEQSFQ FT TNSFLTQLSIASFFIAFALGQLIYGPLSDIFGRKIPALVGIFFFIVSSLFCVIIDDIYA FT FIALRFFEALGGCAGVVIARAIVNDLFEIKEAAGIFALMMVFSSLAPMLSPTFGGILLE FT YFSWHSIFATLFALGILLFLMILFGLKESAPHLKNKKFSHHEAMKSYKFVLSDKRFLVY FT ILCASFALAAMFAYITGSSFVFTQFFSLSEQKFALLFGANALGFVICANINARLVLKYE FT SEKILAKALMIMFISTVILLVNAFFHPNFLLFELSIFTSIAMLGFIAPNTTTLAMARFK FT EHSGTASAVLGTVQFGFAGLISFVVGAINANTPIILAFVMCACVLVANMIYFLIKIKEK FT K" FT misc_feature complement(join(53763..53831,53652..53720,53550..53618, FT 53487..53540,53382..53450,53301..53369,53145..53213, FT 53034..53102,52947..53015,52851..52919,52764..52832, FT 52686..52754)) FT /note="12 probable transmembrane helices predicted for FT Cj0035c by TMHMM2.0 at aa 13-35, 50-72, 84-106, FT 110-127,140-162, 167-189, 219-241, 256-278, 285-307, FT 317-339,346-368 and 372-394" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(52719..52751) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature complement(52758..53813) FT /note="HMMPfam hit to PF07690, Major Facilitator FT Superfamily, score 4.8e-52" FT /inference="protein motif:Pfam:PF07690" FT sig_peptide complement(53748..53867) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000016_52665_53867 by SignalP 2.0 HMM FT (Signal peptide probability 0.901) with cleavage site FT probability 0.388 between residues 40 and 41" FT CDS 53970..55319 FT /transl_table=11 FT /locus_tag="Cj0036" FT /product="hypothetical protein Cj0036" FT /note="Original (2000) note: Cj0036, unknown, len: 449 aa; FT 37.8% identity to HP1143 hypothetical protein. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="InterPro:IPR019219" FT /db_xref="UniProtKB/TrEMBL:Q0PC90" FT /protein_id="CAL34216.1" FT /translation="MQNLNQNEQIKCPSCGSFIDISTALYAQILDKAKQEMLKQKKEFD FT DEVNAKRAEYTKALNDLKTQKIEQEKLINEQVSQKLLLEKQKFEQELLIQKQNFQKEFS FT EKFNKEHENEMKIMQEELEKKSKELSEFLSIKAENERLKREQKENEERLKFQAKEEAFK FT EFKEQESKNLEFEREKMRLEFQKSTQEQDLKYKELETNFKSVAQKLEDAQRRIEQGSQQ FT LQGEAAELLIEEYIQSEYLSDEVKEVPKGVNGADCLHIVKDNFGNICGSILYESKRTKE FT FNKEWLDKLKLDSIAAKSDIAVLITKTMPKDKEKTHFKEGILICTFNEFKGVLAVLRES FT IINAYKLKNALQNKDEKNHILYEYLNSKEFNTQITFILKTYQNMKEELEVEKRALQNIW FT KKRERAIENLSFNSTAIVSSLNAIFSDLQGGNLIGEEGIKSLENLAKDED" FT CDS complement(55343..56386) FT /transl_table=11 FT /locus_tag="Cj0037c" FT /product="putative cytochrome C" FT /note="Original (2000) note: Cj0037c, possible cytochrome FT C, len: 347 aa; weak simlarity to e.g. TR:O69780 FT (EMBL:U76906) di-heme cytochrome c (fixP) from Rhizobium FT etli (287 aa), fasta scores; opt: 97 z-score: 205.7 E(): FT 0.00034, 27.2% identity in 151 aa overlap. No Hp match. FT Contains 2x PS00190 Cytochrome c family heme-binding site FT signature and Pfam match to entry PF00034 FT cytochrome_c,Cytochrome c, score 5.90, E-value 0.11" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores has been carried out yet. FT Thus, putative kept within product function. Functional FT classification - Energy metabolism - Respiration -Electron FT transport" FT /db_xref="GOA:Q0PC89" FT /db_xref="InterPro:IPR003088" FT /db_xref="InterPro:IPR009056" FT /db_xref="InterPro:IPR011031" FT /db_xref="UniProtKB/TrEMBL:Q0PC89" FT /inference="protein motif:Pfam:PF00034" FT /inference="protein motif:Prosite:PS00190" FT /protein_id="CAL34217.1" FT /translation="MKKHILLLGLCLSLSLSAKSVSDYKVGEELSDKEGVEYFKELSKR FT PVQEWPNKNLSINDVPKGKQGDLIRYGIELLSKTESTLGPYSKLKKTSNEVNCISCHMD FT NDGNGLPGTKKYVIPFLNILNNYPRLDIETMKIISVEDRIRGMGGTDSHRFPNDSKEMK FT AILAYFKWLKEAYGIKDGVKLEGDFFAKMNFPNRPADPVRGKKLFEENCVACHGERGLG FT VKNDNYEQGSGHLYPSLLIYPDGGHMAMIPFLARFLKSAMPFGASADNPILSDEDALDI FT AAYVNTGFVRMPITTTENRAGLDTAYSKSPSLKPEYFASPQQNLDPKEYIKVKYGPWKN FT PNHFPGE" FT misc_feature complement(55520..55783) FT /note="HMMPfam hit to PF00034, Cytochrome c, score 0.0012" FT /inference="protein motif:Pfam:PF00034" FT misc_feature complement(55736..55753) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT misc_feature complement(56078..56095) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT sig_peptide complement(56327..56386) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000018_55343_56386 by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.378 between residues 20 and 21" FT CDS complement(56564..57211) FT /transl_table=11 FT /locus_tag="Cj0038c" FT /product="putative poly(A) polymerase family protein" FT /EC_number="2.7.7.-" FT /note="Original (2000) note: Cj0038c, possible membrane FT protein, len: 215 aa; no HP match. Contains two possible FT transmembrane domains at the N-terminus" FT /note="Updated (2006) note: Pfam domain PF01743 Poly A FT polymerase family identified within CDS by carrying out own FT Pfam search. This family includes nucleic acid independent FT RNA polymerases, such as Poly(A) polymerase,which adds the FT poly(A) tail to mRNA (EC:2.7.7.19). This family also FT includes the tRNA nucleotidyltransferase that adds the CCA FT to the 3' of the tRNA (EC:2.7.7.25). Product modified to FT more specific family member due to motif match. No specific FT characterisation has been carried out yet. Thus, putative FT kept within product function. Functional classification - FT Synthesis and modification of macromolecules - DNA FT replication,restriction/modification, recombination and FT repair" FT /db_xref="GOA:Q0PC88" FT /db_xref="UniProtKB/TrEMBL:Q0PC88" FT /inference="protein motif:Pfam:PF01743" FT /protein_id="CAL34218.1" FT /translation="MDLKSLENNRLYILKRLGILKFLSIIEALLVGFLAFVFIRDALIA FT VILAVFVGVFFFRFTAKKLKLAQKELQINALNLFLRRFGAKFKKQSLSQKDFLKLGLTK FT DLKEFKSQNCFEFKDFKIYDIQFLDENKRFFCGILLEISKANKNPSFENEEQIYIKLTD FT KNFTLNHIFSKENHYLITTLSNPFFIDIKKDLESNFKDLEENLNSIKNKLFK" FT misc_feature complement(join(57095..57163,57032..57085)) FT /note="2 probable transmembrane helices predicted for FT Cj0038c by TMHMM2.0 at aa 17-39 and 43-60" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(57211..59019) FT /transl_table=11 FT /gene="typA" FT /locus_tag="Cj0039c" FT /product="GTP-binding protein TypA homolog" FT /note="Original (2000) note: Cj0039c, typA, GTP-binding FT protein typA homolog, len: 602 aa; similar to TYPA_ECOLI FT GTP-binding protein typA/bipA (591 aa), fasta scores; opt: FT 2145 z-score: 2659.1 E(): 0, 54.2% identity in 592 aa FT overlap, and to many EF-G proteins e.g. EFG_AGRTU FT elongation factor G (EF-G) (699 aa), fasta scores; opt: 344 FT z-score: 797.3 E(): 0, 26.2% identity in 715 aa overlap. FT 77.3% identity to HP0480. Contains PS00017 ATP/GTP-binding FT site motif A (P-loop), PS00301 GTP-binding elongation FT factors signature and Pfam match to entry PF00009 GTP_EFTU, FT Elongation factor Tu family (contains ATP/GTP binding FT P-loop), score 282.90, E-value 4e-81" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Homolog FT designation kept within product function. Functional FT classification - Synthesis and modification of FT macromolecules - Protein translation and modification" FT /note="PMID:7783627, PMID:9642082, PMID:14560797" FT /db_xref="GOA:Q0PC87" FT /db_xref="InterPro:IPR000640" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR004161" FT /db_xref="InterPro:IPR005225" FT /db_xref="InterPro:IPR006298" FT /db_xref="InterPro:IPR009000" FT /db_xref="InterPro:IPR009022" FT /db_xref="UniProtKB/TrEMBL:Q0PC87" FT /inference="protein motif:Pfam:PF00009" FT /inference="protein motif:Prosite:PS00301" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34219.1" FT /translation="MENIRNIAVIAHVDHGKTTMVDELLKQSGTFSEREQISERVMDSN FT DIEKERGITILSKNTAINYKGTKINIIDTPGHADFGGEVERVLKMIDGVLLLVDAQEGV FT MPQTKFVVKKALSLGLKPIVVINKIDKPAADPERVINEIFDLFVALDANDEQLDFAIVY FT AAAKNGYAKLDLNDESDNMEPLFKTILERVPAPSGSDENPLQLQVFTLGYDNFVGKIGI FT ARIFNGVVKKNQSVMLAKADGTKVNGRISKLIGFMGLEKMDIEEAGSGDIVAIAGFEAL FT DVGDSVVDPNNPMPLDPLHIEEPTLSIVFSVNDGPLAGTEGKHVTSNKIAERLEAEMKT FT NIAMKYESTGEGKFKVSGRGELQITILAENMRREGFEFCMGRPEVIVKVEDGVKTEPFE FT HLVIDVPEEFSGAVIEKLGKRKAEMKTMAPTGDGQTRLEFEIPARGLIGFRSQFLTDTK FT GEGVMNHSFLEFRPFSGAVEKRNNGALISMENGVALGYSLFNLQERGVLFIEPQTKVYT FT GMIIGEHSRPNDLDVNPIKGKNLTNVRASGSDDAIKLVPPRKLSLERALEWIEEDELVE FT VTPVNVRVRKRYLDPTQRKRMEKAKS" FT misc_feature complement(57580..57843) FT /note="HMMPfam hit to PF00679, Elongation factor G FT C-terminus, score 7.8e-30" FT /inference="protein motif:Pfam:PF00679" FT misc_feature complement(58156..58368) FT /note="HMMPfam hit to PF03144, Elongation factor Tu domain, FT score 6.7e-12" FT /inference="protein motif:Pfam:PF03144" FT misc_feature complement(58429..59016) FT /note="HMMPfam hit to PF00009, Elongation factor Tu GTP FT binding domain, score 6.7e-70" FT /inference="protein motif:Pfam:PF00009" FT misc_feature complement(58846..58893) FT /note="PS00301 GTP-binding elongation factors signature" FT /inference="protein motif:Prosite:PS00301" FT misc_feature complement(58966..58989) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 59154..59477 FT /transl_table=11 FT /locus_tag="Cj0040" FT /product="hypothetical protein Cj0040" FT /note="Original (2000) note: Cj0040, unknown, len: 107 aa; FT no Hp match" FT /note="Updated (2006) note: Literature search identified FT paper giving clues to product function. Functional FT classification - Unknown" FT /note="PMID:14985343" FT /db_xref="GOA:Q0PC86" FT /db_xref="InterPro:IPR002178" FT /db_xref="UniProtKB/TrEMBL:Q0PC86" FT /protein_id="CAL34220.1" FT /translation="MSKPLNEEIFVEFKSDLAERKNEVLLQVLELLETFRSDENEKMAR FT ISSELTEILENEENLEKILNAKNLEELLNILTALNEDKMIKVYEDSYLKEKFPNVMVDK FT FLK" FT CDS 59493..61289 FT /transl_table=11 FT /gene="fliK" FT /locus_tag="Cj0041" FT /product="putative flagellar hook-length control protein" FT /note="Original (2000) note: Cj0041, unknown, len: 598 aa; FT 25.2% identity to HP0906, but shorter at N-term" FT /note="Updated (2006) note: Literature search identified FT papers linking product function to be involved in motility FT and invasion. Unpublished observation by N.Kamal & C. Penn FT have predicted this CDS to be fliK. Literature search FT identified work carried out in Campylobacter FT jejuni,Helicobacter pylori and Escherichia coli. Product FT function modified to more specific family member. Putative FT was kept in product function as not fully characterised. FT Functional classification - Surface structures" FT /note="PMID:12379703, PMID:14985343, FT PMID:15812042,PMID:11895937, PMID:16077121, PMID:15276839" FT /db_xref="GOA:Q0PC85" FT /db_xref="InterPro:IPR021136" FT /db_xref="UniProtKB/TrEMBL:Q0PC85" FT /protein_id="CAL34221.1" FT /translation="MMSNLAPQNDVLNLTPSKTSTTSSSFSKTSKNKEHESSDSKNSTQ FT DDTESFLNSLLNSINETNEFLPDHMKISQKEVVNEAMSRLQKGAFDESDKISIFESASF FT MQILSLLDKLKTDTADVKLANLSTQLSSLIKTEANFNALKGASNLSELLDIAKDLGLNV FT KNIKVDRLLDLKATFPNLDKADFFKGAVDNVFKEIINNKISNVSKNLNHNLENTTHTTS FT THSMQKTNSKDSGSLLSQTLKNLDSILSSKESKHEKNDKVKSKIEEDTTDAKNTLKNIK FT NDEFAKNLTEELNIKDKKNQDNLNKESKDLNKDFNKELNKNQEKNNLNQENIQDQNKNL FT KNNDQNLNLDKNLNKEIVKDTQKLVSNLTQKDFNLNKEPKNNNKENKDIKQNFFDQKLN FT FENLNKTQVVQNKENNANFNNNNTNNKETFTQEQTKTHSENVDKNSLDELNSLVKDLNK FT VTQNNARNITPKETLQYFSQDLKEAVDQYKAPITKLSITLNPNNLGEVEVTLIQRGNNL FT HINFNSNANAMNLFIQNQAEFKNSLVNMGFTGLEMNFSDQGKREQNQNQGKNRSGYGFK FT DALDGKNESEKVNLELVLAKYF" FT CDS 61343..62227 FT /transl_table=11 FT /gene="flgD" FT /locus_tag="Cj0042" FT /product="putative flagellar hook assembly protein" FT /note="Original (2000) note: Cj0042, flgD, possible FT flagellar hook assembly protein, len: 294 aa; similar in FT part to flgD from e.g. TR:Q44920 (EMBL:L76303) flagellar FT hook assembly protein flgD, Borrelia burgdorferi (147 FT aa),fasta scores; opt: 170 z-score: 215.7 E(): 9.3e-05, FT 38.8% identity in 67 aa overlap, and TR:O07893 FT (EMBL:U42012) flgD, Treponema pallidum (153 aa), fasta FT scores; opt: 165 z-score: 208.0 E(): 0.00025, 42.0% FT identity in 88 aa overlap. 28.9% identity to HP0907" FT /note="Updated (2006) note: Pfam domain PF03963 Flagellar FT hook capping protein was identified within CDS. Further FT support given to product function. Alignment does not cover FT full sequence length. No specific characterisation with FT acceptable identity score has been carried out yet. Thus, FT putative not added to product function. Functional FT classification - Surface structures" FT /note="PMID:8049271" FT /db_xref="GOA:Q0PC84" FT /db_xref="InterPro:IPR005648" FT /db_xref="UniProtKB/TrEMBL:Q0PC84" FT /inference="protein motif:Pfam:PF03963" FT /protein_id="CAL34222.1" FT /translation="MISSSDWNLNTTATTSGTTSSGSTSGTTRTDSSSSSGIVSNPNAT FT LDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVETMQKLS FT DSFSTSMSTSALGAIGKMATVSDNKIKLTGADELIALKMYLPEDSDENGVTLEIYDSNN FT KLVFSEKSDAKSISQGLFTMEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYP FT IEGVVFKDGVAYAKMAGQEVPFDAIQEITDYKLGSSSSTGGSGSSGDSSGGSSDGDSSG FT SGSTEDGDKEEKA" FT misc_feature 61382..61852 FT /note="HMMPfam hit to PF03963, Flagellar hook capping FT protein, score 1.4e-60" FT /inference="protein motif:Pfam:PF03963" FT CDS 62231..63868 FT /transl_table=11 FT /gene="flgE" FT /locus_tag="Cj0043" FT /product="flagellar hook protein" FT /note="Original (2000) note: Cj0043, flgE, probable FT flagellar hook protein, len: 545 aa; similar to e.g. FT FLGE_BORBU flagellar hook protein flgE (442 aa), fasta FT scores; opt: 350 z-score: 665.8 E(): 7.9e-30, 27.5% FT identity in 553 aa overlap. 24.5% identity to HP0908. FT Contains PS00588 Flagella basal body rod proteins signature FT and Pfam match to entry PF00460 flg_bb_rod,Flagella basal FT body rod proteins, score 37.00, E-value 6.7e-08" FT /note="Updated (2006) note: Characterised within Borrilia FT burgdorferi and also some work within Campylobacter jejuni. FT Identity scores were marginal. Appropriate motifs were FT present and alignments covered full length of sequence. FT Thus, putative not added to product function. Functional FT classification - Surface structures" FT /note="PMID:9658019, PMID:9244248, PMID:9079915" FT /db_xref="GOA:Q0PC83" FT /db_xref="InterPro:IPR001444" FT /db_xref="InterPro:IPR010930" FT /db_xref="InterPro:IPR019776" FT /db_xref="InterPro:IPR020013" FT /db_xref="UniProtKB/TrEMBL:Q0PC83" FT /inference="protein motif:Pfam:PF00460" FT /inference="protein motif:Prosite:PS00588" FT /protein_id="CAL34223.1" FT /translation="MMNSFYNGISGVKSNSFGIDITANNIANVNTTGFKYSDAQFKDIF FT YTTITTQSTNPAQGGYGSGAASSQVVFEQGSPVASDGEFDVALQGKGFFGVLGADGNAY FT YTRNGSFRRDANGYLVDSYGNFVLGTMNPAFTGINYSDRVAGLMGDYLNTGTPVNNGFT FT VNSNNSFSIGTTASQGAIKVPVNMYLPPQVTQNVKWSGSLNTNTTTEVVKVDLDPSKFN FT ITKTEDGKYVVSGSVSKEDVFSAKAGDRIILNFTDDNGVKTSFEATLDENLNFKSNELD FT LKGLDENSIKLDTAQISTEQQKANKDILESPIYNADGSKSTLRVTLERVLPQEGDNIQY FT KAIAQIYDSNGNAVGNPTEGNMVFDKNGALLQNNITSIANPNGGTINIDLGSPYDANKP FT GSGYSGIYIKQGVEKNVVTQQDGVAEGFFEQYNISDDGSIVAQFSNGKNAIVGKLALYN FT FINEQGLVAMGDNIFAATANSGDASFIMKDGQVVNTAKFKGGFLEQSNVDLSAELSNLI FT VTQKAFDASSKSITTSDQMIQKAINMKR" FT misc_feature 62243..62335 FT /note="HMMPfam hit to PF00460, Flagella basal body rod FT protein, score 1.4e-08" FT /inference="protein motif:Pfam:PF00460" FT misc_feature 62261..62323 FT /note="PS00588 Flagella basal body rod proteins signature" FT /inference="protein motif:Prosite:PS00588" FT misc_feature 63140..63439 FT /note="HMMPfam hit to PF07559, Flagellar basal body protein FT FlaE, score 1.9e-29" FT /inference="protein motif:Pfam:PF07559" FT misc_feature 63743..63859 FT /note="HMMPfam hit to PF06429, Domain of unknown function FT (DUF1078), score 8.8e-18" FT /inference="protein motif:Pfam:PF06429" FT CDS complement(63872..65743) FT /transl_table=11 FT /locus_tag="Cj0044c" FT /product="hypothetical protein Cj0044c" FT /note="Original (2000) note: Cj0044c, unknown, len: 623 aa; FT no Hp ortholog, Also similar to Cj0800c (28.5% identity in FT 625 aa overlap). Preceeded by a C(9-11) polymorphic region; FT C11 would allow the translation of Cj0045c to extend by FT another 15aa, overlapping the start of this CDS; C9 and C10 FT (consensus) have no effect" FT /note="Updated (2006) note: Literature search identified FT paper giving further clues to product function. Functional FT classification - Conserved hypothetical proteins" FT /note="PMID:14985343" FT /db_xref="InterPro:IPR005646" FT /db_xref="UniProtKB/TrEMBL:Q0PC82" FT /protein_id="CAL34224.1" FT /translation="MNFQVKTLETFNPFESLNHEQANTEQILDFRVIDFKLLCSSVKPA FT KTKTYERKDFDLFYADDFFVKNYNTIVQKFLIEIYPKTQSFPFTVKLRSNSNLTHLKAS FT INLTENFKYYPNLKFDILQNIYKIMIKQKFLILRLDKNLFDKIDDFILSIQKSPSIKEI FT ELEIAKGVDKIEHKSDEIIYHRDVNEECFDENINYDEGNYCKPIEKNELLFEYIYRILG FT KEGRNLRGEILHLNPIAFLDNPFIIKDESIYTEELEDRIKYFSANYGFLNKDHTGYCIA FT NNLKLSQIGLKTTGSIKTNTDENINLEITNFDISDDAIKSGIVNVQASNIKVNGNVGAT FT KLYGKNISIKGLTHAKSEIFAQDIFITTHKGTLQADTVYIKNLENGTIIAKNVFVENCM FT GGKIEAENIYICNLLTDNTLYPRKNLIITNNIKFKNNIVVSPLVSIENNSDTECENLKN FT LSLKIKSKLDDTISKMQNYYDYLIKNQIKIIKLQKTKNPSAIEMKFSNLYHDIIKKYNH FT LSISYKKLVKLKYQIDAKLNFLNEMVYNVKIYIKAENIGEDNFLKFYPNTNTNLELKHH FT INLKDYEKVLYLEKGQQVSYIKSSHNYSESDIEEIKIIFKKLEKDNS" FT CDS complement(65744..66466) FT /transl_table=11 FT /locus_tag="Cj0045c" FT /product="putative iron-binding protein" FT /note="Original (2000) note: Cj0045c, possible iron-binding FT protein, len: 240 aa; weak similarity to members of the FT eukaryotic iron-binding hemerythrin family,e.g. HEMT_LINUN FT hemerythrin alpha chain (117 aa), fasta scores; opt: 105 FT z-score: 137.1 E(): 2.5, 23.8% identity in 122 aa overlap. FT Note that all of the iron-binding residues are conserved. FT No Hp match, similar to Cj0072c (pseudogene), Cj0241c FT (30.9% identity in 123 aa overlap) and Cj1224 (27.7% FT identity in 202 aa overlap). Contains a C(9-11) polymorphic FT region at the N-terminus; C11 would allow the translation FT of this CDS to extend by another 15aa, overlapping the FT start of Cj0044c; C9 and C10 (consensus) have little FT effect" FT /note="Updated (2006) note: Pfam domain PF01814 Hemerythrin FT HHE cation binding domain identified within CDS. No FT specific characterisation with acceptable identity score FT has been carried out yet. Thus, putative kept within FT product function. Literature search identified paper giving FT further clues to product function. Functional FT classification - Transport/binding proteins - Cations" FT /note="PMID:14985343" FT /db_xref="GOA:Q0PC81" FT /db_xref="InterPro:IPR012827" FT /db_xref="InterPro:IPR016131" FT /db_xref="UniProtKB/TrEMBL:Q0PC81" FT /inference="protein motif:Pfam:PF01814" FT /protein_id="CAL34225.1" FT /translation="MKVKWSRDFSIKNMQLDKQHELIFEITNLANDLALNIQDNNTQHK FT NDLKQILVKLFQYIKIHFKDEEKFMESIDFPLIEEHKKSHQILVEKTKELLEHSNDIVK FT MSQELSILTKDWILDHFANEDLWIANFTKKTLHLQEIHYTLEQYIKLKSIKQDLRAEKT FT YDYICNCSLRIHAVPQTIHQELVSKENTLKCEKCGQILVHLDYFDLNQNFEKFNAIFED FT ALQNHHFTTQENDMRGGG" FT misc_feature complement(66074..66238) FT /note="HMMPfam hit to PF01814, Hemerythrin HHE cation FT binding domain, score 0.0046" FT /inference="protein motif:Pfam:PF01814" FT misc_feature complement(66248..66433) FT /note="HMMPfam hit to PF01814, Hemerythrin HHE cation FT binding domain, score 0.0029" FT /inference="protein motif:Pfam:PF01814" FT misc_RNA 66646..66744 FT /note="Bacterial signal recognition particle RNA" FT /note="Updated (2006) note: Running Rfam search revealed FT new non-coding RNA families within Campylobacter jejuni. FT Rfam RF00169, Bacterial signal recognition particle RNA was FT identified within CDS. This SRP is a univerally conserved FT ribonucleoprotein involved in the co-translational FT targeting of proteins to membranes" FT CDS join(66985..67113,67229..67411,67411..67602,67602..67940, FT 67942..68203,68205..68278,68277..68504) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0046" FT /product="pseudogene (putative sodium:sulfate transmembrane FT transport protein)" FT /note="Original (2000) note: Cj0046, probable transmembrane FT transport protein pseudogene, len: 1559 bp; fragmentary FT similarity in all three reading frames to members of the FT SODIT1 subfamily of the NADC/P/PHO87 family of transporters FT e.g. SOT1_SPIOL 2-oxoglutarate/malate translocator FT precursor (spinach) (569 aa), fasta scores; opt: 278 FT z-score: 498.4 E(): 1.7e-20, 45.0% identity in 80 aa FT overlap, and YBHI_ECOLI (477 aa) fasta scores; opt: 196 FT z-score: 361.3 E(): 7.2e-13, 34.6% identity in 78 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF00939 FT Sodium:sulfate symporter transmembrane identified within FT CDS. Also, ten probable transmembrane helices predicted by FT TMHMM2.0. Further support given to product function. No FT specific characterisation with acceptable identity scores FT yet. Thus, putative added to product function. Coding FT sequence has been updated to reflect the complete amino FT acid sequence for the encoded protein regardless of its FT expression. This will cause differences from the amino acid FT sequence of the previous annotation. Functional FT classification - Transport/binding proteins - Other" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00939" FT misc_feature order(66985..67113,67229..67411,67411..67602,67602..67940, FT 67942..68203,68205..68277,68278..68492) FT /note="HMMPfam hit to PF00939, Sodium:sulfate symporter FT transmembrane, score 8.5e-118" FT /inference="protein motif:Pfam:PF00939" FT misc_feature order(67012..67080,67289..67357,67719..67787,67875..67940, FT 67942..67944,67957..68025,68050..68118,68161..68203, FT 68205..68230,68249..68277,68278..68315,68328..68396, FT 68415..68483) FT /note="10 probable transmembrane helices predicted for FT Cj0046 by TMHMM2.0 at aa 10-32, 64-86, 208-230, FT 260-282,287-309, 318-340, 355-377, 384-406, 411-433 and FT 440-462" FT /inference="protein motif:TMHMM:2.0" FT stem_loop 68496..68544 FT CDS complement(68532..69548) FT /transl_table=11 FT /gene="trmU" FT /locus_tag="Cj0053c" FT /product="tRNA FT (5-methylaminomethyl-2-thiouridylate)-methyltransferase" FT /EC_number="2.1.1.61" FT /note="Original (2000) note: Cj0053c, trmU, probable tRNA FT (5-methylaminomethyl-2-thiouridylate)-methyltransferase,len: FT 338 aa; similar to many e.g. TRMU_ECOLI tRNA FT (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC FT 2.1.1.61) (383 aa), fasta scores; opt: 249 z-score: 751.3 FT E(): 0, 32.7% identity in 358 aa overlap. 45.8% identity to FT HP1335 conserved hypothetical protein" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Aminoacyl tRNA synthetases and their FT modification" FT /note="PMID:4703553, PMID:3298234" FT /db_xref="GOA:Q9PJ66" FT /db_xref="InterPro:IPR004506" FT /db_xref="InterPro:IPR014729" FT /db_xref="InterPro:IPR023382" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ66" FT /protein_id="CAL34227.1" FT /translation="MKILVAMSGGVDSTVTAYKLKNLGHEVIGCYMKLHGKPNYHEENI FT KKVEKVANFLQIPYHILDLQEDFKNKVYMPFVDTYKEGKTPNPCALCNRFIKLGKLLEF FT AKSLGCEKLATGHYARLENNLIKTAVDESKDQSYFLASADKEALKYLIFPLGEMKKEDV FT KKFASTIEVLKSFATQKESSEICFVEDTYVQVLDQFMDTKIPGEVLDSSGKVVGKHEGY FT MHYTIGKRRGFEVRGAHEPHFVLKINPKQNQIIVGTKEELKISEFNLKNINLFIDAKEL FT DCEVKIRYRSKSTPCKVEIYEDKSAKIILKDPVYGLASGQMAVFYDHDKVIASGFIE" FT misc_feature complement(68538..69548) FT /note="HMMPfam hit to PF03054, tRNA methyl FT transferase,score 1.3e-132" FT /inference="protein motif:Pfam:PF03054" FT CDS complement(69548..70153) FT /transl_table=11 FT /locus_tag="Cj0054c" FT /product="putative lysine decarboxylase family protein" FT /note="Original (2000) note: Cj0054c, unknown, len: 201 aa; FT similar to hypothetical proteins e.g. TR:Q46063 FT (EMBL:X81379) Corynebacterium glutamicum hypothetucal FT protein (211 aa), fasta scores; opt: 426 z-score: 696.2 FT E(): 1.6e-31, 44.2% identity in 156 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF03641 possible FT lysine decarboxylase family identified within CDS. Product FT modified to more specific family member due to motif match. FT No specific characterisation with acceptable identity score FT has been carried out yet. Thus, putative kept within FT product function. Functional classification -Misc" FT /db_xref="InterPro:IPR005269" FT /db_xref="UniProtKB/TrEMBL:Q0PC79" FT /inference="protein motif:Pfam:PF03641" FT /protein_id="CAL34228.1" FT /translation="MNEKISQDLEKFANIPNLKNAVTFFGSARLKEDNFYYQQAKILAQ FT KCVQNGFCVISGGGGGIMRAANEGAFSQNNNTNSMSSVGFNIFLPHEQKLNDFVEYNIT FT FESLAIRKMALIEKSLAFVIFPGGFGTLDELCEILTLKQLEFKKDVPIILFGSEFWRGF FT DEFVRNSLLKLEVISKGDELKYKITDDLDFIINTLKEI" FT misc_feature complement(69551..69967) FT /note="HMMPfam hit to PF03641, Possible lysine FT decarboxylase, score 2.2e-53" FT /inference="protein motif:Pfam:PF03641" FT CDS complement(70274..71098) FT /transl_table=11 FT /locus_tag="Cj0055c" FT /product="conserved hypothetical protein Cj0055c" FT /note="Original (2000) note: Cj0055c, unknown, len: 274 aa; FT no Hp match, similar in C-terminus to Cj0122 (46.6% FT identity in 148 aa overlap)" FT /note="Updated (2006) note: Contains Prosite match PS01164 FT COPPER_AMINE_OXID, Copper amine oxidase. Amine oxidases are FT enzymes that catalyze the oxidation of different biogenic FT amines e.g. neurotransmitters. Copper-containing amine FT oxidases are found in bacteria. This particular form binds FT one copper ion per subunit as well as a FT 2,4,5-trihydroxyphenylalanine quinone (or topaquinone) FT (TPQ) cofactor (PMID:8591028). Functional classification FT -Unknown" FT /note="PMID:8591028" FT /db_xref="UniProtKB/TrEMBL:Q0PC78" FT /inference="protein motif:Prosite:PS01164" FT /protein_id="CAL34229.1" FT /translation="MVGILSSKEEKLMINSLNSNLNYDYNTSNFKQDKNIDFKINKHGV FT AVITGEGALPYRGKKFEYNPKIFGLDESISKKDMQEFNNFMKSNALKDPNKIEKSPLKD FT FNPAYTKWDPTTEKMMLGFFVSYSKMFHLGYDIIKKADEFYKEFDALISKDLSLNEFKT FT KYIDFKQRYDEFVKEYEMAMGDKMLLSSDDEIITQQSEKPFKAIQGESKNKETYKDDST FT RNELVKKLLEGKFSTSKELELLFGMKFSDDDAGEFNKILSLNSTPKSIDIKA" FT misc_feature complement(71024..71065) FT /note="PS01164 Copper amine oxidase topaquinone signature" FT /inference="protein motif:Prosite:PS01164" FT CDS complement(71155..71571) FT /transl_table=11 FT /locus_tag="Cj0056c" FT /product="hypothetical protein Cj0056c" FT /note="Original (2000) note: Cj0056c, unknown, len: 138 aa. FT No Hp match" FT /note="Updated (2006) note: Literature search identified FT paper giving clues to product function. Functional FT classification - Unknown" FT /note="PMID:14702320" FT /db_xref="UniProtKB/TrEMBL:Q0PC77" FT /protein_id="CAL34230.1" FT /translation="MKEVKGGYITYLKRLSDNEVIAFAKPDWNLELTLFQDSNGDQYYW FT NREGLVRFGGMCGIETTNCLVNSKHSYINQKRLWETMSIVGDDPYRNFLGYTVKRNIGI FT SNLGKRFVYFSYGVAVINEQSGSWYRVKSSPVFE" FT CDS 72005..72859 FT /transl_table=11 FT /locus_tag="Cj0057" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0057, possible periplasmic FT protein, len: 284 aa; no Hp match. Contains possible FT N-terminal signal sequence. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PC76" FT /protein_id="CAL34231.1" FT /translation="MKKIFLTFMVLVNCVFASDELNIDSLFKKQIGLRSITSFSLLSTG FT NANSYSLYPNITIGGDPTIWNDTKQVFLTQTFIYTLTPKFDILISGGGSYARQEYTNFF FT TNAYSHKDRIGFDNLWLGFIYTGDSIADLIPQITFQTAVVQREKAINQTKNFYLKSQSL FT QASLRGYSDPVVYSIYTGFGYNQSRKFKTLKIEYGNSIYVGGDLSIILSPKITLDLGAE FT QRFQMKQKINGYQNSEVRSIPTLSLGSTYSINSDTAVSVNASFGGSSASPDSIFGISLW FT KKF" FT sig_peptide 72005..72055 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000026_72005_72859 by SignalP 2.0 HMM FT (Signal peptide probability 0.783) with cleavage site FT probability 0.723 between residues 17 and 18" FT CDS 72844..73443 FT /transl_table=11 FT /locus_tag="Cj0058" FT /product="putative peptidase C39 family protein" FT /note="Original (2000) note: Cj0058, possible periplasmic FT protein, len: 199 aa; no Hp match. Contains possible FT N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF03412 Peptidase FT C39 family identified within CDS. Product modified to more FT specific family member based on motif match. No specific FT characterisation with acceptable identity scores carried FT out yet. Thus, putative kept within product function. FT Functional classification - Degradation of macromolecules - FT Proteins, peptides and glycopeptides" FT /db_xref="GOA:Q0PC75" FT /db_xref="InterPro:IPR005074" FT /db_xref="UniProtKB/TrEMBL:Q0PC75" FT /inference="protein motif:Pfam:PF03412" FT /protein_id="CAL34232.1" FT /translation="MEKILKILLFLPILALSTKAEWVVKSYQEIKNERVIRQTYEQSCG FT ASSLATLLNILDDQKKFDELELLKIMSGQELYTDMVSFADLNDAVKKLGFQSNSYQINR FT ENLDKLVNIPMLVKIEDDPRFPHFVIIINHKGNYLQVLDPSHGEYISSKSQFFSIWDRY FT NKGGYALIVAPKKELKPFKLNTPKSLHFDFSPFSLF" FT misc_feature 72949..73374 FT /note="HMMPfam hit to PF03412, Peptidase C39 family, score FT 4.5e-11" FT /inference="protein motif:Pfam:PF03412" FT CDS complement(73492..74334) FT /transl_table=11 FT /gene="fliY" FT /locus_tag="Cj0059c" FT /product="putative flagellar motor switch protein" FT /note="Original (2000) note: Cj0059c, fliY, probable FT flagellar motor switch protein, len: 280 aa; similar to FT e.g. TR:P74928 (EMBL:U36839) Treponema pallidum flagellar FT motor switch protein fliY (348 aa), fasta scores; opt: 277 FT z-score: 496.5 E(): 2.1e-20, 26.2% identity in 309 aa FT overlap. Also similar in C-terminus to FLIN_BORBU flagellar FT motor switch protein fliN (113 aa), fasta scores; opt: 231 FT z-score: 362.5 E(): 6.2e-13, 44.2% identity in 77 aa FT overlap. 39.7% identity to HP1030. Contains Pfam match to FT entry PF01052 SPOA_protein, Surface presentation of FT antigens (SPOA) protein, score 52.80,E-value 7.5e-12" FT /note="Updated (2006) note: Chararcterisation has been FT carried out within Escherichia coli and Bacillus FT subtilis,however, only partial sequence alignment was FT achieved. Thus, putative kept within product function. FT Functional classification - Cell envelope - Surface FT structures" FT /note="PMID:1447979, PMID:1898932, PMID:14749334" FT /db_xref="GOA:Q0PC74" FT /db_xref="InterPro:IPR001172" FT /db_xref="InterPro:IPR001543" FT /db_xref="InterPro:IPR012826" FT /db_xref="UniProtKB/TrEMBL:Q0PC74" FT /inference="protein motif:Pfam:PF01052" FT /protein_id="CAL34233.1" FT /translation="MINDFLKMFTNECISTIEGLTGKSAEFSEYKEFDVNTSDTLKAPL FT VYAIFNIANGGKIGILAGAILMSAIGEWMMGEEEITKNDKLGPDEMDAAKEAIQNIISA FT FSTTLGAQKDIPKMDFSIESCEFVPESVDFKDFKKLFLYDVKIGDLEEQVSLAMDQTLH FT NILSGKPAETGNTSTDSNHNTEEKAIMLSEELKNINLIMDVRLPVRVRIGNKKMLLKDV FT LTMDIGSVVELNQLANDPLEILIGDKRIAYGEVVIVDGNFGVQITEIGSKKERLEQLR" FT misc_feature complement(73516..73746) FT /note="HMMPfam hit to PF01052, Surface presentation of FT antigens (SPOA) prot, score 6.1e-24" FT /inference="protein motif:Pfam:PF01052" FT CDS complement(74331..75410) FT /transl_table=11 FT /gene="fliM" FT /locus_tag="Cj0060c" FT /product="flagellar motor switch protein" FT /note="Original (2000) note: Cj0060c, fliM, probable FT flagellar motor switch protein, len: 359 aa; simlar to e.g. FT FLIM_BACSU flagellar motor switch protein fliM (332 aa), FT fasta scores; opt: 728 z-score: 1046.5 E(): 0, 35.6% FT identity in 329 aa overlap. 61.1% identity to HP1031" FT /note="Updated (2006) note: Pfam domain PF01052 Surface FT presentation of antigens (SPOA) protein and PF02154 FT Flagellar motor switch protein FliM were identified within FT CDS. Further support given to product function. FT Characterised within Bacillus subtilis with acceptable FT identity score. Thus, putative not added to product FT function. Functional classification - Cell envelope FT -Surface structures" FT /note="PMID:1898932, PMID:8169223" FT /db_xref="GOA:Q0PC73" FT /db_xref="InterPro:IPR001543" FT /db_xref="InterPro:IPR001689" FT /db_xref="UniProtKB/TrEMBL:Q0PC73" FT /inference="protein motif:Pfam:PF02154" FT /inference="protein motif:Pfam:PF01052" FT /protein_id="CAL34234.1" FT /translation="MAEILSQEEIDALLEVVDDNTDTPIASNSKDEKDERNIVVYDFKR FT PNRVSKEQLRTIKGIHDKLARNLASQISSMMRSIVETKLHSVDQMTYGEFLMSLPSPTS FT FNVFSIKPLDGNCVLEINPSIAFPMIDRLLGGQGDSYEASRELTDIELNLLDSILRIIM FT QRLKESWATVTEIYPSIEAKESSPNVVQIVSQNEIVIMVVMEIIIGNSSGMVNICYPVV FT HLESILSRLANRDIMMGETSAKKSRNKELKTLIGRAEVVYEAILGKTLINVHEFLELKQ FT GDILRLDREADDKAIVSIDKKDVFLAQIGLHRFRKSIKILELIRTDKDEIKEILEKYEE FT ERKAKASVYDEPEEEDEEI" FT misc_feature complement(74430..74660) FT /note="HMMPfam hit to PF01052, Surface presentation of FT antigens (SPOA) prot, score 0.00022" FT /inference="protein motif:Pfam:PF01052" FT misc_feature complement(74718..75290) FT /note="HMMPfam hit to PF02154, Flagellar motor switch FT protein FliM, score 8.3e-105" FT /inference="protein motif:Pfam:PF02154" FT CDS complement(75410..76126) FT /transl_table=11 FT /gene="fliA" FT /locus_tag="Cj0061c" FT /product="RNA polymerase sigma factor for flagellar operon" FT /note="Original (2000) note: Cj0061c, fliA, probable RNA FT polymerase sigma factor for flagellar operon, len: 238 aa; FT similar to many e.g. FLIA_ECOLI RNA polymerase sigma factor FT for flagellar operon (sigma-F factor) (239 aa),fasta FT scores; opt: 235 z-score: 539.0 E(): 9.1e-23, 31.6% FT identity in 225 aa overlap. 54.9% identity to HP1032. FT Contains PS00716 Sigma-70 factors family signature 2, Pfam FT match to entry PF00140 sigma70, Sigma-70 factors, score FT 91.20, E-value 2e-23 and helix-turn-helix motif (Score FT 1846, +5.47 SD)" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni, Escherichia coli and Helicobacter FT pylori. Thus, putative removed from product function. FT Functional classification - Cell envelope - Surface FT structures" FT /note="PMID:11292815, PMID:7590326, PMID:11985711" FT /db_xref="GOA:Q0PC72" FT /db_xref="InterPro:IPR000943" FT /db_xref="InterPro:IPR007627" FT /db_xref="InterPro:IPR007630" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR012845" FT /db_xref="InterPro:IPR013324" FT /db_xref="InterPro:IPR013325" FT /db_xref="InterPro:IPR014284" FT /db_xref="UniProtKB/TrEMBL:Q0PC72" FT /inference="protein motif:Pfam:PF00140" FT /inference="protein motif:Prosite:PS00716" FT /protein_id="CAL34235.1" FT /translation="MNSKKDEEMLKEPPKAYAQMLKKEQDELVLSYMPALRAMAFRLKE FT RLPSSIDVNDLISIGVEEMIKLSRRYDKEQNDNFWGFARKRVNGSMLDYLRSLDVMSRN FT NRKIIKDIDAIMDEYFLEHECEPDDEYLAKKLDLDVEKIKEVRTAHAISYTLPIDEQIE FT LYNEDNTLEKIEKEELLEKIHEVLDDLKERDQLIIQLYYYEELSLKEISEILQISESRI FT SQIHKKLLKKLRERLV" FT misc_feature complement(75422..75571) FT /note="HMMPfam hit to PF04545, Sigma-70, region, score FT 5.8e-19" FT /inference="protein motif:Pfam:PF04545" FT misc_feature complement(75428..75508) FT /note="PS00716 Sigma-70 factors family signature 2" FT /inference="protein motif:Prosite:PS00716" FT misc_feature complement(75827..76045) FT /note="HMMPfam hit to PF04542, Sigma-70 region, score FT 3.3e-12" FT /inference="protein motif:Pfam:PF04542" FT CDS complement(76083..76439) FT /transl_table=11 FT /locus_tag="Cj0062c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0062c, probable integral FT membrane protein, len: 118 aa; no Hp match. Contains two FT possible transmembrane domains. Functional classification - FT Cell envelope - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PC71" FT /protein_id="CAL34236.1" FT /translation="MRPENYVAFFTVCGFFIGLAFSIISIDEAFDILIFTCFITFMFYV FT FVHIAIMNFIDVKKISGRIFNKHDYEKTSNNIINDLVIREKKMDIILEKLNEEREELKK FT NEFKERRRNAKRAA" FT misc_feature complement(join(76362..76421,76278..76346)) FT /note="2 probable transmembrane helices predicted for FT Cj0062c by TMHMM2.0 at aa 7-26 and 32-54" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(76458..77324) FT /transl_table=11 FT /locus_tag="Cj0063c" FT /product="putative ATP-binding protein" FT /note="Original (2000) note: Cj0063c, probable ATP-binding FT protein, len: 288 aa; similar to hypothetical proteins in FT other flagellar operons e.g. YLXH_BACSU hypothetical 33.2 FT kd protein in flhF-cheB intergenic region (298 aa), fasta FT scores; opt: 390 z-score: 493.5 E(): 3.1e-20, 29.0% FT identity in 293 aa overlap, and to cell division proteins FT e.g. MIND_BACSU septum site-determining protein minD (268 FT aa), fasta scores; opt: 323 z-score: 417.6 E(): FT 5.3e-16,32.9% identity in 249 aa overlap. 45.7% identity to FT HP1034. Contains PS00017 ATP/GTP-binding site motif A FT (P-loop) and Pfam match to entry PF00991 ParA, ParA family FT ATPase, score 34.80, E-value 1.3e-06" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity score carried out yet. FT Thus,putative kept within product function. Functional FT classification - Cell envelope - Surface structures" FT /db_xref="GOA:Q0PC70" FT /db_xref="InterPro:IPR002586" FT /db_xref="UniProtKB/TrEMBL:Q0PC70" FT /inference="protein motif:Pfam:PF00991" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34237.1" FT /translation="MNNQANKLRNLMSQNGTKKSQNTHFIAITSGKGGVGKSTISANLA FT NVLANNGYKVGLFDADIGLANLDVILNVRIQKNLLHVLRGECSLEDILIEVKPNLWLIP FT GESGDEILKYNDKNIYERFLNQASILDELDFLIIDTGAGIGGNILNFLEMADEVIVVTV FT PDPAAITDAYATIKTTSKTKENLLMLFNVVKNENEALKVFENIKKVADANIKNPLNLEF FT LGHLSASKDVSGSIKKRTLFSDENTASSDEIKALASKLLYRLERKVLDNVSNRSFSSFF FT RKIIERF" FT misc_feature complement(76623..77249) FT /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA FT nucleotide binding domai, score 5.8e-21" FT /inference="protein motif:Pfam:PF01656" FT misc_feature complement(77211..77234) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(77317..78771) FT /transl_table=11 FT /gene="flhF" FT /locus_tag="Cj0064c" FT /product="flagellar biosynthesis protein" FT /note="Original (2000) note: Cj0064c, flhF, flagellar FT biosynthesis protein, len: 484 aa; similar to e.g. FT FLHF_BACSU flagellar biosynthesis protein flhF (366 FT aa),fasta scores; opt: 406 z-score: 483.3 E(): 1.2e-19, FT 32.0% identity in 256 aa overlap. 99.0% identity to FT TR:O52908 (EMBL:AJ000857) C. jejuni flhF protein (fragment) FT (104 aa). 40.9% identity to HP1035. Contains PS00017 FT ATP/GTP-binding site motif A (P-loop) and Pfam match to FT entry PF00448 SRP54, SRP54-type protein, score FT -25.00,E-value 1.8e-09" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni and Bacillus subtilis. Thus, putative FT not added to product function. Functional classification FT -Cell envelope - Surface structures" FT /note="PMID:10792727, PMID:14617189, PMID:15317803" FT /db_xref="GOA:O52908" FT /db_xref="InterPro:IPR000897" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR020006" FT /db_xref="UniProtKB/Swiss-Prot:O52908" FT /inference="protein motif:Pfam:PF00448" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34238.1" FT /translation="MGQLIHTFTVEDTEQIIPKVKEDYGDKALIITNKQIRPKTLNRSA FT LYEVMVAIEESDYEEHLKKQGKSLPAKKSSPKPSSTSLAEEKIRSQIPQEDEDVVLDFS FT NTRLNTNLNTVKNNDLAKKTYQDFPQNKINPHQNKTLGFDDFKEKLSEVSNEISKVTNT FT PLENYTPNPNYNKKIENFEKQFEKQINKLNDKIDLLADMMWDDKAEARKNLMIPPEFAS FT IYKQAKESGMLENHLEAIMKATIENMPAAMKTNKDAVQRYFHSLLRNILPCRVESDIKK FT QKIMMLVGPTGVGKTTTLAKLAFRYAYGDKRYKTGIITLDTYRIGAVEQLFQYAKMMKL FT PIIDSIEPKDLDEAIKSLNNCEVILVDTIGNSQYDQSKLAKTKEFLMHSNAEIDVNLVV FT SANTKHEDLMEIYKNFSFLNIDTLIITKFDETKVFGNIFSLVYETNIPLSFFSIGQEVP FT DDLEVANSDFLVHCILEGFNKGKNNE" FT misc_feature complement(77347..77931) FT /note="HMMPfam hit to PF00448, SRP54-type protein, GTPase FT domain, score 1.9e-40" FT /inference="protein motif:Pfam:PF00448" FT misc_feature complement(77884..77907) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(78781..79254) FT /transl_table=11 FT /gene="folK" FT /locus_tag="Cj0065c" FT /product="putative FT 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine FT pyrophosphokinase" FT /EC_number="2.7.6.3" FT /note="Original (2000) note: Cj0065c, folK, possible FT 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine FT pyrophosphokinase, len: 157 aa, similar to e.g. HPPK_BACSU FT 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine FT pyrophosphokinase (EC 2.7.6.3) (167 aa), fasta scores; opt: FT 194 z-score: 370.0 E(): 2.4e-13, 28.7% identity in 129 aa FT overlap. 35.6% identity to HP1036. Contains Pfam match to FT entry PF01288 FT HPPK,7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase FT (HPPK), score 4.10, E-value 1.1e-06" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis and Escherichia coli, however, identity scores FT were marginal. Thus, putative kept within product function. FT Functional classification - Biosynthesis of cofactors, FT prosthetic groups and carriers - Folic acid" FT /note="PMID:1325970" FT /db_xref="GOA:Q9PJ54" FT /db_xref="InterPro:IPR000550" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ54" FT /inference="protein motif:Pfam:PF01288" FT /protein_id="CAL34239.1" FT /translation="MLKIQGVKHFEKSRFFPFFSQNIRSFKYLALIGLGSNIEPEKKRF FT DMLFRVMMDDKRFKILSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALLKVLLYYE FT VKFKRKRTFKNAPRTLDLDLLYFSQKVKRDKWCEVPHKGAKERVSVILPLGMI" FT misc_feature complement(78784..79164) FT /note="HMMPfam hit to FT PF01288,7,8-dihydro-6-hydroxymethylpterin-pyrophosph, score FT 3.1e-25" FT /inference="protein motif:Pfam:PF01288" FT misc_feature complement(78880..78915) FT /note="PS00794 FT 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase FT signature" FT /inference="protein motif:Prosite:PS00794" FT CDS complement(79257..79736) FT /transl_table=11 FT /gene="aroQ" FT /locus_tag="Cj0066c" FT /product="3-dehydroquinate dehydratase" FT /EC_number="4.2.1.10" FT /note="Original (2000) note: Cj0066c, aroQ, probable FT 3-dehydroquinate dehydratase, len: 159 aa; similar to type FT II enzymes e.g. AROD_ACTPL 3-dehydroquinate dehydratase (EC FT 4.2.1.10) (154 aa), fasta scores; opt: 419 z-score: 765.6 FT E(): 0, 44.8% identity in 145 aa overlap. 50.9% identity to FT HP1038. Contains Pfam match to entry PF01220 DHquinase_II, FT Dehydroquinase class II , score 261.60,E-value 1e-74" FT /note="Updated (2006) note: Characterised within FT Helicobacter pylori with acceptable identity scores. FT Thus,putative removed from product function. Functional FT classification - Amino acid biosynthesis - Aromatic amino FT acid family" FT /note="PMID:8912695, PMID:12784220" FT /db_xref="GOA:Q9PJ53" FT /db_xref="InterPro:IPR001874" FT /db_xref="InterPro:IPR018509" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ53" FT /inference="protein motif:Pfam:PF01220" FT /protein_id="CAL34240.1" FT /translation="MKIMIIQGPNVNMLGVREVGIYGAMKMEEIHEQMKLAASQNNVEL FT DFFQSNFEGEIVDKIQECLGTVDGIIINAAGYTHTSVAIRDAIAAVALPTIEVHISNVY FT RREEFRQKSLIAPVCSGTIVGFGPFGYHLALMGIIQICEQIKNLRAMQQAQQTNK" FT misc_feature complement(79305..79730) FT /note="HMMPfam hit to PF01220, Dehydroquinase class FT II,score 1.4e-74" FT /inference="protein motif:Pfam:PF01220" FT CDS 79827..81056 FT /transl_table=11 FT /locus_tag="Cj0067" FT /product="putative amidohydrolase family protein" FT /note="Original (2000) note: Cj0067, unknown, len: 409 aa; FT identical to, but shorter than, C. jejuni hypothetical FT protein TR:P71126 (EMBL:U38524) upstream of pspA (518 aa) FT (99.5% identity in 409 aa overlap), and to many FT hypothetical proteins e.g. YF41_METJA hypothetical protein FT MJ1541 (420 aa), fasta scores; opt: 226 z-score: 413.4 E(): FT 9.2e-16, 26.9% identity in 383 aa overlap. 42.0% identity FT to HP0267 chlorohydrolase" FT /note="Updated (2006) note: Pfam domain PF01979 FT Amidohydrolase family identified within CDS. Product FT modified to more specific family member due to motif match. FT No specific characterisation with acceptable identity score FT has yet been carried out. Thus, putative kept within FT product function. Functional classification -Misc" FT /note="PMID:8793884" FT /db_xref="GOA:Q0PC66" FT /db_xref="InterPro:IPR006680" FT /db_xref="UniProtKB/TrEMBL:Q0PC66" FT /inference="protein motif:Pfam:PF01979" FT /protein_id="CAL34241.1" FT /translation="MFIVAARYLFLCDEDFTILENQAFVFEDKILELGELDNLKKKYPK FT AKIIKTPKNSVILPAFINPHTHLEFSANSTTLHFGEFLIWLKSVINSRSILNAQAKEEL FT ILQSIKKMQKSGIGTIGEISSFGSDLDPCLKASHKGMRIVFFNEILGTNENQVEDKKQE FT FLKRFENSLKFKNDFFIPAISIHSPYSTHPSLAHFALDLAKKQNLLASTHFLESKAENI FT WLRESKGGFKKWLENFTLHPKPLYTPKDFVKLFKGVRTLFTHCVYLKEYEWLDKNLHSI FT THCAFSNRLLSQKSLDLKTALKSGLNIHLGTDGLSSNISLSLLDEMRANLLIHKNFDLL FT ELASKLLQMVTLYPARALNLNLGELKKGKIADFNVFELGECDKKQAPLQFILNAKEVDK FT LFIKGKECKF" FT misc_feature 79992..80957 FT /note="HMMPfam hit to PF01979, Amidohydrolase family,score FT 1.8e-68" FT /inference="protein motif:Pfam:PF01979" FT CDS 81044..81940 FT /transl_table=11 FT /gene="pspA" FT /locus_tag="Cj0068" FT /product="protease" FT /note="Original (2000) note: Cj0068, pspA, probable FT protease required for pilus-like appendage formation, len: FT 298 aa; almost identical to TR:P71127 (EMBL:U38524) pspA FT (298 aa) (99.0% identity in 298 aa overlap) and similar to FT the C-terminus of e.g. SPPA_ECOLI protease IV (618 FT aa),fasta scores; opt: 285 z-score: 266.8 E(): 1.3e-07, FT 24.7% identity in 251 aa overlap. 42.0% identity to HP1435" FT /note="Updated (2006) note: Pfam domain PF01343 Peptidase FT family S49 identified within CDS. Product function based on FT direct submission with paper (PMID:8793884). Putative not FT added to product function due to characterisation work FT within Campylobacter jejuni. Functional classification FT -Degradation of macromolecules - Surface structures" FT /note="PMID:8793884, PMID:3522590" FT /db_xref="GOA:Q0PC65" FT /db_xref="InterPro:IPR002142" FT /db_xref="InterPro:IPR004635" FT /db_xref="InterPro:IPR023562" FT /db_xref="UniProtKB/TrEMBL:Q0PC65" FT /inference="protein motif:Pfam:PF01343" FT /protein_id="CAL34242.1" FT /translation="MQILKSFFKALGCGIKFINTYFKTFVLLLIVIWILIPSANSSSNL FT ANLERIDLKGEIFDSSAVLEKIINAKNDSNIKGVLFVIDSPGGAFAPSMELALAIKDLK FT IKKPVLVYASGTMASGSYLAGVGANKILANPASFIGSIGVIMQGADLSGLANKLGIKEQ FT TIQAGEFKSAGTFARAWNENERNFLQGLIDQSYDLFTGFVAKERALDLNKKDQWANARV FT FLAAKAKELGLIDELSNYENAKKELEKLANVSNPVWKEEDKIDKFLNRLEGQTSSLISK FT SLIEIAYKTNSSFINAR" FT sig_peptide 81044..81166 FT /note="Signal peptide predicted for pspA by SignalP 2.0 HMM FT (Signal peptide probability 0.973) with cleavage site FT probability 0.320 between residues 41 and 42" FT misc_feature 81080..81148 FT /note="1 probable transmembrane helix predicted for Cj0068 FT by TMHMM2.0 at aa 13-35" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 81344..81805 FT /note="HMMPfam hit to PF01343, Peptidase family S49, score FT 1.4e-74" FT /inference="protein motif:Pfam:PF01343" FT CDS 82019..83050 FT /transl_table=11 FT /locus_tag="Cj0069" FT /product="hypothetical protein Cj0069" FT /note="Original (2000) note: Cj0069, unknown, len: 343 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Literature search identified FT paper giving further clues to product function. Functional FT classification - Unknown" FT /note="PMID:14702320" FT /db_xref="UniProtKB/TrEMBL:Q0PC64" FT /protein_id="CAL34243.1" FT /translation="MKKNIVFFEVKGGSDKGEDGYRKDTMPMVNALKAKGWNAEVIFFE FT VGKKDEIYKYVKENFDGYVSRINPGNLKEENEYFDMLRKLCADKLVGMPHPDAMIGYGA FT KDALTKLADTDLVPSDTYAYYDIKTFKENFPKSLAKGERVLKQNRGSTGEGIWRVSVEG FT NVSGDSLPLNTKIKCTEAKDNHVEHRELGEFMDFCEQYIIGDNGMLVDMTFLPRIKEGE FT IRLLMLYNTPVNVVHKKPAEDADAFSATLFSGAKYRYDKPEDWKTLVDMFLGELPKVRE FT KLGNYDLPLIWTADFILDTDEKGNDKYVLGEINCSCVGFTSHLELADEVASNIINIVSK FT TKA" FT CDS complement(83047..83205) FT /transl_table=11 FT /locus_tag="Cj0070c" FT /product="hypothetical protein Cj0070c" FT /note="Original (2000) note: Cj0070c, questionable CDS,len: FT 52 aa; no Hp match" FT /note="Updated (2006) note: Similar to proteins in other FT bacteria. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PC63" FT /protein_id="CAL34244.1" FT /translation="MDKFDYSYPILTKDTKCSFCENFFSIEYSSNLKTIEKECPFYNNK FT MDIKLKD" FT CDS complement(join(83292..83654,83654..83893)) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0072c" FT /product="pseudogene (putative iron-binding protein)" FT /note="Original (2000) note: Cj0072c, possible iron-binding FT protein pseudogene, len: 98 aa; Weak similarity to members FT of the eukaryotic iron-binding hemerythrin family, e.g. FT HEMM_THEZO myohemerythrin (118 aa). Note that all of the FT iron-binding residues are conserved. No Hp match. Also FT similar to N-terminus of Cj1224 (50.5% identity in 91 aa FT overlap), Cj0241c (40.5% identity in 79 aa overlap) and FT Cj0045c (32.5% identity in 83 aa overlap). Contains one FT frameshift" FT /note="Updated (2006) note: Pfam domains x2 PF01814 FT Hemerythrin HHE cation binding domain identified within FT CDS. Further support given to product function. Similar to FT many Campylobacter species designated as putative FT methy-accepting chemotaxis protein and also iron-binding FT proteins. No specific characterisation with acceptable FT identity score has been carried out yet. Thus, putative FT kept within product function. Coding sequence has been FT updated to reflect the complete amino acid sequence for the FT encoded protein regardless of its expression. This will FT cause differences from the amino acid sequence of the FT previous annotation. Functional classification FT -Transport/binding proteins - Cations" FT /inference="protein motif:Pfam:PF01814" FT misc_feature complement(join(83654..83686,83523..83654)) FT /note="HMMPfam hit to PF01814, Hemerythrin HHE cation FT binding domain, score 2.9" FT /inference="protein motif:Pfam:PF01814" FT misc_feature complement(83696..83866) FT /note="HMMPfam hit to PF01814, Hemerythrin HHE cation FT binding domain, score 0.007" FT /inference="protein motif:Pfam:PF01814" FT CDS complement(84087..84743) FT /transl_table=11 FT /locus_tag="Cj0073c" FT /product="conserved hypothetical protein Cj0073c" FT /note="Original (2000) note: Cj0073c, unknown, len: 218 aa; FT similar to hypothetical proteins e.g. YKGG_ECOLI (282 aa), FT fasta scores; opt: 215 z-score: 231.0 E(): 1.3e-05,32.2% FT identity in 146 aa overlap. 41.8% identity to HP0137" FT /note="Updated (2006) note: Pfam domain PF02589 FT Uncharacterized ACR, YkgG family COG1556 identified within FT CDS. Conserved added to product function. Literature search FT identified paper giving further clues to product function. FT Functional classification - Conserved hypothetical FT proteins" FT /note="PMID:15773975" FT /db_xref="InterPro:IPR003741" FT /db_xref="InterPro:IPR024185" FT /db_xref="UniProtKB/TrEMBL:Q0PC62" FT /inference="protein motif:Pfam:PF02589" FT /protein_id="CAL34246.1" FT /translation="MSKIDEISSKSKANILEHLKKAYKETTFTRIESIDPVEHIQTTQD FT MLTEMKQKMSDNKYIVENATKDTLEEKINEIVAKYSFKSMIYGADLNLNLEQIKAEKKI FT CFDKEIENLRSEVFHSDFSIIHARAGVSSHGVALIPSSKTQPRMLSLAPKLCIVLLKKE FT NVVKSLSEALNLVKKENEILPTNILFIAGPSRTADIELITVFGVHGPQIAHIIIY" FT misc_feature complement(84090..84470) FT /note="HMMPfam hit to PF02589, Uncharacterized ACR, YkgG FT family COG1556, score 1.2e-29" FT /inference="protein motif:Pfam:PF02589" FT CDS complement(84736..86175) FT /transl_table=11 FT /locus_tag="Cj0074c" FT /product="putative iron-sulfur protein" FT /note="Original (2000) note: Cj0074c, probable iron-sulfur FT protein, len: 479 aa; similar to hypothetical proteins e.g. FT YKGF_ECOLI (475 aa), fasta scores; opt: 1142 z-score: FT 1335.9 E(): 0, 38.3% identity in 462 aa overlap. 58.1% FT identity to HP0138. Contains 2x PS00198 4Fe-4S ferredoxins, FT iron-sulfur binding region signature and 2x Pfam match to FT entry PF00037 fer4, 4Fe-4S ferredoxins and related FT iron-sulfur cluster binding domains., scores 13.80, E-value FT 0.0095, and 12.30, E-value 0.026" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores. Thus, putative kept within FT product function. Functional classification -Energy FT metabolism - Electron transport" FT /note="PMID:15773975" FT /db_xref="GOA:Q0PC61" FT /db_xref="InterPro:IPR001450" FT /db_xref="InterPro:IPR003741" FT /db_xref="InterPro:IPR004452" FT /db_xref="InterPro:IPR009051" FT /db_xref="InterPro:IPR012285" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR017900" FT /db_xref="InterPro:IPR024185" FT /db_xref="InterPro:IPR024569" FT /db_xref="UniProtKB/TrEMBL:Q0PC61" FT /inference="protein motif:Pfam:PF00037" FT /inference="protein motif:Prosite:PS00198" FT /protein_id="CAL34247.1" FT /translation="MSQKIPHEQIVQIKLNDKQMQENLMTAMHTLQKNRLNVIDARFKD FT WQGLRAKAKQAKNNALMSLEERLLEFEKNATKNGIKVHWASSDEDACEIVYEIMKEKNI FT TKLLKGKSMASEEIGLNHYLEKKGLKAIETDLGELILQLNEEPPLHIVVPAIHRNRHEI FT GEIFKEKLGANLENDEPESLNAVAREHLRKDFEGLKLGLSGVNFAMSREGAFWLIENEG FT NGRMCTTAPDIHIALCGIEKIMESFEDAATMVSLLTPSATGQFIPTYNNIITGPRKNGD FT LDGPKEVHVILFDHNRSKMLAHEDYYEALRCIRCGACMNFCPVYDQIGGHAYQTTYPGP FT IGEVISPNIFGIDHTGDILNFCSLCGRCSEVCPVQIPLADLIRKLRCDKIGQGKNPPLG FT ANNVHHNALEAFAFKQFKNIATNGDKWRFSLSKAHYFNWTVQNFASILPVIKKWYAFKE FT LPQIKMDLYKEVQKLEGVSYE" FT misc_feature complement(85042..85113) FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 0.00065" FT /inference="protein motif:Pfam:PF00037" FT misc_feature complement(85057..85092) FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT misc_feature complement(85192..85263) FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 0.0015" FT /inference="protein motif:Pfam:PF00037" FT misc_feature complement(85207..85242) FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT misc_feature complement(85258..85296) FT /note="PS00018 EF-hand calcium-binding domain" FT /inference="protein motif:Prosite:PS00018" FT CDS complement(86172..86912) FT /transl_table=11 FT /locus_tag="Cj0075c" FT /product="putative oxidoreductase iron-sulfur subunit" FT /note="Original (2000) note: Cj0075c, possible FT oxidoreductase iron-sulfur subunit, len: 246 aa; similar to FT hypothetical proteins and to the C-terminus of e.g. FT TR:O53142 (EMBL:AJ000942) Methanobacterium FT thermoautotrophicum strain Marburg, Thiol:fumarate FT reductase subunit B (488 aa), fasta scores; opt: 217 FT z-score: 476.0 E(): 3e-1, 24.3% identity in 235 aa overlap. FT 60.7% identity to HP0139" FT /note="Updated (2006) note: Pfam domain x2 PF02754 FT Cysteine-rich domain identified within CDS. Further support FT given to product function. No specific characterisation FT with acceptable identity score. Thus,putative kept within FT product function. Functional classification - Energy FT metabolism - Electron transport" FT /note="PMID:15773975" FT /db_xref="InterPro:IPR004017" FT /db_xref="UniProtKB/TrEMBL:Q0PC60" FT /inference="protein motif:Pfam:PF02754" FT /protein_id="CAL34248.1" FT /translation="MMKKVYFYATCLGSTAMQQSVLNAIKLLRREGIEVIFKKNQTCCA FT QPSFNSGYFDESREIALYNVDLFDKDYPIVVPSGSCAGMMSHDYKELFKNRPEFSKIKT FT FSSRVIELSQYLDEVLKVDYEDKGVPIKVTWHSNCHALRVQKSIQASKNLIKKLKNVEL FT VELQYEEECCGFGGTFSVKEPEISNAMVRSKIKDIQNSGAKYLISGDGGCLLNIDGTMK FT RMGLDIKGIHLYDFLLKRLEGGRL" FT misc_feature complement(86259..86447) FT /note="HMMPfam hit to PF02754, Cysteine-rich domain, score FT 7.2e-19" FT /inference="protein motif:Pfam:PF02754" FT misc_feature complement(86655..86831) FT /note="HMMPfam hit to PF02754, Cysteine-rich domain, score FT 5.1e-12" FT /inference="protein motif:Pfam:PF02754" FT CDS complement(87036..88718) FT /transl_table=11 FT /gene="lctP" FT /locus_tag="Cj0076c" FT /product="L-lactate permease" FT /note="Original (2000) note: Cj0076c, lctP, probable FT L-lactate permease, len: 560 aa; highly similar to many FT e.g. LLDP_ECOLI L-lactate permease (551 aa), fasta scores; FT opt: 1957 z-score: 2614.5 E(): 0, 54.0% identity in 556 aa FT overlap. 61.2% identity to HP0141 and 60.6% identity to FT HP0140" FT /note="Updated (2006) note: Pfam domain PF02652 L-lactate FT permease identified within CDS. Thirteen probable FT transmembrane helices predicted by TMHMM2.0. Further FT support given to product function. Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Transport/binding proteins -Carbohydrates, FT organic acids and alcohols" FT /note="PMID:8407843, PMID:11283302, PMID:11785976" FT /db_xref="GOA:Q0PC59" FT /db_xref="InterPro:IPR003804" FT /db_xref="UniProtKB/TrEMBL:Q0PC59" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02652" FT /protein_id="CAL34249.1" FT /translation="MEQILTWQQIYDPFSNIWLSALVAFLPILCFLVCLVVLKLKGYQA FT GFLTVILATLVALFAYKMPWNLVGASFIQGFTNGMWPIAWIIIAAIFLYKLSIKSGSFE FT IIKKSVMSITPDHRIQVILIGFCFGSFLEGAIGFGGPVAITAALLVGLGLRPLQAAGLC FT LIANTAPVAFGAVGIPIIAMANLVGIEQHSVSAMVGRMLVPLSLTIPFFIVFLMDGFKG FT IKETFPAILVAALSFTTTQFLSSNHLGAELPDIISAVVSLAVTTVFLKFWKPKNIFRFD FT NESNFTQDNTLSFNQILKAWSPFILLIVCIIIWTQPWFKALFDKDGILSYTSITLQFSN FT ITTGILSPSITGIGEAKPLSLALGVDLINGKTVAQAGTAILLAAFLTIAILKIKAEDAA FT ECFWVTLKEMAIPCITIGLVVAFAFISKNSGMSTTLGLAFAHTGDAFSFFSPIIGWIGV FT FLTGSDTSANLLFGTLQQVSAQKLGISEALFLAANSVGGVVGKMISPQSIAIACAAVGL FT VGKESDLFKFTLKYSVAFIILIGIWTCIIAFFLQGIIPEVIVK" FT misc_feature complement(join(88608..88676,88536..88595,88425..88493, FT 88269..88364,88158..88226,88071..88139,87903..87956, FT 87762..87830,87546..87605,87444..87512,87297..87365, FT 87168..87236,87057..87125)) FT /note="13 probable transmembrane helices predicted for FT Cj0076c by TMHMM2.0 at aa 15-37, 42-61, 76-98, FT 119-150,165-187, 194-216, 255-272, 297-319, 372-391, FT 403-425,452-474, 495-517 and 532-554" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(87081..88664) FT /note="HMMPfam hit to PF02652, L-lactate permease, score FT 1.2e-268" FT /inference="protein motif:Pfam:PF02652" FT misc_feature complement(87183..87215) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(88890..89459) FT /transl_table=11 FT /gene="cdtC" FT /locus_tag="Cj0077c" FT /product="cytolethal distending toxin C" FT /note="Original (2000) note: Cj0077c, cdtC, cytolethal FT distending toxin, len: 189 aa, identical to TR:Q46102 FT (EMBL:U51121) cdtC (189 aa). No Hp match. Contains FT N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF03499 Cytolethal FT distending toxin C identified within CDS. Product modified FT to more specific family member due to motif match. FT Characterised within Campylobacter jejuni, so putative not FT added to product function. Functional classification FT -Pathogenicity" FT /note="PMID:10688204, PMID:8675309, PMID:11083762" FT /db_xref="GOA:Q46102" FT /db_xref="InterPro:IPR003558" FT /db_xref="InterPro:IPR008997" FT /db_xref="UniProtKB/TrEMBL:Q46102" FT /inference="protein motif:Pfam:PF03499" FT /protein_id="CAL34250.1" FT /translation="MKKIITLFFMFITLAFATPTGDLKDFTEMVSIRSLETGIFLSAFR FT DTSKDPIDQNWNIKEIVLSDELKQKDKLADELPFGYVQFTNPKESDLCLAILEDGTFGA FT KSCQDDLKDGKLETVFSIMPTTTSAVQIRSLVLESDECIVTFFNPNIPIQKRFGIAPCT FT LDPIFFAEVNELMIITPPLTAATPLE" FT misc_feature complement(89040..89438) FT /note="HMMPfam hit to PF03499, Cytolethal distending toxin FT C, score 3.6e-81" FT /inference="protein motif:Pfam:PF03499" FT sig_peptide complement(89409..89459) FT /note="Signal peptide predicted for cdtC by SignalP 2.0 HMM FT (Signal peptide probability 0.983) with cleavage site FT probability 0.852 between residues 17 and 18" FT CDS complement(89470..90267) FT /transl_table=11 FT /gene="cdtB" FT /locus_tag="Cj0078c" FT /product="cytolethal distending toxin B" FT /note="Original (2000) note: Cj0078c, cdtB, cytolethal FT distending toxin, len: 265 aa; identical toTR:Q46101 FT (EMBL:U51121) cdtB (265 aa) and similar to e.g. TR:Q47089 FT (EMBL:U03293) Escherichia coli cdtB (273 aa), fasta scores; FT opt: 946 z-score: 1533.6 E(): 0, 55.2% identity in 268 aa FT overlap. No Hp match. Contains N-terminal signal sequence" FT /note="Updated (2006) note: Prosite domain PRO1388 FT CDTOXINB, Cytolethal distending toxin B signature FT identified within CDS. Product modified to more specific FT family member due to motif match. Characterised within FT Campylobacter jejuni, so putative not added to product FT function. Functional classification - Pathogenicity" FT /note="PMID:10688204, PMID:8675309, PMID:11083762" FT /db_xref="GOA:Q46101" FT /db_xref="InterPro:IPR003539" FT /db_xref="InterPro:IPR005135" FT /db_xref="UniProtKB/TrEMBL:Q46101" FT /protein_id="CAL34251.1" FT /translation="MKKIICLFLSFNLAFANLENFNVGTWNLQGSSAATESKWSVSVRQ FT LVSGANPLDILMIQEAGTLPRTATPTGRHVQQGGTPIDEYEWNLGTLSRPDRVFIYYSR FT VDVGANRVNLAIVSRMQAEEVIVLPPPTTVSRPIIGIRNGNDAFFNIHALANGGTDVGA FT IITAVDAHFANMPQVNWMIAGDFNRDPSTITSTVDRELANRIRVVFPTSATQASGGTLD FT YAITGNSNRQQTYTPPLLAAILMLASLRSHIVSDHFPVNFRKF" FT misc_feature complement(89476..90207) FT /note="HMMPfam hit to FT PF03372,Endonuclease/Exonuclease/phosphatase fa, score FT 7.8e-23" FT /inference="protein motif:Pfam:PF03372" FT sig_peptide complement(90169..90267) FT /note="Signal peptide predicted for cdtB by SignalP 2.0 HMM FT (Signal peptide probability 0.926) with cleavage site FT probability 0.740 between residues 33 and 34" FT CDS complement(90264..91070) FT /transl_table=11 FT /gene="cdtA" FT /locus_tag="Cj0079c" FT /product="cytolethal distending toxin A" FT /note="Original (2000) note: Cj0079c, cdtA, cytolethal FT distending toxin, len: 268 aa; identical to TR:Q46100 FT (EMBL:U51121) cdtB (268 aa) and similar to e.g. TR:Q47088 FT (EMBL:U03293) Escherichia coli cdtA (237 aa), fasta scores; FT opt: 310 z-score: 408.0 E(): 1.8e-15, 32.7% identity in 159 FT aa overlap. No Hp match. Contains N-terminal signal FT sequence and appropriately positioned PS00013 Prokaryotic FT membrane lipoprotein lipid attachment site" FT /note="Updated (2006) note: Pfam domain PF03498 Cytolethal FT distending toxin A identified within CDS. Product modified FT to more specific family member due to motif match. FT Characterised within Campylobacter jejuni, so putative not FT added to product function. Functional classification FT -Pathogenicity" FT /note="PMID:10688204, PMID:8675309, PMID:11083762" FT /db_xref="GOA:Q0PC56" FT /db_xref="InterPro:IPR000772" FT /db_xref="InterPro:IPR003558" FT /db_xref="InterPro:IPR008997" FT /db_xref="InterPro:IPR015957" FT /db_xref="UniProtKB/Swiss-Prot:Q0PC56" FT /inference="protein motif:Pfam:PF03498" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34252.1" FT /translation="MQKIIVFILCCFMTFFLYACSSKFENVNPLGRSFGEFEDTDPLKL FT GLEPTFPTNQEIPSLISGADLVPITPITPPLTRTSNSANNNAANGINPRFKDEAFNDVL FT IFENRPAVSDFLTILGPSGAALTVWALAQGNWIWGYTLIDSKGFGDARVWQLLLYPNDF FT AMIKNAKTNTCLNAYGNGIVHYPCDASNHAQMWKLIPMSNTAVQIKNLGNGKCIQAPIT FT NLYGDFHKVFKIFTVECAKKDNFDQQWFLTTPPFTAKPLYRQGEVR" FT misc_feature complement(90420..90704) FT /note="HMMPfam hit to PF03498, Cytolethal distending toxin FT A, score 1.6e-33" FT /inference="protein motif:Pfam:PF03498" FT sig_peptide complement(90990..91070) FT /note="Signal peptide predicted for cdtA by SignalP 2.0 HMM FT (Signal peptide probability 0.852) with cleavage site FT probability 0.451 between residues 27 and 28" FT misc_feature complement(91005..91058) FT /note="1 probable transmembrane helix predicted for Cj0079c FT by TMHMM2.0 at aa 5-22" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(91011..91043) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 91147..91416 FT /transl_table=11 FT /locus_tag="Cj0080" FT /product="putative membrane protein. Functional FT classification-Membranes, lipoproteins and porins" FT /note="Original (2000) note: Cj0080, possible membrane FT protein, len: 267 aa; no Hp match; Contains one possible FT transmembrane domain" FT /note="Updated (2006) note: Two probable transmembrane FT helices predicted by TMHMM2.0" FT /db_xref="UniProtKB/TrEMBL:Q0PC55" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34253.1" FT /translation="MFYFVVFKGRIYMYLKHLYFSISQIFNFYKEGFKNLTLGKTLWKI FT IFIKLFVMFVILKLFVFDVNFNSIFKSDKEKSTFVLKNLTLEGK" FT misc_feature order(91174..91233,91270..91338) FT /note="2 probable transmembrane helices predicted for FT Cj0080 by TMHMM2.0 at aa 10-29 and 42-64" FT /inference="protein motif:TMHMM:2.0" FT CDS 91417..92979 FT /transl_table=11 FT /gene="cydA" FT /locus_tag="Cj0081" FT /product="cytochrome bd oxidase subunit I" FT /EC_number="1.10.3.-" FT /note="Original (2000) note: Cj0081, cydA, probable FT cytochrome bd oxidase subunit I, len: 520 aa;similar to FT many e.g. APPC_ECOLI cytochrome bd-ii oxidase subunit I (EC FT 1.10.3.-) (514 aa), fasta scores; opt: 1412 z-score: 1888.2 FT E(): 0, 45.7% identity in 530 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF01654 Bacterial FT Cytochrome Ubiquinol Oxidase identified within CDS. FT Also,nine probable transmembrane helices predicted by FT TMHMM2.0. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Thus, putative not added to product FT function. Functional classification - Energy metabolism - FT Electron transport" FT /note="PMID:8626304, PMID:9068659, PMID:9852001" FT /db_xref="GOA:Q0PC54" FT /db_xref="InterPro:IPR002585" FT /db_xref="UniProtKB/TrEMBL:Q0PC54" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01654" FT /protein_id="CAL34254.1" FT /translation="MNELSSVDWSRAQFALTALYHFLFVPLTLGLSFMIAIMETIYVKT FT KNERWKKITKFWLSLFAINFAIGVATGIIMEFEFGTNWANYSWFVGDIFGAPLAVEGIM FT AFFLEATFFAVMFFGWDKVSKGFHLLSTWCVAIGSNLSAFWILVANGWMQYPVGMSFNP FT DTARNEMQSFFEVALSPVAISKFLHTIGSGYVISALFVMGISAWFMLKGRHIIEAKKSL FT VVGASFGLVCSIFLFFSGDESAYRVTQTQPMKLAAMEGVYQGEHRAGLVPFGILNPKKT FT IDNNESVFLFDITIPYALSILGNRDPNSFVPGIEDLIYGNESKGIEPMQNRIDRGKIAI FT QTLKDYKLAKENNDTIAMANHKSILETHFKDFGYGYLEKPSDTIPPVALTFYSFHIMVA FT LGSFFFLLFIVTLYLTMANDIEKFRKVLWVCLLSIPLGYIAAEAGWIVAEVGRQPWAIQ FT DLLPVHIAATQLGKVNVQISFWIFAVLFTALLIAEVKIMLTQIKKGFDAHAGHTPLMGK FT GEK" FT misc_feature 91441..92952 FT /note="HMMPfam hit to PF01654, Bacterial Cytochrome FT Ubiquinol Oxidase, score 3.3e-191" FT /inference="protein motif:Pfam:PF01654" FT misc_feature order(91459..91527,91582..91650,91708..91776,91795..91863, FT 91972..92040,92077..92136,92587..92655,92692..92760, FT 92845..92913) FT /note="9 probable transmembrane helices predicted for FT Cj0081 by TMHMM2.0 at aa 15-37, 56-78, 98-120, FT 127-149,186-208, 221-240, 391-413, 426-448 and 477-499" FT /inference="protein motif:TMHMM:2.0" FT CDS 92979..94103 FT /transl_table=11 FT /gene="cydB" FT /locus_tag="Cj0082" FT /product="cytochrome bd oxidase subunit II" FT /EC_number="1.10.3.-" FT /note="Original (2000) note: Cj0082, cydB, probable FT cytochrome bd oxidase subunit II, len: 520 aa;similar to FT many e.g. CYDB_ECOLI cytochrome d ubiquinol oxidase subunit FT II (EC 1.10.3.-) (379 aa), fasta scores; opt: 466 z-score: FT 449.6 E(): 8.7e-18, 27.7% identity in 386 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF02322 Cytochrome FT oxidase subunit II identified within CDS. Also, nine FT probable transmembrane helices predicted by TMHMM2.0. FT Further support given to product function. Characterised FT within Escherichia coli with marginal identity score. FT Putative not added to product function. Functional FT classification - Energy metabolism - Electron transport" FT /note="PMID:8626304, PMID:9068659, FT PMID:9852001,PMID:15470119" FT /db_xref="GOA:Q0PC53" FT /db_xref="InterPro:IPR003317" FT /db_xref="UniProtKB/TrEMBL:Q0PC53" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02322" FT /protein_id="CAL34255.1" FT /translation="MFFGLELEGLQIYWWLILSLLGGLLVFMFFVQGGQTLIDELSKDE FT LEKTMLVNSLGRKWELGFTTLVLFGGAAFAAFPLFYSTSFGGAYWAWLCILFCFILQAV FT AYEYRKKENNVYGSKTYEIFLKINGYLGVFLIGVAVSSFFSGSEFILNEHNFVSWQNPL FT HGLELLLNPFNYLLGLALVFLARLLGAAYFMNNINDENIKIRAMKKLMINSILFLPFFL FT GFLAWIFLKDGFSVDTNGVVSMSANLYLYNFLNQMIFAVLLVIGVILVLLGMVQGTKGC FT SKAIFTLGLGTVLTVFALLSSIGLGQSAFYPSLSDLQSSLTLKNASSSYYTLSVMAYVS FT LLVPFVLAYIIYVWNAMDKVKITREEIANDDHAY" FT misc_feature 93000..94061 FT /note="HMMPfam hit to PF02322, Cytochrome oxidase subunit FT II, score 3.5e-13" FT /inference="protein motif:Pfam:PF02322" FT misc_feature order(93006..93071,93153..93221,93234..93302,93363..93431, FT 93501..93569,93606..93665,93723..93791,93828..93896, FT 93972..94040) FT /note="9 probable transmembrane helices predicted for FT Cj0082 by TMHMM2.0 at aa 10-31, 59-81, 86-108, FT 129-151,175-197, 210-229, 249-271, 284-306 and 332-354" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(94297..94992) FT /transl_table=11 FT /locus_tag="Cj0085c" FT /product="putative amino acid recemase" FT /note="Original (2000) note: Cj0085c, probable amino acid FT recemase, len: 231 aa; similar to members of the FT aspartate/glutamate racemases family e.g. YGEA_ECOLI (230 FT aa), fasta scores; opt: 667 z-score: 1155.6 E(): 0, 46.7% FT identity in 225 aa overlap, and RACD_STRTR aspartate FT racemase (243 aa), fasta scores; opt: 254 z-score: 230.9 FT E(): 1.3e-05, 25.4% identity in 232 aa overlap. No Hp FT match. Contains PS00924 Aspartate and glutamate racemases FT signature 2 andPfam match to entry PF01177 FT Asp_Glu_race,Aspartate / glutamate racemase, score 108.40, FT E-value 1.3e-28" FT /note="Updated (2006) note: Pfam domain PF01177 FT Asp/Glu/Hydantoin racemase identified within CDS. No FT specific characterisation with acceptable identity score FT identified. Thus, putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PC52" FT /db_xref="InterPro:IPR001920" FT /db_xref="InterPro:IPR004380" FT /db_xref="InterPro:IPR015942" FT /db_xref="UniProtKB/TrEMBL:Q0PC52" FT /inference="protein motif:Pfam:PF01177" FT /inference="protein motif:Prosite:PS00924" FT /protein_id="CAL34256.1" FT /translation="MKTIGIIGGMSFESTITYYKTINQAINDKLKSLNSAKILLYSVNF FT EEIENLQSQDKWQEAAQILTQCAKKLELAGANFIIIATNTMHKVFDEIQQNINIPILHI FT AKSSAKALKQENIQKIGLLGTKYTMTQDFYKKMLIEENISVITPSDEDIKIVNDIIFNE FT LCKGEIKQDSKEKYLNIIKKLQEKGAKGVLLACTEIGLLISKNDTNIKIFDTSLIHALD FT AANEALKDL" FT misc_feature complement(94309..94986) FT /note="HMMPfam hit to PF01177, Asp/Glu/Hydantoin FT racemase,score 4.8e-67" FT /inference="protein motif:Pfam:PF01177" FT misc_feature complement(94387..94419) FT /note="PS00924 Aspartate and glutamate racemases signature FT 2" FT /inference="protein motif:Prosite:PS00924" FT CDS complement(95108..95803) FT /transl_table=11 FT /gene="ung" FT /locus_tag="Cj0086c" FT /product="uracil-DNA glycosylase" FT /EC_number="3.2.2.-" FT /note="Original (2000) note: Cj0086c, ung, probable FT uracil-DNA glycosylase, len: 231 aa; similar to mnay FT e.g.UNG_BORBU uracil-DNA glycosylase (EC 3.2.2.-) (223 aa), FT fasta scores; opt: 765 z-score: 1221.9 E(): 0, 51.8% FT identity in 222 aa overlap. 47.8% identity to HP1347. FT Contains PS00130 Uracil-DNA glycosylase signature and Pfam FT match to entry PF00315 UNG, Uracil-DNA glycosylase, score FT 334.90, E-value 9e-97" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Appropriate motifs present. Thus, putative not added to FT product function. Functional classification - DNA FT replication, restriction/modification, recombination and FT repair" FT /note="PMID:2836397, PMID:1429601" FT /db_xref="GOA:Q9PJ40" FT /db_xref="InterPro:IPR002043" FT /db_xref="InterPro:IPR005122" FT /db_xref="InterPro:IPR018085" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ40" FT /inference="protein motif:Pfam:PF00315" FT /inference="protein motif:Prosite:PS00130" FT /protein_id="CAL34257.1" FT /translation="MEEITINIDKIKINDDWKEFLRDEFQKKYFLEIKKQYLNAINQNI FT IIYPPANLIFNAFNLCPLKEIKIIILGQDPYHQPNQAMGLSFSVPKNVKIPPSLNNIFK FT ELQNDLNITPAKSGDLSSWAKQGVLLLNSILSVEANKAASHSSWGWQEFSDAIIHKLSN FT EKSGLVFMLWGNYAKNKEILIDNTKHLILKAAHPSPLARTGFLGCKHFSKANEFLKKVG FT KIPIDWKIV" FT misc_feature complement(95147..95623) FT /note="HMMPfam hit to PF03167, Uracil DNA glycosylase FT superfamily, score 1.6e-73" FT /inference="protein motif:Pfam:PF03167" FT misc_feature complement(95576..95605) FT /note="PS00130 Uracil-DNA glycosylase signature" FT /inference="protein motif:Prosite:PS00130" FT CDS 96074..97480 FT /transl_table=11 FT /gene="aspA" FT /locus_tag="Cj0087" FT /product="aspartate ammonia-lyase" FT /EC_number="4.3.1.1" FT /note="Original (2000) note: Cj0087, aspA, aspartate FT ammonia-lyase, len: 468 aa; similar to many e.g.ASPA_ECOLI FT aspartate ammonia-lyase (EC 4.3.1.1) (ASPAR (478 aa),fasta FT scores; opt: 1853 z-score: 2526.1 E(): 0, 58.2% identity in FT 466 aa overlap, 67.5% identity to HP0649. Contains PS00163 FT Fumarate lyases signature and Pfam match to entry PF00206 FT lyase_1, Lyases, score 615.50, E-value 3.1e-181" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Central intermediary metabolism -General" FT /note="PMID:2699932" FT /db_xref="GOA:Q0PC50" FT /db_xref="InterPro:IPR000362" FT /db_xref="InterPro:IPR003031" FT /db_xref="InterPro:IPR004708" FT /db_xref="InterPro:IPR005677" FT /db_xref="InterPro:IPR008948" FT /db_xref="InterPro:IPR018951" FT /db_xref="InterPro:IPR020557" FT /db_xref="InterPro:IPR022761" FT /db_xref="InterPro:IPR024083" FT /db_xref="UniProtKB/TrEMBL:Q0PC50" FT /inference="protein motif:Pfam:PF00206" FT /inference="protein motif:Prosite:PS00163" FT /protein_id="CAL34258.1" FT /translation="MGTRKEHDFIGELEISDEVYYGVQTFRAVENFDISHDRLKDFPRF FT VRALARVKKAAAMANHELGLLDKNIQDAIIKACDKILEGGYYDQFVVDMIQGGAGTSTN FT MNANEVIANIGLELMGHKKGEYQYLHPNDHVNLSQSTNDAYPTALHLALHDYLSDLAKA FT MEHLKKAYERKAEEFKDVLKMGRTQLQDAVPMTLGREFKTFAVMIGEDIQRVLEARKLI FT LEINLGGTAIGTGINSHPDYPKVVERKIREVTGFEYTVAEDLIEATQDTGAYVQISGVL FT KRVATKLSKVCNDLRLLSSGPKCGLNEINLPKMQPGSSIMPGKVNPVIPEVVNQVCYFV FT IGADVTVTFACEGGQLQLNVFEPVVAYSLFNSVVMLEKAMYTLADKCIDGITANEKICS FT DFVYNSVGIVTALNPYIGYENSASIAKEAMNTGKRVADIALERGLLSKEQIDEILTPSN FT MLNPHMEAKK" FT misc_feature 96104..97099 FT /note="HMMPfam hit to PF00206, Lyase, score 1.2e-151" FT /inference="protein motif:Pfam:PF00206" FT misc_feature 97022..97051 FT /note="PS00163 Fumarate lyases signature" FT /inference="protein motif:Prosite:PS00163" FT CDS 97496..98833 FT /transl_table=11 FT /gene="dcuA" FT /locus_tag="Cj0088" FT /product="anaerobic C4-dicarboxylate transporter" FT /note="Original (2000) note: Cj0088, dcuA, probable FT anaerobic C4-dicarboxylate transporter, len: 445 aa; highly FT similar to many e.g. DCUA_ECOLI anaerobic C4-dicarboxylate FT transporter dcuA (433 aa), fasta scores; opt: 1484 z-score: FT 1900.4 E(): 0, 53.6% identity in 442 aa overlap. 61.0% FT identity to HP0724" FT /note="Updated (2006) note: Pfam domain PF03605 Anaerobic FT c4-dicarboxylate membrane transport protein identified FT within CDS. Twelve probable transmembrane helices predicted FT by TMHMM2.0. Characterised within Wolinella succinogenes FT (PMID:11004174) and Escherichia coli with acceptable FT identity score. Thus, putative removed from product FT function. Functional classification -Transport/binding FT proteins - Carbohydrates, organic acids and alcohols" FT /note="PMID:11004174" FT /db_xref="GOA:Q0PC49" FT /db_xref="InterPro:IPR004668" FT /db_xref="UniProtKB/TrEMBL:Q0PC49" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03605" FT /protein_id="CAL34259.1" FT /translation="MDIMIILQVIVLLGAIFIGIRLGGIAIGYAGGLGVVILGLVLGMK FT PGNIPWDVILIIAAAIAAISAMQQAGGLDYMVRVTEKILRSSPKFINYLAPACGWLLTI FT LAGTGNAVFSLMPVVVDVAKSQNIKPSVPLSLMVVSSQIGITASPVSAAVVYMSGVLEP FT LGWNYPTLIGIWISTTFVACMLAAFIVSLITPMDLSKDSVYQERLKAGLVKDAGAVLHG FT EDKPGAKLSVVIFLITVLAVVLYATAISSNIKWIDPVVVSRDAAIMSFLLTAATLITWL FT CKVEPGKILDTSVFKSGMTACVCVFGVAWLGNTFVAGHEASIKEVAGDWVKQTPAMLAV FT AFFFASMLLYSQAATAKAIVPVIITALGISAANPHDSYMLVACFAAVSALFVLPTYPTL FT LGAVQMDDTGTTRIGKFIFNHSFFIPGVLAIAIAVALGFVLAPMLI" FT misc_feature order(97502..97555,97568..97621,97640..97708,97766..97834, FT 97895..97963,98006..98074,98183..98242,98270..98338, FT 98396..98464,98507..98575,98633..98701,98759..98827) FT /note="12 probable transmembrane helices predicted for FT Cj0088 by TMHMM2.0 at aa 3-20, 25-42, 49-71, FT 91-113,134-156, 171-193, 230-249, 259-281, 301-323, FT 338-360,380-402 and 422-444" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 97517..98608 FT /note="HMMPfam hit to PF03605, Anaerobic c4-dicarboxylate FT membrane transpo, score 3.9e-245" FT /inference="protein motif:Pfam:PF03605" FT misc_feature 98012..98044 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 98941..100302 FT /transl_table=11 FT /locus_tag="Cj0089" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0089, probable FT lipoprotein,len: 453 aa; 27.4% identity to HP0018. Contains FT N-terminal signal sequence and appropriately positioned FT PS00013 Prokaryotic membrane lipoprotein lipid attachment FT site. Functional classification - Membranes, lipoproteins FT and porins" FT /db_xref="GOA:Q0PC48" FT /db_xref="InterPro:IPR011990" FT /db_xref="UniProtKB/TrEMBL:Q0PC48" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34260.1" FT /translation="MKIKVGLIFSGIACLFLTACVNQVKQNTTFENTLTQKYCGDDFFN FT QNLEKIKKNDDVIYTGLNAGLIARNCGDFNKSNVFFDAVEESYKYDVDLENVSPKAAKF FT IGTTLLNDNIVDYDGSLYERIMVNIYKALNYMEEDDYENARVEFNRVLMRQDKAKEYFA FT KEIEKNRADLDKAKEDKNYDKNMNENSKVIEAQYDNLFKEFDTTKNFINPYATYLASIF FT FFMDKDYRKAADLFREVAIIYPKNKTIKKEAKIFKEYATKIKVKKAKKYVFVVYENGFG FT VVKDEFALTLPFIVDKKIISTNIALQTLKKREASFANLNINGQNTNDFVDLDNIVATEF FT KINMPAMIAKALAQTIIKTTLNVAVANNDSTGGWLSLATAVATAATNKADVRSWRGLPK FT SIAIATIENDGNLEIKDPQGNILFQKSLDKNKNALVIVRSFAPYLPASVAIMEK" FT sig_peptide 98941..99018 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000038_98941_100302 by SignalP 2.0 HMM FT (Signal peptide probability 0.998) with cleavage site FT probability 0.724 between residues 26 and 27" FT misc_feature 98968..99000 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 99313..99414 FT /note="HMMPfam hit to PF07719, Tetratricopeptide FT repeat,score 1.4" FT /inference="protein motif:Pfam:PF07719" FT misc_feature 99577..99678 FT /note="HMMPfam hit to PF07719, Tetratricopeptide FT repeat,score 0.12" FT /inference="protein motif:Pfam:PF07719" FT CDS 100312..100680 FT /transl_table=11 FT /locus_tag="Cj0090" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0090, probable FT lipoprotein,len: 122 aa; no Hp match. Contains N-terminal FT signal sequence and appropriately positioned PS00013 FT Prokaryotic membrane lipoprotein lipid attachment site. FT Functional classification - Membranes, lipoproteins and FT porins" FT /db_xref="InterPro:IPR010824" FT /db_xref="UniProtKB/TrEMBL:Q0PC47" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34261.1" FT /translation="MKKNILFILMFLLSACAPSYQINSNQNTVILGSNLPKSLVKQFQK FT RINSNGYLEFEVILRSTFAKDVIYKVDWLDKDGFVLRDVLNEDYQALRIPAGQEVILRK FT LASDTRANDFRLEIKAKN" FT sig_peptide 100312..100383 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000039_100312_100680 by SignalP 2.0 FT HMM (Signal peptide probability 0.997) with cleavage site FT probability 0.247 between residues 24 and 25" FT misc_feature 100327..100359 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 100704..101327 FT /transl_table=11 FT /locus_tag="Cj0091" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0091, probable FT lipoprotein,len: 207 aa; 33.5% identity to HP1457. Contains FT N-terminal signal sequence and appropriately positioned FT PS00013 Prokaryotic membrane lipoprotein lipid attachment FT site. Functional classification - Membranes, lipoproteins FT and porins" FT /db_xref="InterPro:IPR014094" FT /db_xref="UniProtKB/TrEMBL:Q0PC46" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34262.1" FT /translation="MKKTKILGTALIGALLFSGCAQTAYTDGKASQVKKGDALTLGLDR FT QDFESAAETMINSMLSDPAFANIKPGTRKVIAIGRVVNDTPQRIDTEKLTAKITSALRK FT SGKFVLTSAVAAGGALDSMSEDVRELRDNDEFNQKTIAKKGTLVSPDFSLAGKIRQDNV FT KLSNGKTQVEYFFLLRLTDLTSGLVYWEDEQTIDKTGSSKSVTW" FT sig_peptide 100704..100781 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000040_100704_101327 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.579 between residues 26 and 27" FT misc_feature 100722..100781 FT /note="1 probable transmembrane helix predicted for Cj0091 FT by TMHMM2.0 at aa 7-26" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 100731..100763 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 101410..102747 FT /transl_table=11 FT /locus_tag="Cj0092" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0092, probable periplasmic FT protein, len: 445 aa; no Hp match. Contains probable FT N-terminal signal sequence and PS00017 ATP/GTP-binding site FT motif A (P-loop). Functional classification -Miscellaneous FT periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PC45" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34263.1" FT /translation="MKKILFIGSLVMASLLYAQGSQPVEITQQDINTQNEMSDASTKDI FT TPKSIEDFFEEFADNFGIEYGITKDGKTFYTGKSTVAVNDTDPQFAQALQNAYQKAMLN FT LQSEFIRDAFGRIATSKIQNYEADNSTNAKEFDELPKGDKVDQILNKLTQLAGAQLDKA FT LKDLGIDTNSLSEDRKKTLLKQEFLNKTMTNAIGSMSGLVPVQTIVTQRRGEYDVGVVA FT VISNKTRQLAKDMALARQSAIKGKGKAISEYLPKDTKGFLNEYGIRLVYDENGAPIILS FT YGNWGYVADPSNAKKTNILEDRAKETALTMADAAIIEFINTNLSLKDERTTGDTYEEII FT KQSINVNDSSTQEQTQNITNIIDKVNSKIKASASGKIRGIRTLKKWSYTSENGIEHVGA FT VRFYSYENLANTNEALNSKSNATKNEAKKSSSIQRSSNVVNSMDDF" FT sig_peptide 101410..101469 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000041_101410_102747 by SignalP 2.0 FT HMM (Signal peptide probability 0.988) with cleavage site FT probability 0.408 between residues 20 and 21" FT misc_feature 101605..101628 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 102757..103959 FT /transl_table=11 FT /locus_tag="Cj0093" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0093, probable periplasmic FT protein, len: 400 aa; no Hp match. Contains probable FT N-terminal signal sequence. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="GOA:Q0PC44" FT /db_xref="InterPro:IPR005534" FT /db_xref="UniProtKB/TrEMBL:Q0PC44" FT /protein_id="CAL34264.1" FT /translation="MKIIKILFLGLFLSLSLNAKVITTTSTKSSTGEGTGLTREDAINN FT AIIEAIGKMSGVSINSLKKSNTSVSTDNSGSNIQDNYSEQISKATKGRADTYEINSVEQ FT DANGKYTANVTIFKTTTTKKYQAPGLSADNRRSITVFDSTPDAAKRGIGSALQQKIISD FT LLQSRKFNVLDRDSSGYYEMEKALIKSGDAASDEVYKLKNMLATDYILLFSISGLEGKQ FT KTSNLTGKSKTEIEVIVDYRVLLFATRQIKFSNTLSMKVNLKDNSLSANETALKQIANR FT IAGDILNAIYPLKVASVENNEVIFSQSLNQGDVYECFALGKVIKDTYTKENTGRVESKT FT GSIEITRTSPKFSYAKITEGSVKVGDICRPLSNTGSGNGYTIGRDANYQTQEGGGVNLG FT F" FT sig_peptide 102757..102819 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000042_102757_103959 by SignalP 2.0 FT HMM (Signal peptide probability 0.992) with cleavage site FT probability 0.294 between residues 21 and 22" FT CDS 104118..104426 FT /transl_table=11 FT /gene="rplU" FT /locus_tag="Cj0094" FT /product="50S ribosomal protein L21" FT /note="Original (2000) note: Cj0094, rplU, 50S ribosomal FT protein L21, len: 102 aa; similar to many e.g. RL21_ECOLI FT 50S ribosomal protein L21 (103 aa), fasta scores; opt: 268 FT z-score: 457.7 E(): 3.1e-18, 40.8% identity in 103 aa FT overlap. 58.8% identity to HP0296. Contains PS01169 FT Ribosomal protein L21 signature and Pfam match to entry FT PF00829 Ribosomal_L21p, Ribosomal prokaryotic L21 FT protein,score 152.80, E-value 5.7e-42" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Ribosomal protein synthesis and FT modification" FT /note="PMID:378941, 8312607" FT /db_xref="GOA:Q0PC43" FT /db_xref="InterPro:IPR001787" FT /db_xref="InterPro:IPR018258" FT /db_xref="UniProtKB/Swiss-Prot:Q0PC43" FT /inference="protein motif:Pfam:PF00829" FT /inference="protein motif:Prosite:PS01169" FT /protein_id="CAL34265.1" FT /translation="MYAIIKHSGKQYKVSVGDELKLDHFEAESKASIEVSEVLAINDKE FT LKVGAPFVAGAKVVLEVINHGKDKKVVIYKKRRRKDSKLKRGFRRQFTRVVVKDIKA" FT misc_feature 104118..104402 FT /note="HMMPfam hit to PF00829, Ribosomal prokaryotic L21 FT protein, score 3.6e-48" FT /inference="protein motif:Pfam:PF00829" FT misc_feature 104328..104396 FT /note="PS01169 Ribosomal protein L21 signature" FT /inference="protein motif:Prosite:PS01169" FT CDS 104437..104691 FT /transl_table=11 FT /gene="rpmA" FT /locus_tag="Cj0095" FT /product="50S ribosomal protein L27" FT /note="Original (2000) note: Cj0095, rpmA, 50S ribosomal FT protein L27, len: 84 aa; highly similar to meny e.g. FT RL27_ECOLI 50S ribosomal protein L27 (84 aa), fasta scores; FT opt: 334 z-score: 627.0 E(): 1.1e-27, 65.4% identity in 81 FT aa overlap. 85.2% identity to HP0297. Contains PS00831 FT Ribosomal protein L27 signature and Pfam match to entry FT PF01016 Ribosomal_L27, Ribosomal L27 protein, score 189.40, FT E-value 5.5e-53" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Ribosomal protein synthesis and FT modification" FT /note="PMID:8312607" FT /db_xref="GOA:Q9PJ31" FT /db_xref="InterPro:IPR001684" FT /db_xref="InterPro:IPR018261" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ31" FT /inference="protein motif:Pfam:PF01016" FT /inference="protein motif:Prosite:PS00831" FT /protein_id="CAL34266.1" FT /translation="MAHKKGQGSTQNNRDSIGRRLGVKKFGGEFVRAGNIIIRQRGTAT FT HAGNNVGMGKDHTIFALIDGFVKFERKDKDRKKVSVYPA" FT misc_feature 104440..104682 FT /note="HMMPfam hit to PF01016, Ribosomal L27 protein,score FT 3.7e-54" FT /inference="protein motif:Pfam:PF01016" FT misc_feature 104536..104580 FT /note="PS00831 Ribosomal protein L27 signature" FT /inference="protein motif:Prosite:PS00831" FT stem_loop 104722..104783 FT CDS 104798..105850 FT /transl_table=11 FT /locus_tag="Cj0096" FT /product="GTP-binding protein" FT /note="Original (2000) note: Cj0096, probable GTP-binding FT protein, len: 350 aa; simlar to many members of the FT GTP1/OBG family e.g. OBG_BACSU spo0B-associated GTP-binding FT protein (428 aa), fasta scores; opt: 920 z-score: 1171.0 FT E(): 0, 43.0% identity in 342 aa overlap. 55.4% identity to FT HP0303. Also similar in part to Cj0930 (27.1% identity in FT 210 aa overlap). Contains PS00017 ATP/GTP-binding site FT motif A (P-loop), PS00905 GTP1/OBG family signature and FT Pfam match to entry PF01018 GTP1_OBG,GTP1/OBG family, score FT 281.40, E-value 1.2e-80" FT /note="Updated (2006) note: Charactersation work carried FT out within Bacillus subtilis with acceptable identity FT scores. Putative kept within product function. Functional FT classification - Conserved hypothetical proteins" FT /note="PMID:2537815" FT /db_xref="GOA:Q0PC41" FT /db_xref="InterPro:IPR006073" FT /db_xref="InterPro:IPR006074" FT /db_xref="InterPro:IPR006169" FT /db_xref="InterPro:IPR014100" FT /db_xref="UniProtKB/Swiss-Prot:Q0PC41" FT /inference="protein motif:Pfam:PF01018" FT /inference="protein motif:Prosite:PS00905" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34267.1" FT /translation="MFIDSVKITLASGDGGKGAVSFRREKHVPLGGPDGGDGGNGGDII FT FVCDNNTHTLVNFKGKRELRAQNGAGGMGRNKNGKKGENLELIVPEGTQVIDAQTNEIL FT LDLTKEGQRELFLKGGKGGLGNTHFKHATNQRPDYAQPGIKGESRLVRLELKLIADVGL FT VGFPNVGKSTLISVVSNAKPEIANYEFTTLTPKLGLVDVNEYNSFVMADIPGIIEGASG FT GKGLGLAFLKHIERTSFLLFVLDPMRQMPLKEQFIVLRKELEKFSNELFGRKFGIMISK FT SDSVRLGEEFAEQIALNINELDNYLKEINNPQSFLIKVSSLEKTGLKELKFMLLEEIKT FT LRNNKKNLTI" FT misc_feature 104801..105268 FT /note="HMMPfam hit to PF01018, GTP1/OBG, score 2.7e-75" FT /inference="protein motif:Pfam:PF01018" FT misc_feature 105272..105646 FT /note="HMMPfam hit to PF01926, GTPase of unknown FT function,score 2.7e-33" FT /inference="protein motif:Pfam:PF01926" FT misc_feature 105290..105313 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 105431..105472 FT /note="PS00905 GTP1/OBG family signature" FT /inference="protein motif:Prosite:PS00905" FT CDS 105955..106710 FT /transl_table=11 FT /gene="proB" FT /locus_tag="Cj0097" FT /product="glutamate 5-kinase" FT /EC_number="2.7.2.11" FT /note="Original (2000) note: Cj0097, proB, possible FT glutamate 5-kinase, len: 251 aa; similar to, but shorter FT than, many e.g. PROB_BACSU glutamate 5-kinase (EC 2.7.2.11) FT (365 aa), fasta scores; opt: 502 z-score: 752.8 E(): 0, FT 37.1% identity in 232 aa overlap" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis and Escherichia coli with acceptable identity FT scores. Appropriate motifs were also identified. FT Thus,putative removed from product function. Functional FT classification - Amino acid biosynthesis - Glutamate FT family" FT /note="PMID:8083159, PMID:2841193, PMID:15502337" FT /db_xref="GOA:Q9PJ29" FT /db_xref="InterPro:IPR001048" FT /db_xref="InterPro:IPR001057" FT /db_xref="InterPro:IPR005715" FT /db_xref="InterPro:IPR011529" FT /db_xref="InterPro:IPR019797" FT /db_xref="PDB:2AKO" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ29" FT /protein_id="CAL34268.1" FT /translation="MKRIVVKVGSHVISEENTLSFERLKNLVAFLAKLMEKYEVILVTS FT AAISAGHTKLDIDRKNLINKQVLAAIGQPFLISVYNELLAKFNKLGGQILLTGKDFDSR FT KATKHAKNAIDMMINLGILPIINENDATAIEEIVFGDNDSLSAYATHFFDADLLVILSD FT IDGFYDKNPSEFSDAKRLEKITHIKEEWLQATIKTGSEHGTGGIVTKLKAAKFLLEHNK FT KMFLASGFDLSVAKTFLLEDKQIGGTLFE" FT misc_feature 105958..106638 FT /note="HMMPfam hit to PF00696, Amino acid kinase FT family,score 1e-41" FT /inference="protein motif:Pfam:PF00696" FT CDS 106784..107701 FT /transl_table=11 FT /gene="fmt" FT /locus_tag="Cj0098" FT /product="methionyl-tRNA formyltransferase" FT /EC_number="2.1.2.9" FT /note="Original (2000) note: Cj0098, fmt, probable FT methionyl-tRNA formyltransferase, len: 305 aa; similar to FT many e.g.FMT_ECOLI methionyl-tRNA formyltransferase (EC FT 2.1.2.9) (314 aa), fasta scores; opt: 628 z-score: 634.5 FT E(): 4.4e-28, 37.5% identity in 304 aa overlap. Contains FT Pfam match to entry PF00551 formyl_transf, Formyl FT transferase, score 133.00, E-value 3.7e-37. 51.7% identity FT to HP1141" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Aminoacyl tRNA synthetases and their FT modification" FT /note="PMID:1624424" FT /db_xref="GOA:Q9PJ28" FT /db_xref="InterPro:IPR001555" FT /db_xref="InterPro:IPR002376" FT /db_xref="InterPro:IPR005793" FT /db_xref="InterPro:IPR005794" FT /db_xref="InterPro:IPR011034" FT /db_xref="InterPro:IPR015518" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ28" FT /inference="protein motif:Pfam:PF00551" FT /protein_id="CAL34269.1" FT /translation="MKKIIFMGTPSYATCILKALVENENFKLVALFTQPDKAVGRKQIL FT TPSDTKAFLSQNYPSIPIFTPSSLKDKNIIREIKDLNPDFIVVAAYGKILPKAILDLAP FT CVNLHASLLPKYRGASPIQSAILNKDEKSGVCTMLMEEGLDTGAILESLECDIKDKNSS FT EVFELLANLAAKIILSTLLNFDKITPKKQEESLATLCRKIKKEDGLINLQNARELYQKY FT LAFTPWPGVFLENGLKFLELELVDELKQNAKMGEILELEKESFLLACKQGVLRIKKLQE FT SGKKALDGRTYLNGKRLKSEDSLC" FT misc_feature 106787..107326 FT /note="HMMPfam hit to PF00551, Formyl transferase, score FT 4.4e-36" FT /inference="protein motif:Pfam:PF00551" FT misc_feature 107393..107674 FT /note="HMMPfam hit to PF02911, Formyl FT transferase,C-terminal domain, score 8e-24" FT /inference="protein motif:Pfam:PF02911" FT CDS 107664..108317 FT /transl_table=11 FT /gene="birA" FT /locus_tag="Cj0099" FT /product="putative biotin--[acetyl-CoA-carboxylase] FT synthetase" FT /EC_number="6.3.4.15" FT /note="Original (2000) note: Cj0099, birA, possible FT biotin--[acetyl-CoA-carboxylase] synthetase, len: 217 aa; FT weak similarity to e.g. SW:BIRA_BACSU P42975 birA FT bifunctional protein (biotin operon repressor) FT (biotin--[acetyl-CoA-carboxylase] synthetase) (EC FT 6.3.4.15)(325 aa), blastp scores; E= 0.00011, 21% identity FT in 163 aa overlap; similarity does not include DNA-binding FT domain. 39.0% identity to HP1140" FT /note="Updated (2006) note: Pfam domain PF03099 FT Biotin/lipoate A/B protein ligase family identified within FT CDS. Further support given to product function. Specific FT characterisation with acceptable identity scores not yet FT carried out. Thus, putative kept within product function. FT Functional classification - Biosynthesis of FT cofactors,prosthetic groups and carriers - Biotin" FT /db_xref="GOA:Q0PC38" FT /db_xref="InterPro:IPR004143" FT /db_xref="InterPro:IPR004408" FT /db_xref="UniProtKB/TrEMBL:Q0PC38" FT /inference="protein motif:Pfam:PF03099" FT /protein_id="CAL34270.1" FT /translation="MEKGLKVKIVCVESIDSTHLFLCKQIRNGKIDENFAIYALEQING FT VGSRENSWQSSKGNLHLSFCIKEEDLPKDLPLASVSIYFAYLLKEVLQEKGSKIWLKWP FT NDLYLDDKKAGGVISAKISNFIIGGMGLNLKFAPQNTALCDIEISLKDLVSEFLQKVEK FT KILWKNIFSKYMLEFEKSRKFSVHHEGKVFSLENSFLYEDGSILLGDKRVYSLR" FT misc_feature 107694..108083 FT /note="HMMPfam hit to PF03099, Biotin/lipoate A/B protein FT ligase famil, score 2e-13" FT /inference="protein motif:Pfam:PF03099" FT CDS 108314..109099 FT /transl_table=11 FT /locus_tag="Cj0100" FT /product="parA family protein" FT /note="Original (2000) note: Cj0100, putative parA family FT protein, len: 261 aa; similar to members of the parA family FT e.g. SOJ_BACSU soj protein (253 aa) fasta scores; opt: 762 FT z-score: 1251.6 E(): 0, 46.3% identity in 259 aa overlap. FT 61.1% identity to HP1139. Contains Pfam match to entry FT PF00991 ParA, ParA family ATPase, score 118.40,E-value FT 1.3e-31" FT /note="Updated (2006) note: Pfam domain PF01656 FT CobQ/CobB/MinD/ParA nucleotide binding domain identified FT within CDS. This family consists of putative cobyrinic acid FT a,c-diamide synthases family protein. Some characterisation FT work within Bacillus subtilis with acceptable identity FT score. Putative not added to product function. Functional FT classification - Cell division" FT /note="PMID:8071208" FT /db_xref="InterPro:IPR002586" FT /db_xref="UniProtKB/TrEMBL:Q0PC37" FT /inference="protein motif:Pfam:PF01656" FT /inference="protein motif:Pfam:PF00991" FT /protein_id="CAL34271.1" FT /translation="MSEIITIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDVDPQANA FT TTGLGFNRNNYEYNIYHVFIGRKKLSDIILKTELPQLHLAPSNIGLVGIEQELAKGENN FT EKKMLLKNQIQEVIDEYDFIIIDSPPALGSITINAFAASDSVIIPIQCEFYALEGVAMV FT LNTIKIIKKTINSKLRVRGFLPTMYSSQNNLSKDVVDDLKQNFKKQLFTINGNEDDFIV FT IPRNVKLAESPSFGKPIILYDIKSPGSVAYQNLAYSILG" FT misc_feature 108326..109006 FT /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA FT nucleotide binding domai, score 9.4e-53" FT /inference="protein motif:Pfam:PF01656" FT CDS 109105..109941 FT /transl_table=11 FT /locus_tag="Cj0101" FT /product="parB family protein" FT /note="Original (2000) note: Cj0101, putative parB family FT protein, len: 278 aa; similar to members of the parB family FT e.g.SP0J_BACSU stage 0 sporulation protein J (282 aa), FT fasta scores; opt: 563 z-score: 842.8 E(): 0, 36.1% FT identity in 288 aa overlap. 41.7% identity to HP1138 FT plasmid replication-partition related protein. Contains FT helix-turn-helix motif (Score 1486, +4.25 SD)" FT /note="Updated (2006) note: Pfam domain PF02195 ParB-like FT nuclease domain identified within CDS. Some FT characterisation within Bacillus subtilis with acceptable FT identity score. Putative not added to product function. FT Functional classification - Cell division" FT /note="PMID:1900505, PMID:8071208" FT /db_xref="GOA:Q9PJ25" FT /db_xref="InterPro:IPR003115" FT /db_xref="InterPro:IPR004437" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ25" FT /inference="protein motif:Pfam:PF02195" FT /protein_id="CAL34272.1" FT /translation="MGLNKDRGLSSLISDMDTVYSKELGFDKNQSTMIEIDQISPNPFQ FT PRKNFDQEALDELANSIKEFGLIQPIIVFKKNNKFILIAGERRLRAVKALGKKEILAFI FT ADIDENKLRELALIENIQRENLNPIELANSYKDLMQVHKITQENLAELIHKSRTQITNT FT LRLLNLDIRTQELIASGKISQGHAKVLVGLDQKDEKMLVDSIIGQKLNVRDTEKIVKKI FT KNNESLPNQEFEDEIKKLKQILNRFGFDCKNKNNDFVIHLENIDKIKKLIKMLEKL" FT misc_feature 109198..109467 FT /note="HMMPfam hit to PF02195, ParB-like nuclease FT domain,score 2.7e-34" FT /inference="protein motif:Pfam:PF02195" FT CDS 110002..110427 FT /transl_table=11 FT /gene="atpF" FT /locus_tag="Cj0102" FT /product="ATP synthase F0 sector B' subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0102, atpF', probable ATP FT synthase F0 sector B' subunit, len: 141 aa; some similarity FT to e.g. ATPF_BACP3 ATP synthase B chain precursor (EC FT 3.6.1.34) (163 aa), fasta scores; opt: 160 z-score: 227.5 FT E(): 2e-05, 20.9% identity in 129 aa overlap. 25.4% FT identity to HP1137. Contains Pfam match to entry PF00430 FT ATP-synt_B, ATP synthase B/B' CF(0), score 42.80, E-value FT 6.3e-11" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however identity scores were marginal. FT Appropriate motifs were identified. Putative not added to FT product function. Functional classification - Energy FT metabolism - ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:9614129,PMID:11768298, PMID:7961438" FT /db_xref="GOA:Q0PC35" FT /db_xref="InterPro:IPR002146" FT /db_xref="UniProtKB/TrEMBL:Q0PC35" FT /inference="protein motif:Pfam:PF00430" FT /protein_id="CAL34273.1" FT /translation="MFEDMHPSIMLATMAIFLAMIVILNSMLYKPLLKFMDERNDSIKN FT DENKVKENSQEVLGVNDELEAIHINTREEIQKIKQSAIAAAKEEAEQILRSKKEELERK FT MASFYADLAVQKKELQEHLNIHLSELKQALQNNIKKI" FT misc_feature 110026..110418 FT /note="HMMPfam hit to PF00430, ATP synthase B/B' FT CF(0),score 1.5e-06" FT /inference="protein motif:Pfam:PF00430" FT misc_feature 110029..110088 FT /note="1 probable transmembrane helix predicted for Cj0102 FT by TMHMM2.0 at aa 10-29" FT /inference="protein motif:TMHMM:2.0" FT CDS 110438..110950 FT /transl_table=11 FT /gene="atpF" FT /locus_tag="Cj0103" FT /product="ATP synthase F0 sector B subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0103, atpF, probable ATP FT synthase F0 sector B subunit, len: 170 aa; some similarity FT to e.g. ATPF_ENTHR ATP synthase B chain (EC 3.6.1.34) (174 FT aa), fasta scores; opt: 165 z-score: 246.4 E(): FT 1.8e-06,27.5% identity in 131 aa overlap. 31.9% identity to FT HP1136" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however identity scores were marginal. FT Appropriate motifs were identified. Putative not added to FT product function. Functional classification - Energy FT metabolism - ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:9614129,PMID:11768298, PMID:7961438" FT /db_xref="GOA:Q0PC34" FT /db_xref="InterPro:IPR002146" FT /db_xref="UniProtKB/TrEMBL:Q0PC34" FT /protein_id="CAL34274.1" FT /translation="MSKLFFIIFLLPLYAFGASNGSGEYDIIPRTINFLIFVAILYYFV FT ATPFKNFYKNRIVKISSKLDEIQKKLLESKAKKLDTMKKLEEAKASAAAALITAKKEAE FT ILVQNIKKETQDELDLLQKHFEEQKDYEFRKMEKELVSNTLNEIFSDPNMTLKQSEIIE FT LMMKKVS" FT sig_peptide 110438..110488 FT /note="Signal peptide predicted for atpF by SignalP 2.0 HMM FT (Signal peptide probability 0.903) with cleavage site FT probability 0.564 between residues 17 and 18" FT misc_feature order(110450..110503,110516..110584) FT /note="2 probable transmembrane helices predicted for FT Cj0103 by TMHMM2.0 at aa 5-22 and 27-49" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 110513..110923 FT /note="HMMPfam hit to PF00430, ATP synthase B/B' FT CF(0),score 0.00034" FT /inference="protein motif:Pfam:PF00430" FT CDS 110953..111474 FT /transl_table=11 FT /gene="atpH" FT /locus_tag="Cj0104" FT /product="ATP synthase F1 sector delta subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0104, atpH, probable ATP FT synthase F1 sector delta subunit, len: 173 aa; similar to FT e.g. ATPD_ECOLI ATP synthase delta chain (EC 3.6.1.34) (177 FT aa), fasta scores; opt: 135 z-score: 234.1 E(): 8.8e-06, FT 27.6% identity in 145 aa overlap. No Hp match. Contains FT Pfam match to entry PF00213 OSCP, ATP synthase delta (OSCP) FT subunit, score 53.70, E-value 8.2e-15" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however identity scores were marginal. FT Appropriate motifs were identified. Putative not added to FT product function. Functional classification - Energy FT metabolism - ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:7957212,PMID:11768298, PMID:7961438" FT /db_xref="GOA:Q0PC33" FT /db_xref="InterPro:IPR000711" FT /db_xref="UniProtKB/Swiss-Prot:Q0PC33" FT /inference="protein motif:Pfam:PF00213" FT /protein_id="CAL34275.1" FT /translation="MENIIARRYAKAIASRADINDFYQNLCILNSAFVLPKFKNIIESN FT EIKKERKMEFLDSFFDIKNSSFQNFLRLLIENSRLECIPQIVKELERQKAFKENIFVGI FT VYSKEKLSQENLKDLEVKLNKKFDANIKLNNKISQDDSVKIELEELGYELSFSMKALQN FT KLNEYILKII" FT misc_feature 110965..111414 FT /note="HMMPfam hit to PF00213, ATP synthase delta (OSCP) FT subunit, score 1.1e-07" FT /inference="protein motif:Pfam:PF00213" FT CDS 111488..112993 FT /transl_table=11 FT /gene="atpA" FT /locus_tag="Cj0105" FT /product="ATP synthase F1 sector alpha subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0105, atpA, probable ATP FT synthase F1 sector alpha subunit, len: 501 aa; similar to FT e.g. ATPA_ENTHR ATP synthase alpha chain (EC 3.6.1.34) (518 FT aa), fasta scores; opt: 2114 z-score: 2501.4 E(): 0,64.4% FT identity in 497 aa overlap. 75.0% identity to HP1134. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop), FT PS00152 ATP synthase alpha and beta subunits signature and FT Pfam matches to entry PF00006 ATP-synt_ab,ATP synthase FT alpha and beta subunits, score 643.10,E-value 1.5e-189 and FT to entry PF00422 ATP-synt_A-c, ATP synthase Alpha chain, C FT terminal, score 277.50, E-value 7.6e-94" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however identity score was marginal. FT Also, characterised within Enterococcus hirae with FT acceptable identity score. Appropriate motifs were FT identified. Putative not added to product function. FT Functional classification - Energy metabolism - ATP-proton FT motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:11768298,PMID:1328152, PMID:7961438" FT /db_xref="GOA:Q9PJ21" FT /db_xref="InterPro:IPR000194" FT /db_xref="InterPro:IPR000793" FT /db_xref="InterPro:IPR004100" FT /db_xref="InterPro:IPR005294" FT /db_xref="InterPro:IPR018118" FT /db_xref="InterPro:IPR020003" FT /db_xref="InterPro:IPR023366" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ21" FT /inference="protein motif:Pfam:PF00422" FT /inference="protein motif:Pfam:PF00006" FT /inference="protein motif:Prosite:PS00152" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34276.1" FT /translation="MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLK FT NIMAGEMVEFENGDKGMALNLEESSVGIVILGKGEGLKEGASVKRLKKLLKVPVGEALI FT GRVVNALGEPIDAKGVINANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQ FT RELIIGDRQTGKTTVAVDTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTI FT VVNAGASDPAALQYLAPYTGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPP FT GREAYPGDVFYLHSRLLERASKLNDELGAGSLTALPIIETQAGDVSAYIPTNVISITDG FT QIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFA FT SDLDEASRKQLERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIKEFED FT GIYPFIEAKHPDIFEQIRSKKALDSDLEEKLAKAINEFKANHL" FT misc_feature 111557..111763 FT /note="HMMPfam hit to PF02874, ATP synthase alpha/beta FT family, beta-ba, score 7.9e-19" FT /inference="protein motif:Pfam:PF02874" FT misc_feature 111929..112579 FT /note="HMMPfam hit to PF00006, ATP synthase alpha/beta FT family, nucleot, score 3.4e-115" FT /inference="protein motif:Pfam:PF00006" FT misc_feature 111992..112015 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 112550..112579 FT /note="PS00152 ATP synthase alpha and beta subunits FT signature" FT /inference="protein motif:Prosite:PS00152" FT misc_feature 112613..112927 FT /note="HMMPfam hit to PF00306, ATP synthase alpha/beta FT chain, C termin, score 2.5e-36" FT /inference="protein motif:Pfam:PF00306" FT CDS 113002..113886 FT /transl_table=11 FT /gene="atpG" FT /locus_tag="Cj0106" FT /product="ATP synthase F1 sector gamma subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0106, atpG, probable ATP FT synthase F1 sector gamma subunit, len: 294 aa; similar to FT e.g. ATPG_BACSU ATP synthase gamma chain (EC 3.6.1.34) (290 FT aa), fasta scores; opt: 537 z-score: 747.6 E(): 0,33.6% FT identity in 295 aa overlap. 52.8% identity to HP1133. FT Contains Pfam match to entry PF00231 ATP-synt, ATP FT synthase, score 282.80, E-value 4.3e-81" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity scores. Appropriate FT motifs were identified. Putative not added to product FT function. Functional classification - Energy metabolism FT -ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:11768298,PMID:7961438" FT /db_xref="GOA:Q9PJ20" FT /db_xref="InterPro:IPR000131" FT /db_xref="InterPro:IPR023633" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ20" FT /inference="protein motif:Pfam:PF00231" FT /protein_id="CAL34277.1" FT /translation="MSNLKEIKRKIKSVHNTQKTTNAMKLVSTAKLKKAEEAAKRSKIY FT AQKIDEILSEISFQINKIVHNEDDVRLSLFHKKEQIKTVDLIFITADKGLCGGFNIKTL FT KTVSEMLKEYEAKNINIRLRAIGKTGIEYFNFQKIELLEKYFHLSSSPDYEKACEVIHA FT AVDDFLNGNTDEVILVHNGYKNMITQELKINHLIPVEPKSIEQTHNSLLELEPEGTELL FT KDLMKTYFEYNMYYALIDSLAAEHSARMQAMDNATNNAKARVKQLNLAYNKARQESITT FT ELIEIISGVESMK" FT misc_feature 113005..113880 FT /note="HMMPfam hit to PF00231, ATP synthase, score 2.8e-83" FT /inference="protein motif:Pfam:PF00231" FT CDS 113912..115309 FT /transl_table=11 FT /gene="atpD" FT /locus_tag="Cj0107" FT /product="ATP synthase F1 sector beta subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0107, atpD, probable ATP FT synthase F1 sector beta subunit, len: 465 aa; highly FT similar to many e.g. ATPB_WOLSU ATP synthase beta chain (EC FT 3.6.1.34) (467 aa), fasta scores; opt: 2558 z-score: 3132.1 FT E(): 0, 83.0% identity in 464 aa overlap. 79.5% identity to FT HP1132. Contains PS00017 ATP /GTP-binding site motif A FT (P-loop), PS00152 ATP synthase al pha and beta subunits FT signature and Pfam matches to entry P F00006 ATP-synt_ab, FT ATP synthase alpha and beta subunits, s core 604.00, FT E-value 9.1e-178 and to entry PF00306 ATP-synt _ab_C, ATP FT synthase ab C terminal, score 193.50, E-value 3. 4e-54" FT /note="Updated (2006) note: Characterised within Wolinella FT succinogenes with acceptable identity scores. Appropriate FT motifs were identified. Putative not added to product FT function. Functional classification - Energy metabolism FT -ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:11768298,PMID:7961438, PMID:8085791" FT /db_xref="GOA:Q0PC30" FT /db_xref="InterPro:IPR000194" FT /db_xref="InterPro:IPR000793" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR004100" FT /db_xref="InterPro:IPR005722" FT /db_xref="InterPro:IPR018118" FT /db_xref="InterPro:IPR020003" FT /db_xref="InterPro:IPR024034" FT /db_xref="UniProtKB/Swiss-Prot:Q0PC30" FT /inference="protein motif:Pfam:PF00306" FT /inference="protein motif:Prosite:PS00152" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34278.1" FT /translation="MQGFISQVLGPVVDVDFNDYLPQINEAIVVNFESEGKKHKLVLEV FT AAHLGDNRVRTIAMDMTDGLVRGLKAEALGAPISVPVGEKVLGRIFNVTGDLIDEGEEI FT SFDKKWAIHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIM FT ELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRI FT ALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGK FT FQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDP FT LDSTSRMLDPNIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLVVERARK FT IEKFLSQPFFVAEVFTGSPGKYISLEDTIAGFKGILEGKYDHLPENAFYMVGNIDEAIA FT KADKLKG" FT misc_feature 113924..114136 FT /note="HMMPfam hit to PF02874, ATP synthase alpha/beta FT family, beta-ba, score 4.3e-21" FT /inference="protein motif:Pfam:PF02874" FT misc_feature 114302..114946 FT /note="HMMPfam hit to PF00006, ATP synthase alpha/beta FT family, nucleot, score 1e-94" FT /inference="protein motif:Pfam:PF00006" FT misc_feature 114365..114388 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 114917..114946 FT /note="PS00152 ATP synthase alpha and beta subunits FT signature" FT /inference="protein motif:Prosite:PS00152" FT misc_feature 114983..115306 FT /note="HMMPfam hit to PF00306, ATP synthase alpha/beta FT chain, C termin, score 7.2e-55" FT /inference="protein motif:Pfam:PF00306" FT CDS 115313..115702 FT /transl_table=11 FT /gene="atpC" FT /locus_tag="Cj0108" FT /product="ATP synthase F1 sector epsilon subunit" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0108, atpC, probable ATP FT synthase F1 sector epsilon subunit, len: 129 aa; similar to FT many e.g. ATPE_BACME ATP synthase epsilon chain (EC FT 3.6.1.34) (134 aa), fasta scores; opt: 200 z-score: 337.5 FT E(): 1.5e-11, 32.4% identity in 108 aa overlap. 40.0% FT identity to HP1131. Contains Pfam match to entry PF00401 FT ATP-synt_DE, ATP synthase, Delta/Epsilon chain, score FT 84.00, E-value 4.2e-22" FT /note="Updated (2006) note: Characterised within Bacillus FT megaterium with acceptable identity scores. Appropriate FT motifs were identified. Putative not added to product FT function. Functional classification - Energy metabolism FT -ATP-proton motive force" FT /note="PMID:6278247, PMID:8276830, FT PMID:11768298,PMID:7961438, PMID:2894831" FT /db_xref="GOA:Q9PJ18" FT /db_xref="InterPro:IPR001469" FT /db_xref="InterPro:IPR020546" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ18" FT /inference="protein motif:Pfam:PF00401" FT /protein_id="CAL34279.1" FT /translation="MNDLINFEIVTPLGVIYQGEVKSVTLPGSEGEFGVLKGHAALVSS FT LKSGVIDIEKADLNHELIAIDAGHAKVDEDKICVLAKGAVWVCGSDESEIEKNLAQAKD FT LIKSMSSDNAALAATFSKLDNARMH" FT misc_feature 115322..115570 FT /note="HMMPfam hit to PF02823, ATP synthase, Delta/Epsilon FT chain, beta, score 2.6e-21" FT /inference="protein motif:Pfam:PF02823" FT CDS 115702..116256 FT /transl_table=11 FT /gene="exbB3" FT /locus_tag="Cj0109" FT /product="putative MotA/TolQ/ExbB proton channel family FT protein" FT /note="Original (2000) note: Cj0109, exbB3, probable FT exbB/tolQ family transport protein, len: 184 aa; similar to FT members of the exbB/tolQ family, e.g. EXBB_ECOLI biopolymer FT transport exbB protein (244 aa), fasta scores; opt: 208 FT z-score: 287.0 E(): 9.9e-09, 33.6% identity in 128 aa FT overlap, and TOLQ_ECOLI tolQ protein (230 aa),fasta scores; FT opt: 187 z-score: 280.1 E(): 2.4e-08, 48.4% identity in 62 FT aa overlap. 42.6% identity to HP1130. Also similar to FT Cj0179 (30.6% identity in 186 aa overlap) and Cj1628 (44.4% FT identity in 81 aa overlap)" FT /note="Updated (2006) note: Pfam domain FT PF01618,MotA/TolQ/ExbB proton channel family identified FT within CDS. Product modified to more specific family member FT due to motif match. No specific characterisation has been FT carried out yet. Thus, putative kept within product FT function. Functional classification - Transport/binding FT proteins - Other" FT /note="PMID:8437515, PMID:9371459" FT /db_xref="GOA:Q0PC28" FT /db_xref="InterPro:IPR002898" FT /db_xref="InterPro:IPR017269" FT /db_xref="UniProtKB/TrEMBL:Q0PC28" FT /inference="protein motif:Pfam:PF01618" FT /protein_id="CAL34280.1" FT /translation="MNFEAIFHFFNSSSIITYIVLLWLSLYFILAFSILFARLTYLATW FT RNKEKESLETLLLGEKDLSRTDSILRKCNDTTSNHLEIYKNLASRRASAGLTWLSIIAS FT TSPFIGLFGTVISILETFGGLGTQNSLSIIAPKISEALVATGCGILVAIPAYTFHLIIK FT RKAFELLSIIDSEIKVISSSK" FT misc_feature order(115744..115812,115987..116055,116113..116181) FT /note="3 probable transmembrane helices predicted for FT Cj0109 by TMHMM2.0 at aa 15-37, 96-118 and 138-160" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 115837..116235 FT /note="HMMPfam hit to PF01618, MotA/TolQ/ExbB proton FT channel family, score 1e-24" FT /inference="protein motif:Pfam:PF01618" FT CDS 116265..116654 FT /transl_table=11 FT /gene="exbD3" FT /locus_tag="Cj0110" FT /product="putative exbD/tolR family transport protein" FT /note="Original (2000) note: Cj0110, exbD3, probable FT exbD/tolR family transport protein, len: 129 aa; similar to FT members of the exbD/tolR family, e.g. EXBD_ECOLI biopolymer FT transport exbD protein (141 aa), fasta scores; opt: 225 FT z-score: 240.1 E(): 4e-06, 31.1% identity in 132 aa FT overlap, and TOLR_ECOLI tolR protein (142 aa), fasta FT scores; opt: 191 z-score: 240.1 E(): 4.1e-06, 27.7% FT identity in 130 aa overlap. 46.8% identity to HP1129. Also FT similar to Cj0180 (34.1% identity in 126 aa overlap) and FT Cj1629 (26.4% identity in 121 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF02472 Biopolymer FT transport protein ExbD/TolR identified within CDS. Further FT support given to product function. No specific FT characterisation with acceptable identity scores were FT identified. Thus, putative kept within product function. FT Functional classification - Transport/binding proteins FT -Other" FT /note="PMID:9371459" FT /db_xref="GOA:Q0PC27" FT /db_xref="InterPro:IPR003400" FT /db_xref="UniProtKB/TrEMBL:Q0PC27" FT /inference="protein motif:Pfam:PF02472" FT /protein_id="CAL34281.1" FT /translation="MPFDDEKPELNITPLVDIMLVLLAILMVTAPSITYEEKINLPQGS FT QKNTSTPTVKSLIISINAKKEIFLNQEKYDFISFADNLAQRKAQFNTEDPVFIRADKSL FT KYDDVISVLRSVKNLGFNKVALQTE" FT misc_feature 116271..116651 FT /note="HMMPfam hit to PF02472, Biopolymer transport protein FT ExbD/TolR, score 7.2e-16" FT /inference="protein motif:Pfam:PF02472" FT misc_feature 116292..116360 FT /note="1 probable transmembrane helix predicted for Cj0110 FT by TMHMM2.0 at aa 10-32" FT /inference="protein motif:TMHMM:2.0" FT CDS 116657..117436 FT /transl_table=11 FT /locus_tag="Cj0111" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0111, possible periplasmic FT protein, len: 259 aa; no Hp match. Contains possible FT N-terminal signal sequence" FT /note="Updated (2006) note: Literature search identified FT paper (PMID:15231804) suggesting a number of differentially FT expressed genes (e.g. Cj0111) in microarray experiments may FT be co-trasncribed. Cj0111 seems to be iron induced and FT based on RT-PCR seems to be co-transcribed with Cj1658. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /note="PMID:15231804" FT /db_xref="UniProtKB/TrEMBL:Q0PC26" FT /protein_id="CAL34282.1" FT /translation="MKNYGLSNLNSFLLALAIYISIVILVFFRLVSEVEPAIQYTDIKD FT SFVDIELAEPSKQVITQSNTPKEIQKPTEQIDIEKLFAQTTNKTVKTEDIDQKASNFNE FT LFGNIKEIQEEKTTKIQSSAKSGISSAPKPQASELVKQLNDSLLQEESSTQGESTKAQK FT IGIYDEFLGKVVRIITQRWTQYYPNSEKISVKVKIFIDENGKFGYTSVEKSGNPLYDAK FT VAEFLESQKGKFITYPPQNKNISITMNLRDEVKVKND" FT sig_peptide 116657..116758 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000046_116657_117436 by SignalP 2.0 FT HMM (Signal peptide probability 0.888) with cleavage site FT probability 0.573 between residues 34 and 35" FT misc_feature 116681..116749 FT /note="1 probable transmembrane helix predicted for Cj0111 FT by TMHMM2.0 at aa 9-31" FT /inference="protein motif:TMHMM:2.0" FT CDS 117446..118654 FT /transl_table=11 FT /gene="tolB" FT /locus_tag="Cj0112" FT /product="putative TolB precursor protein" FT /note="Original (2000) note: Cj0112, probable periplasmic FT protein, len: 402 aa; some similarity to TOLB_HAEIN P44677 FT tolB protein precursor (427 aa), blastp scores; E= 3.1e-09, FT 23% identity in 259 aa overlap. 41.0% identity to HP1126" FT /note="Updated (2006) note: Pfam domain PF04052 TolB FT amino-terminal domain identified within CDS. Further FT support given to product function. Characterisation has FT been carried out within Escherichia coli, however,identity FT score was not acceptable. Thus, putative kept within FT product function. Functional classification -Miscellaneous FT periplasmic proteins" FT /note="PMID:2687247, PMID:7929011, PMID:9761825" FT /db_xref="GOA:Q9PJ14" FT /db_xref="InterPro:IPR011659" FT /db_xref="InterPro:IPR014167" FT /db_xref="InterPro:IPR015943" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ14" FT /inference="protein motif:Pfam:PF04052" FT /protein_id="CAL34283.1" FT /translation="MKKIVAIFLVFLGSLWAEDPVIDVVNSGVVLPKIIVKDNSNLSDE FT NLKKSFYNIIVNDLKVSSNFEVVANATETSNYIFEYTLNKNGNTLSLNVKIKAGGSDKS FT EQTYTLNGLEQYPFLAHKSVKASVNALGLAPVDWMDHKILIARNSSSKKSQIIMADYTL FT TYQKVIVDGGLNLFPKWGNKEQTLFYYTAYDHDKPTLYRYDLNTNKASKILSSGGMVVA FT SDVNVDGSKLLVTMAPKDQPDVYLYDLNTKNLTQLTNYSGIDVNGNFIGSDDSKVVFVS FT DRLGYPNIFMQDLNSNSAEQVVFHGRNNSAVSTYKDFLVYSSREPNQAGVFNIYLMSIN FT SDYIRQLTANGKNLFPRFSSDGGSIVFIKYLGAQSALGVIRVNANKTFYFPLRVGKIQS FT IDW" FT sig_peptide 117446..117496 FT /note="Signal peptide predicted for tolB by SignalP 2.0 HMM FT (Signal peptide probability 0.904) with cleavage site FT probability 0.791 between residues 17 and 18" FT misc_feature 117455..117889 FT /note="HMMPfam hit to PF04052, TolB amino-terminal FT domain,score 4e-51" FT /inference="protein motif:Pfam:PF04052" FT misc_feature 118589..118621 FT /note="PS00284 Serpins signature" FT /inference="protein motif:Prosite:PS00284" FT CDS 118731..119228 FT /transl_table=11 FT /gene="pal" FT /locus_tag="Cj0113" FT /product="peptidoglycan associated lipoprotein (omp18)" FT /note="Original (2000) note: Cj0113, pal, peptidoglycan FT associated lipoprotein (omp18), len: 165 aa; identical to FT TR:Q46123 (EMBL:X83374) precursor of peptidoglycan FT associated lipoprotein (165 aa), almost identical to FT TR:Q46099 omp18 (165 aa) (93.9% identity). Similar to e.g. FT PAL_ECOLI peptidoglycan-associated lipoprotein precursor FT (173 aa), fasta scores; opt: 322 z-score: 491.5 E(): 4e-20, FT 38.5% identity in 169 aa overlap. 42.2% identity (in 109 aa FT overlap) to HP1125. Contains N-terminal signal sequence FT with appropriately positioned PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site and Pfam match to entry FT PF00691 OmpA, OmpA family, score 100.60, E-value 3.2e-26" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni (PMID:8576327). Putative not added to FT product function. Functional classification - FT Membranes,lipoproteins and porins" FT /note="PMID:8576327" FT /db_xref="GOA:Q46123" FT /db_xref="HSSP:1OAP" FT /db_xref="InterPro:IPR006664" FT /db_xref="InterPro:IPR006665" FT /db_xref="InterPro:IPR014169" FT /db_xref="UniProtKB/TrEMBL:Q46123" FT /inference="protein motif:Pfam:PF00691" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34284.1" FT /translation="MKKILFTSIAALAVVISGCSTKSTSVSGDSSVDSNRGSGGSDGWD FT IDSKISQLNDTLNKVYFDFDKFNIRPDMQNVVSTNANIFNTEVSGVSITVEGNCDEWGT FT DEYNQALGLKRAKAVKEALIAKGVNADRIAVKSYGETNPVCTEKTKACDAQNRRAEFKL FT SR" FT sig_peptide 118731..118814 FT /note="Signal peptide predicted for pal by SignalP 2.0 HMM FT (Signal peptide probability 1.000) with cleavage site FT probability 0.827 between residues 28 and 29" FT misc_feature 118755..118787 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 118911..119201 FT /note="HMMPfam hit to PF00691, OmpA family, score 2.1e-27" FT /inference="protein motif:Pfam:PF00691" FT CDS 119232..120179 FT /transl_table=11 FT /locus_tag="Cj0114" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0114, possible periplasmic FT protein, len: 315 aa; similar to hypothetical protein FT YBGF_ECOLI hypothetical 28.2 kd protein in pal-lysT FT intergenic region (263 aa), fasta scores; opt: 144 z-score: FT 238.8 E(): 4.8e-06, 21.3% identity in 249 aa overlap. 28.6% FT identity to HP1124. Contains possible N-terminal signal FT sequence" FT /note="Updated (2006) note: Prosite PS50005 FT TPR_REPEAT,Tetratricopeptide region identified within CDS. FT Supporting paper identifies protein as a glycoprotein. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /note="PMID:12186869" FT /db_xref="GOA:Q0PC23" FT /db_xref="InterPro:IPR011990" FT /db_xref="UniProtKB/TrEMBL:Q0PC23" FT /inference="protein motif:Prosite:PS50005" FT /protein_id="CAL34285.1" FT /translation="MKKIFTVALLGATLLYAESSAFGAGDITSNSSYGLTSNEKLFKEK FT LDNLNNENIQTNARINEINERIEGLQSTLEGINSQYAKSNSRLSQVEENNQNIENNFTS FT EIQKLKAYVEESRKIQEANNKQVKKVLAELSSLVDAINANYVSKNELNDANLSVKTITP FT SVVVSTTDSNSTIENNNTQNTQDDKAKQIDESWKKKKNNEILELAIKDVDKNAFEDSKA FT KLNFLITKQYKPARANFWLGEIEYKQKNYNNAIVYYKKSSSLSTKGDYFPKLLYHTAIS FT LDKTGDTKTANGFYKALKTNYPNSPEAKASPNRK" FT sig_peptide 119232..119300 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000047_119232_120179 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.874 between residues 23 and 24" FT misc_feature 119934..120035 FT /note="HMMPfam hit to PF07719, Tetratricopeptide FT repeat,score 0.012" FT /inference="protein motif:Pfam:PF07719" FT CDS 120194..120763 FT /transl_table=11 FT /gene="slyD" FT /locus_tag="Cj0115" FT /product="FKBP-type peptidyl-prolyl cis-trans isomerase" FT /EC_number="5.2.1.8" FT /note="Original (2000) note: Cj0115, slyD, probable FT peptidyl-prolyl cis-trans isomerase, len: 189 aa; similar FT to many of the FKBP-type e.g. SLYD_ECOLI FKBP-type FT peptidyl-prolyl cis-trans isomerase (196 aa), fasta scores; FT opt: 478 z-score: 296.9 E(): 2.8e-09, 38.5% identity in 200 FT aa overlap. 39.2% identity to HP1123" FT /note="Updated (2006) note: Prosite PS50059 FT FKBP_PPIASE,Peptidylprolyl isomerase, FKBP-type domain FT identified within CDS. Product modified to more specific FT family member due to motif match. Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Protein translation and modification" FT /note="PMID:9188461" FT /db_xref="GOA:Q0PC22" FT /db_xref="InterPro:IPR001179" FT /db_xref="UniProtKB/TrEMBL:Q0PC22" FT /inference="protein motif:Prosite:PS50059" FT /protein_id="CAL34286.1" FT /translation="MAIEKNSVVSMFYELKDANTNEVLESNLYSQPISFILGKGQILES FT LEEEVMKLDCPSNADVVIKKEKGLGEYDENAVQTLPKEQFAGIDLKVGMELFGEGENGE FT TVRVTVKEIGENDVTIDYNHPYAGRDLLFSLNIVDARAASEDEILTGIIAGSHSCGCGS FT GHGHDHHHGHGHGGGGCCGGGGCGCH" FT misc_feature 120701..120733 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 120763..121683 FT /transl_table=11 FT /gene="fabD" FT /locus_tag="Cj0116" FT /product="malonyl CoA-acyl carrier protein transacylase" FT /EC_number="2.3.1.39" FT /note="Original (2000) note: Cj0116, fabD, probable malonyl FT CoA-acyl carrier protein transacylase, len: 306 aa; similar FT to many e.g. FABD_ECOLI malonyl CoA-acyl carrier protein FT transacylase (EC 2.3.1.39) (308 aa), fasta scores; opt: 555 FT z-score: 655.2 E(): 3.1e-29, 36.1% identity in 296 aa FT overlap. 49.5% identity to HP0090. Contains Pfam match to FT entry PF00698 Acyl_transf, Acyl transferase domain, score FT 58.10, E-value 1.9e-13" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity scores. FT Thus,putative not added to product function. Functional FT classification - Fatty acid biosynthesis" FT /note="PMID:1339356, PMID:7768883, PMID:8759840" FT /db_xref="GOA:Q0PC21" FT /db_xref="InterPro:IPR001227" FT /db_xref="InterPro:IPR004410" FT /db_xref="InterPro:IPR014043" FT /db_xref="InterPro:IPR016035" FT /db_xref="InterPro:IPR016036" FT /db_xref="InterPro:IPR024925" FT /db_xref="UniProtKB/TrEMBL:Q0PC21" FT /inference="protein motif:Pfam:PF00698" FT /protein_id="CAL34287.1" FT /translation="MNAAFIFPGQGSQSLGMGKDFYENSIKAKELLQNASDFCKIDFKH FT LLFEENEKLNQSEFTQPAIVLNSLMAYSVLLEKKPDLSSKFALGHSLGEFSALAVNGAF FT DFLEALSLVNKRGLFMQEDCAKVEAGMMVVLGLDDEKVEELCQKAQKENKQIFAANYNC FT DGQIVVAGLKPDLASYESVFKEAGAKRAMLLNMSVASHCPLLENASAKLCVELEKVLKP FT NFKAVISNANAKIYTSKEEALELLKAQLISPVLYKQSIKACENEVDYFIEFGASVLKGL FT NKKITSKETYALTNMNDIDEFLKVV" FT misc_feature 120772..121680 FT /note="HMMPfam hit to PF00698, Acyl transferase FT domain,score 6.7e-07" FT /inference="protein motif:Pfam:PF00698" FT CDS 121680..122369 FT /transl_table=11 FT /gene="pfs" FT /locus_tag="Cj0117" FT /product="5'-methylthioadenosine/S-adenosylhomocysteine FT nucleosidase" FT /EC_number="3.2.2.16" FT /note="Original (2000) note: Cj0117, pfs, probable FT 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase, FT len: 229 aa; similar to many e.g. PFS_ECOLI FT 5'-methylthioadenosine (EC 3.2.2.16) / FT S-adnosylhomocysteine nucleosidase (232 aa), fasta scores; FT opt: 478 z-score: 817.7 E(): 0, 36.7% identity in 229 aa FT overlap. 50.0% identity to HP0089. Contains Pfam match to FT entry PF01048 PNP_UDP_1, Phosphorylase family, score FT 216.20, E-value 4.7e-61" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity scores. FT Thus,putative not added to product function. Functional FT classification - Misc" FT /note="PMID:9524204" FT /db_xref="GOA:Q0PC20" FT /db_xref="InterPro:IPR000845" FT /db_xref="InterPro:IPR010049" FT /db_xref="InterPro:IPR018017" FT /db_xref="UniProtKB/TrEMBL:Q0PC20" FT /inference="protein motif:Pfam:PF01048" FT /protein_id="CAL34288.1" FT /translation="MMKIAILGAMSEEITPLLETLKDYTKIEHANNTYYFAKYKNHELV FT LAYSKIGKVNSTLSASVMIEKFGAQALLFTGVAGAFNPELEIGDLLYATKLAQYDLDIT FT AFGHPLGFVPGNEIFIKTDEKLNNLALEVAKELNIKLRAGIIATGDEFICDEAKKAKIR FT EIFNADACEMEGASVALVCDALKVPCFILRAMSDKAGEKAEFDFDEFVINSAKISANFV FT LKMCEKL" FT misc_feature 121686..122357 FT /note="HMMPfam hit to PF01048, Phosphorylase family, score FT 1.9e-56" FT /inference="protein motif:Pfam:PF01048" FT CDS 122366..123121 FT /transl_table=11 FT /locus_tag="Cj0118" FT /product="conserved hypothetical protein Cj0118" FT /note="Original (2000) note: Cj0118, unknown, len: 251 aa; FT similar to hypothetical proteins from many organisms e.g. FT YDAO_ECOLI (311 aa), fasta scores; opt: 447 z-score: 465.6 FT E(): 1.1e-18, 32.5% identity in 240 aa overlap. 49.4% FT identity to HP1182. Contains Pfam match to entry PF01171 FT UPF0021, Uncharacterized protein family UPF0021, score FT -88.80, E-value 9.9e-05" FT /note="Updated (2006) note: Pfam domain PF01171 PP-loop FT family identified within CDS. No specific characterisation FT has been carried out. Thus, putative kept within product FT function. Conserved added to product function. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="GOA:Q0PC19" FT /db_xref="InterPro:IPR011063" FT /db_xref="InterPro:IPR012089" FT /db_xref="InterPro:IPR014729" FT /db_xref="UniProtKB/TrEMBL:Q0PC19" FT /inference="protein motif:Pfam:PF01171" FT /protein_id="CAL34289.1" FT /translation="MINLSKKLIRQVAQANAKFGLIKDGDRVLLGLSGGKDSLALAHLL FT NRMQAHAPFKFELEAVTLSYGMGEDYSHLHAHCEEHGIKHSVLDSNIYEVSGDTIRENS FT SFCSYFSRMRRGALYTYALEKGFNKLAIAHHLDDAAESFFMNFIHNGALRTLAPIYQSK FT RGITVIRPLIFVRERQLRDNATQNELSVIGNEFCPGMKLSEKNVKFPHAREEAKQLLAN FT LEKDHPKLFTSLKTAFANLHTESFWLQKA" FT misc_feature 122444..123043 FT /note="HMMPfam hit to PF01171, PP-loop family, score 4e-14" FT /inference="protein motif:Pfam:PF01171" FT CDS 123126..123647 FT /transl_table=11 FT /locus_tag="Cj0119" FT /product="putative hydrolase" FT /note="Original (2000) note: Cj0119, unknown, len: 173 aa; FT similar to a hypothetical protein from B. subtilis FT TR:O32091 (EMBL:Z99120) YUEJ protein (183 aa), fasta FT scores; opt: 172 z-score: 282.5 E(): 1.8e-08, 29.5% FT identity in 166 aa overlap. No Hp match" FT /note="Updated (2006) note: Motif match (IPR000868) FT identified link to hydrolase. Product modified to more FT specific family member based on motif match. No specific FT characterisation with acceptable identity score has been FT carried out yet. Putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PC18" FT /db_xref="InterPro:IPR000868" FT /db_xref="UniProtKB/TrEMBL:Q0PC18" FT /protein_id="CAL34290.1" FT /translation="MKKAFVLVDYQNDFIDGSLGFDKALKIKENILKALNQIDFNNTHL FT LLTYDTHDEHYLQSKEGLNLPVKHCIKESLGWQMPKEFEPFLQKAHKIFYKNTFGSLEL FT ANFIQKSDYEELHFAGLVSHICVFCNIILAFGAKPNARIILHQNLSASFDENLEKSAFD FT ILRAYGIEIV" FT CDS 123647..124261 FT /transl_table=11 FT /locus_tag="Cj0120" FT /product="hypothetical protein Cj0120" FT /note="Original (2000) note: Cj0120, unknown, len: 204 aa; FT 41.7% identity to HP0951. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PC17" FT /protein_id="CAL34291.1" FT /translation="MQGFILHTQKVKDEDLIVYILSPKMLIKAYRFYGLRHSSILSGYK FT IDFALEENPSFLPRLKDVLHLGFLWIMQRDKMLIWQEFIRLLYRHLKDVEELDSFYFDL FT LDECVKRFEKQNPKRVIVDAYLKILEFEGRLHKDFFCFACDEKIQNSITLLRAFLPSHS FT QCALGFEFEEKKLKQFYSSKNCAIFDDEEIENLYHLIKEGL" FT CDS 124258..124665 FT /transl_table=11 FT /locus_tag="Cj0121" FT /product="conserved hypothetical protein Cj0121" FT /note="Original (2000) note: Cj0121, unknown, len: 135 aa; FT similar to hypothetical proteins from many organisms e.g. FT YBEY_ECOLI (155 aa) fasta scores; opt: 218 z-score: 353.9 FT E(): 1.9e-12, 37.8% identity in 111 aa overlap. 59.8% FT identity to HP1160" FT /note="Updated (2006) note: Pfam PF02130 Uncharacterized FT protein family UPF0054 was present within CDS. Conserved FT added to product function. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="GOA:Q9PJ06" FT /db_xref="InterPro:IPR002036" FT /db_xref="InterPro:IPR020549" FT /db_xref="InterPro:IPR023091" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ06" FT /inference="protein motif:Pfam:PF02130" FT /protein_id="CAL34292.1" FT /translation="MILSDEKCDFLESIASFLSPKDVELVFVDSKEMQEINLEQRKQDK FT TTDVLSFPLENIDESLPLGSVVINVDLAKEKAKELGHSYEEEISLLFIHAMLHLLGFDH FT ENDNGEMREKEKELIEHFNLPKSLIVRTLED" FT misc_feature 124339..124602 FT /note="HMMPfam hit to PF02130, Uncharacterized protein FT family UPF0054, score 6.5e-36" FT /inference="protein motif:Pfam:PF02130" FT CDS 124789..125478 FT /transl_table=11 FT /locus_tag="Cj0122" FT /product="hypothetical protein Cj0122" FT /note="Original (2000) note: Cj0122, unknown, len: 229 aa; FT no Hp match. Similar in C-terminus to Cj0055c (46.6% FT identity in 148 aa overlap), and in N-terminus to Cj0416 FT (88.2% identity in 34 aa overlap)" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PC15" FT /protein_id="CAL34293.1" FT /translation="MIVFPLSSFNRYFGNNPLQTLTKIRDESIENGNPELTKKQREELG FT NDLIDLYKISKKFSDKIELVEGSIEDKLRNNELPESEVKNLFQWMDENAKHPRWMHIDG FT VSYDEAYVKIFHTSKSIDEFKEKYLELQKKYFVDFNNIDSSQKKLQETSEEDKKAFKPI FT QVESKSETYKDDNKMNELLRKLLETKFGTSDELEILFGMNFSNDNAGEFNKILSQNTSA FT KIIDIKA" FT CDS complement(125503..126429) FT /transl_table=11 FT /locus_tag="Cj0123c" FT /product="putative tRNA-dihydrouridine synthase" FT /note="Original (2000) note: Cj0123c, possible FT transcriptional regulator, len: 308 aa; similar to FT hypothetical proteins e.g. YACF_BACSU (333 aa), fasta FT scores; opt: 566 z-score: 916.8 E(): 0, 37.2% identity in FT 312 aa overlap, and to e.g. NIR3_RHOCA nitrogen regulation FT protein nifR3 (324 aa), fasta scores; opt: 517 z-score: FT 616.2 E(): 4.6e-27, 34.4% identity in 317 aa overlap. 49.5% FT identity to HP0727. Contains Pfam match to entry PF01207 FT UPF0034, Uncharacterized protein family UPF0034,score FT 260.90, E-value 1.7e-74" FT /note="Updated (2006) note: Pfam domain PF01207 FT Dihydrouridine synthase (Dus) identified within CDS. FT Product modified to more specific family member due to FT motif match. No specific characterisation with acceptable FT identity scores carried out yet. Thus, putative kept within FT product function. Functional classification - Misc" FT /db_xref="GOA:Q0PC14" FT /db_xref="InterPro:IPR001269" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR018517" FT /db_xref="InterPro:IPR024036" FT /db_xref="UniProtKB/TrEMBL:Q0PC14" FT /inference="protein motif:Pfam:PF01207" FT /protein_id="CAL34294.1" FT /translation="MIDFSKKPLFLAPMAGFSDLPFRNVVKKFGADITISEMISSNALV FT YESSKTLHMLERAELENPYIVQIAGGDKEVLKKAVQMLNEMDFVDGIDFNCGCPVNKVV FT KQCAGSALLENLELFKNLVGVIKENNKKSLTSVKFRLGFNEKYPEKMAKICESLGVDFI FT SIHGRTRKQLYSGKADYGSIASAKASVKIPVIANGDINAQNAKEVYKITKCDGLMIGRA FT SVGNPWIFYEIKSGKSVDEKLKKEIILTHFDEMIKHYKDQGVSIFRKHLHEYSKGHKDA FT STFRDTVNRIDNVEEMRKKIEEFFSLT" FT misc_feature complement(125515..126402) FT /note="HMMPfam hit to PF01207, Dihydrouridine synthase FT (Dus), score 3.1e-75" FT /inference="protein motif:Pfam:PF01207" FT CDS complement(126426..127412) FT /transl_table=11 FT /locus_tag="Cj0124c" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0124c, probable membrane FT protein, len: 328 aa; 21.1% identity to HP0948. Contains FT two possible transmembrane domains. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PC13" FT /protein_id="CAL34295.1" FT /translation="MKIKLFLLASFIYIALIFAFAWHLELGSYTLNISTYTFELPIMIW FT LVIPLFIYMILAVLHIAFYGFLRYLKFKHFFKDAAKFEAYTQDLLLEKDLKTTFQTKEF FT RSVAQLFKTIKTHEKIPHSNKINEILDLIDGLNKNEFFNLSKFKLENNNVLYLQNEKNH FT LKNDANYAYNKLKNLNEIKDEFEEIAFNTLIEKASYEQIKNVKIPKKPSEVLTLIKRFK FT EGNLELSVAEYEVLLSHNILSEKDYLNAAKLSTKLLNPDAILGIFNKIKNEKSEALRAY FT LYLLAEFGLLDELREQIHNDDKKFNDFKAFLALREKNIKIDLNQLIQ" FT misc_feature complement(join(127332..127400,127221..127289)) FT /note="2 probable transmembrane helices predicted for FT Cj0124c by TMHMM2.0 at aa 5-27 and 42-64" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(127350..127412) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000054_126426_127412 by SignalP 2.0 FT HMM (Signal peptide probability 0.978) with cleavage site FT probability 0.782 between residues 21 and 22" FT CDS complement(127402..127764) FT /transl_table=11 FT /locus_tag="Cj0125c" FT /product="hypothetical protein Cj0125c" FT /note="Original (2000) note: Cj0125c, unknown, len: 120 aa; FT some similarity to e.g. DKSA_ECOLI dnaK suppressor protein FT (151 aa), fasta scores; opt: 186 z-score: 276.6 E(): FT 3.8e-08, 26.3% identity in 118 aa overlap. No Hp match. FT Contains PS01102 Prokaryotic dksA/traR C4-type zinc finger FT and Pfam match to entry PF01258 zf_dskA_traR,Prokaryotic FT dksA/traR C4-type zinc finger, score 39.20,E-value 9.7e-08" FT /note="Updated (2006) note: No specific characterisation FT has been carried out yet. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="GOA:Q0PC12" FT /db_xref="InterPro:IPR000962" FT /db_xref="InterPro:IPR020458" FT /db_xref="UniProtKB/TrEMBL:Q0PC12" FT /inference="protein motif:Pfam:PF01258" FT /inference="protein motif:Prosite:PS01102" FT /protein_id="CAL34296.1" FT /translation="MKKNEIQNFKNILEERKKAILENLQSNSNEIEALHNSVPSDSVDF FT SVIETGSQIDFAISTNLKEELIEIEDSLDKIKNGTYGICESCDDEIDSQRLKVKPHARY FT CITCRQIAEQGKKHEN" FT misc_feature complement(127417..127617) FT /note="HMMPfam hit to PF01258, Prokaryotic dksA/traR FT C4-type zinc finge, score 6.8e-09" FT /inference="protein motif:Pfam:PF01258" FT misc_feature complement(127441..127515) FT /note="PS01102 Prokaryotic dksA/traR C4-type zinc finger" FT /inference="protein motif:Prosite:PS01102" FT CDS complement(127776..128237) FT /transl_table=11 FT /locus_tag="Cj0126c" FT /product="conserved hypothetical protein Cj0126c" FT /note="Original (2000) note: Cj0126c, unknown, len: 153 aa; FT similar to hypotheticals e.g. YBEA_ECOLI (155 aa),fasta FT scores; opt: 189 z-score: 288.6 E(): 8.1e-09, 28.1% FT identity in 153 aa overlap. 37.2% identity to HP0949" FT /note="Updated (2006) note: Pfam PF02590 Uncharacterized FT ACR family was present within CDS. Conserved added to FT product function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="GOA:Q9PJ01" FT /db_xref="InterPro:IPR003742" FT /db_xref="UniProtKB/Swiss-Prot:Q9PJ01" FT /inference="protein motif:Pfam:PF02590" FT /protein_id="CAL34297.1" FT /translation="MENNLQVNIFCIQKSDEFKTCSEKYSKLISKYATLKEINVFNKKI FT ALAQNLNAIEAKKSYEEAFMPYKKGYCIALDEKGKDLTSIEFAKLIQDKNELSFFIGGA FT YGLREEFNQSLDFRLSLSKLTLAHQFVKTLLLEQIYRAFCINNNHPYHK" FT misc_feature complement(127782..128225) FT /note="HMMPfam hit to PF02590, Uncharacterized ACR,COG1576, FT score 9.2e-69" FT /inference="protein motif:Pfam:PF02590" FT CDS complement(128227..129069) FT /transl_table=11 FT /gene="accD" FT /locus_tag="Cj0127c" FT /product="acetyl-coenzyme A carboxylase carboxyl FT transferase subunit beta" FT /EC_number="6.4.1.2" FT /note="Original (2000) note: Cj0127c, accD, probable FT acetyl-coenzyme A carboxylase carboxyl transferase subunit FT beta , len: 280 aa; similar to many e.g. ACCD_ECOLI FT acetyl-coenzyme A carboxylase carboxyl transferase subunit FT beta (EC 6.4.1.2) (304 aa), fasta scores; opt: 903 z-score: FT 1278.3 E(): 0, 53.4% identity in 251 aa overlap. 65.5% FT identity to HP0950" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Functional FT classification - Fatty acid biosynthesis" FT /note="PMID:7678242, PMID:1355086" FT /db_xref="GOA:Q0PC10" FT /db_xref="InterPro:IPR000022" FT /db_xref="InterPro:IPR000438" FT /db_xref="InterPro:IPR011762" FT /db_xref="UniProtKB/TrEMBL:Q0PC10" FT /protein_id="CAL34298.1" FT /translation="MNFADIFSKIRRQQPSVKEAPNHWVKCQSCHALMYYKEIESCFNV FT CPKCNYHMRISADERIKLLSDEGSFIEYDANLEAIDPLKFVDSKSYKKRLSEGESKTGR FT KSSVISGECEINGLKTQLVVFDFSFMGGSLGSVEGEKIVRAIQRAITSKTSLVIVSASG FT GARMQESTYSLMQMSKTSAALKLLSKEKLPYISILTDPTMGGVSASFAWLGDLIIAEPE FT ALVGFAGARVIKQTIGADLPEGFQKAEFLLEHGLIDAIVERGEQKQYLSDVLKFFSGK" FT misc_feature complement(128974..128991) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT CDS complement(129078..129800) FT /transl_table=11 FT /locus_tag="Cj0128c" FT /product="putative inositol monophosphatase family protein" FT /note="Original (2000) note: Cj0128c, unknown, len: 240 aa; FT some similarity to e.g. SUHB_ECOLI extragenic suppressor FT protein suhB (267 aa), fasta scores; opt: 168 z-score: FT 229.0 E(): 1.7e-05, 29.9% identity in 134 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF00459 Inositol FT monophosphatase family identified within CDS. Product FT modified to more specific family member due to motif match. FT Characterised within Escherichia coli, however,identity FT scores were not acceptable. Functional classification - FT Misc" FT /note="PMID:10747806, PMID:8002619" FT /db_xref="GOA:Q0PC09" FT /db_xref="InterPro:IPR000760" FT /db_xref="UniProtKB/TrEMBL:Q0PC09" FT /inference="protein motif:Pfam:PF00459" FT /protein_id="CAL34299.1" FT /translation="MKEFLDACLNANLQIRKYLNNIPQNDLKLCSKLGYDKNQGYELDL FT KCEQIFIKYLSCFGQIFSEESGLIGKASPKQMILDPLDGSSNFVSKIPFYGTSIALMEK FT DQAKSAFVCNLVSQEIFAFNNKQAFKSNLSDPKYSPLTPNLFSKIGIVEKISLYPELLD FT FLTKNQLKFRSLGATALSLAYASYFSFVLILGKTRIFDTAAALAIHQNLYIEKNENFLL FT LSQDKKIFDIILEFLKNN" FT misc_feature complement(129096..129800) FT /note="HMMPfam hit to PF00459, Inositol monophosphatase FT family, score 1.2e-06" FT /inference="protein motif:Pfam:PF00459" FT misc_feature complement(129219..129287) FT /note="1 probable transmembrane helix predicted for Cj0128c FT by TMHMM2.0 at aa 172-194" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(129800..132019) FT /transl_table=11 FT /locus_tag="Cj0129c" FT /product="outer membrane protein" FT /note="Original (2000) note: Cj0129c, probable outer FT membrane protein, len: 739 aa; similar to e.g. TR:O30912 FT (EMBL:AF021245) Neisseria meningitidis outer membrane FT protein omp85 (797 aa), fasta scores; opt: 643 z-score: FT 886.3 E(): 0, 25.3% identity in 782 aa overlap, and FT D152_HAEIN protective surface antigen d15 precursor (795 FT aa), fasta scores; opt: 523 z-score: 548.2 E(): FT 2.8e-23,24.3% identity in 807 aa overlap. 34.2% identity to FT HP0655. Contains N-terminbal signal sequence and Pfam match FT to entry PF01103 Bac_suface_Ag, Bacterial surface antigen, FT score 404.10, E-value 1.3e-117" FT /note="Updated (2006) note: Pfam domains PF01103 Surface FT antigen and x5 PF07244 Surface antigen variable number FT repeat were identified within CDS. Further support given to FT product function. Literature search identified papers FT giving further clues to product function. Characterisation FT has been carried out within Escherichia coli, FT however,identity scores were marginal. Appropriate motifs FT were present. Putative not added to product function. FT Functional classification - Membranes, lipoproteins and FT porins" FT /note="PMID:11422558, PMID:16102012" FT /db_xref="GOA:Q0PC08" FT /db_xref="InterPro:IPR000184" FT /db_xref="InterPro:IPR010827" FT /db_xref="InterPro:IPR016474" FT /db_xref="UniProtKB/TrEMBL:Q0PC08" FT /inference="protein motif:Pfam:PF07244" FT /inference="protein motif:Pfam:PF01103" FT /protein_id="CAL34300.1" FT /translation="MKKHLISICALVAMANAATIKDIKFIGLNHLSNTSAINIAGLKIG FT EEINPAKINTAILNLYKQNYFENIAVENNNGILEIIVTEKPTIAKVTITGIASNDRKQV FT ESILGIKRGTLLDEGNIKEAIERIKAYYEAKSYFDTIVEYKKKTLENTDGLELEFIVNR FT GENIIIDNVHLSGAKKFSYSDIEPAVVNKEKEFMGWMWGRNDGKLKVFELSNDSSRIAD FT EYMKKGYLDVQVSSPYLKTYTDTYQANLTYFIKEGKPYKIKSISIENPLFDDKQNAQTV FT KDLRSSAGKTINIEDIRKDVKTIETQSADLGYAFVEVYPDIQKNDQTQEATVVFKVIPH FT DKVYIRNVIISGNSRTVDRVIRRELYITEGNLYNRTDLSESKNALKRTSYFDDVNIKEE FT KVDDTHIDLIVDVKEASTGAISGGIGYGSSDGILLNASLSDTNIFGSGIKSSVSVDKSD FT DTLSGRISLVNPRVLDSQYSLGGTLYSNDYEWDNYSEKNYGFDITIGRQFARYYNVSLT FT YNLEQSDIYHLSPTLLRTGYELGKSIKSSITPAITFNDTDDYYLPRSGIIASTSLEYAG FT LGGDQEFISSSSKFNFYQGLQDYIGYDLIYRYKASFYKVWDEGYLPINQRIYLGGIRSI FT RGFESRTVSPKNQWGDEIGGTIAFANSVELSFPLIDRIKLRGSVFFDYGMIGRKNLDEI FT KRMSTGIGIEWITPIGPLQLVFAKPLNDKKGDDTNSFEFNLGTRF" FT misc_feature complement(129803..130726) FT /note="HMMPfam hit to PF01103, Surface antigen, score FT 3e-78" FT /inference="protein motif:Pfam:PF01103" FT misc_feature complement(130760..130921) FT /note="HMMPfam hit to PF07244, Surface antigen variable FT number repeat, score 5.9e-08" FT /inference="protein motif:Pfam:PF07244" FT misc_feature complement(130991..131164) FT /note="HMMPfam hit to PF07244, Surface antigen variable FT number repeat, score 3e-07" FT /inference="protein motif:Pfam:PF07244" FT misc_feature complement(131234..131416) FT /note="HMMPfam hit to PF07244, Surface antigen variable FT number repeat, score 1.7e-07" FT /inference="protein motif:Pfam:PF07244" FT misc_feature complement(131519..131692) FT /note="HMMPfam hit to PF07244, Surface antigen variable FT number repeat, score 1.3e-07" FT /inference="protein motif:Pfam:PF07244" FT misc_feature complement(131756..131896) FT /note="HMMPfam hit to PF07244, Surface antigen variable FT number repeat, score 3.7e-07" FT /inference="protein motif:Pfam:PF07244" FT sig_peptide complement(131969..132019) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000058_129800_132019 by SignalP 2.0 FT HMM (Signal peptide probability 0.997) with cleavage site FT probability 0.981 between residues 17 and 18" FT CDS 132096..132923 FT /transl_table=11 FT /gene="tyrA" FT /locus_tag="Cj0130" FT /product="putative prephenate dehydrogenase" FT /EC_number="1.3.1.12" FT /note="Original (2000) note: Cj0130, tyrA, probable FT prephenate dehydrogenase, len: 275 aa; similar to e.g. FT TYRA_BACSU prephenate dehydrogenase (EC 1.3.1.12) (372 aa), FT fasta scores; opt: 474 z-score: 529.7 E(): 3e-22,31.0% FT identity in 284 aa overlap. 45.3% identity to HP1380" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with marginal identity score. Alignment does not FT cover full sequence length. Putative kept within product FT function. Functional classification - Amino acid FT biosynthesis - Aromatic amino acid family" FT /note="PMID:3106153" FT /db_xref="GOA:Q0PC07" FT /db_xref="InterPro:IPR003099" FT /db_xref="InterPro:IPR008927" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:Q0PC07" FT /protein_id="CAL34301.1" FT /translation="MKIAIIGLGLMGGSLGLCLKENKLISCVYGMDLSKENEKDALQLG FT LIHELIEFKDLALCDMIFVATPVNAIIEILQKLVDLPSNVTIIELGSTKRKIIESLPKN FT LIKQTLFAHPMTGTENSGPKAAFKELYKDAVCVLCDSEIADDLHQKRAVEIFSHLGMKI FT VFMDSKAHDHHAAIISHLPHVISFSLANFVMKEEDKRNIVHLAGGSFKGMSRIAKSSPQ FT MWESIFLQNKDNLLSSIDFFQQELERCKQMIQLDKNDELREWMKQANTLREIL" FT misc_feature 132108..132911 FT /note="HMMPfam hit to PF02153, Prephenate FT dehydrogenase,score 1.2e-83" FT /inference="protein motif:Pfam:PF02153" FT CDS 133003..134376 FT /transl_table=11 FT /locus_tag="Cj0131" FT /product="putative peptidase M23 family protein" FT /note="Original (2000) note: Cj0131, probable periplasmic FT protein, len: 457 aa; similar to hypothetical proteins FT e.g.TR:O25694 (EMBL:AE000754) Aquifex aeolicus AQ_1743 (422 FT aa), fasta scores; opt: 401 z-score: 635.2 E(): 4e-28, FT 30.0% identity in 420 aa overlap. 30.0% identity to HP1054. FT Contains probable N-terminal signal sequence. Also similar FT in C-terminus to Cj1235 (30.2% identity in 222 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF01551 Peptidase FT family M23 identified within CDS. Product modified to more FT specific family member due to motif match. No specific FT characterisation with acceptable identity scores identified FT yet. Thus, putative kept within product function. FT Functional classification - Degradation of macromolecules - FT Proteins, peptides and glycopeptides" FT /db_xref="InterPro:IPR011055" FT /db_xref="InterPro:IPR016047" FT /db_xref="UniProtKB/TrEMBL:Q0PC06" FT /inference="protein motif:Pfam:PF01551" FT /protein_id="CAL34302.1" FT /translation="MAKRKGKTYLSVLILVLIAILIFFISRLSIFEKNPPQILMPDVVY FT TDLKKPILVHIKDDESSIKNVQIILHKDDNTSAMVIADEKISNLKDITLQVALPKFGYK FT ENVKSFVLEVIAKDSSFWNFFSGNEARKQIAVLVDNTAPKINIISNSYQIEQGGAGAVV FT FKADDANLDKVYIETNKGKIFKATPYVKEGYYAALIAWDARDEEFRAFVIATDKAGNIS FT KERIRYYFVNRKYRVSNINLTDKFLDGKIENLANQYAPKDNNLNRYEKFKFVNETLRNS FT NEKLIHEITSKVPEEKIDNFDLNLFLPLKNGMKVADFADHRYYSYNGQFVSDSYHMGLD FT LASVAQAPIISNNAGKVVFAAENGIYGLNLIVYHGFGVYSLYGHCSSKNVDLDEMINKQ FT SIIGKTGTSGLALGDHLHFGVLVQGVETRPEQWQDKKWIENNIYNVLNDGKKIILGKN" FT sig_peptide 133003..133098 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000059_133003_134376 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.745 between residues 32 and 33" FT misc_feature 133027..133095 FT /note="1 probable transmembrane helix predicted for Cj0131 FT by TMHMM2.0 at aa 9-31" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 134002..134289 FT /note="HMMPfam hit to PF01551, Peptidase family M23, score FT 5.2e-27" FT /inference="protein motif:Pfam:PF01551" FT CDS 134376..135260 FT /transl_table=11 FT /gene="lpxC" FT /locus_tag="Cj0132" FT /product="UDP-3-O-[3-hydroxymyristoyl] n-acetylglucosamine FT deacetylase" FT /EC_number="3.5.1.-" FT /note="Original (2000) note: Cj0132, lpxC, probable FT UDP-3-O-[3-hydroxymyristoyl] n-acetylglucosamine FT deacetylase, len: 294 aa; simlar to e.g. LPXC_ECOLI FT UDP-3-O-[3-hydroxymyristoyl] n-acetylglucosamine FT deacetylase (305 aa), fasta scores; opt: 804 z-score: FT 1267.2 E(): 0, 42.5% identity in 287 aa overlap. 54.9% FT identity to HP1052" FT /note="Updated (2006) note: Pfam domain PF03331 FT UDP-3-O-acyl N-acetylglycosamine deacetylase identified FT within CDS. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity scores. Thus, putative not added to product FT function. Functional classification - Surface FT polysaccharides, lipopolysaccharides and antigens" FT /note="PMID:8752330" FT /db_xref="GOA:Q9PIZ5" FT /db_xref="InterPro:IPR004463" FT /db_xref="InterPro:IPR011334" FT /db_xref="InterPro:IPR015870" FT /db_xref="InterPro:IPR020568" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIZ5" FT /inference="protein motif:Pfam:PF03331" FT /protein_id="CAL34303.1" FT /translation="MKQLTLAKTVKGVGIGLHKGEPIEITLEPLEANSGIVFFRSDLNA FT SYKASPENVINTQMATVLGDDRGFISTIEHLMSAINAYGIDNVRIVLNANEAPVMDGSS FT ISFCMMLDEAGVKELDAPKKIMVIKKPIEVRDGNKFVRLTPTKEPRINYTIKFDNAVIG FT EQSYNFEFSKKNYIENIARARTFGFLKDVQALRSMNLALGGSLENTIVVDENRILNPEG FT LRFKDEFVRHKILDAIGDLTLLGYRVFGDYTSYAGSHHLNHLLTKEVLKDKDAYEIVSL FT EKTTQKAYEKVFA" FT misc_feature 134376..135197 FT /note="HMMPfam hit to PF03331, UDP-3-O-acyl FT N-acetylglycosamine deacetylase, score 5.5e-135" FT /inference="protein motif:Pfam:PF03331" FT CDS 135299..135700 FT /transl_table=11 FT /locus_tag="Cj0133" FT /product="putative glycoprotease family protein" FT /note="Original (2000) note: Cj0133, unknown, len: 133 aa; FT 33.6% identity to HP1051" FT /note="Updated (2006) note: Pfam domain PF00814 FT Glycoprotease family identified within CDS. Further support FT given to product function. No specific characterisation FT with acceptable identity score carried out yet. Putative FT kept within product function. Functional classification - FT Degradation of macromolecules - Proteins,peptides and FT glycopeptides" FT /db_xref="GOA:Q0PC04" FT /db_xref="UniProtKB/TrEMBL:Q0PC04" FT /inference="protein motif:Pfam:PF00814" FT /protein_id="CAL34304.1" FT /translation="MIGIYQDDKLIKTYKSEEKASEFLPKILDELLKEYDFTSLIYANG FT PGSYMGIKISYVSLSTLSIVKNIPLFAVSAFELNGYKPISANKNFCFVYKEGEICLEQN FT IPAEFFLPKNLQELKLNNDNLPFYFLDAI" FT misc_feature 135323..135550 FT /note="HMMPfam hit to PF00814, Glycoprotease family, score FT 1e-18" FT /inference="protein motif:Pfam:PF00814" FT CDS 135709..136587 FT /transl_table=11 FT /gene="thrB" FT /locus_tag="Cj0134" FT /product="putative homoserine kinase" FT /EC_number="2.7.1.39" FT /note="Original (2000) note: Cj0134, thrB, probable FT homoserine kinase, len: 292 aa; similar to many e.g. FT KHSE_FREDI homoserine kinase (EC 2.7.1.39) (307 aa), fasta FT scores; opt: 537 z-score: 750.4 E(): 0, 31.6% identity in FT 294 aa overlap. 51.6% identity to HP1050. Contains PS00627 FT GHMP kinases putative ATP-binding domain" FT /note="Updated (2006) note: Pfam domain PF00288 GHMP FT kinases putative ATP-binding protein identified within CDS. FT Further support given to product function. Characterised FT within Fremyella diplosiphon with marginal identity score. FT Putative kept within product function" FT /note="Updated (2006) note: PMID:2838727. Functional FT classification - Amino acid biosynthesis - Aspartate FT family" FT /note="PMID:2838727" FT /db_xref="GOA:Q9PIZ3" FT /db_xref="InterPro:IPR000870" FT /db_xref="InterPro:IPR006203" FT /db_xref="InterPro:IPR006204" FT /db_xref="InterPro:IPR014721" FT /db_xref="InterPro:IPR020568" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIZ3" FT /inference="protein motif:Pfam:PF00288" FT /inference="protein motif:Prosite:PS00627" FT /protein_id="CAL34305.1" FT /translation="MKILVPATSANLGPGFDCLGLSLKLFNETQIQKSGVFSISIGGEG FT SDNIFLKKNNIFVNIFYEIYEKLSGKKDNFRFIFQNNIPLSRGLGSSSAVIVGAIASAY FT YMSGFKVEKECILDEALIYENHPDNIAPATLGGFVCSLVEKNKVYSIKKEIDKDLAAVV FT VIPNLAMSTEQSRQALAKNLSFNDAVFNLSHASFLTACFLEKKYEFLKFASQDKLHEIN FT RMKNLPELFEVQKFALENKALMSTLSGSGSSFFSLAFKDDALALAKKIQTKFKDFRVQY FT LEFDDNGFEIC" FT misc_feature 135928..136494 FT /note="HMMPfam hit to PF00288, GHMP kinases putative FT ATP-binding protei, score 6e-28" FT /inference="protein motif:Pfam:PF00288" FT misc_feature 135955..135990 FT /note="PS00627 GHMP kinases putative ATP-binding domain" FT /inference="protein motif:Prosite:PS00627" FT misc_feature 136279..136311 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 136612..136869 FT /transl_table=11 FT /locus_tag="Cj0135" FT /product="conserved hypothetical protein Cj0135" FT /note="Original (2000) note: Cj0135, unknown, len: 85 aa; FT 44.6% identity to HP1049" FT /note="Updated (2006) note: Pfam PF04296 Protein of unknown FT function (DUF448) was present within CDS. Conserved added FT to product function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="InterPro:IPR007393" FT /db_xref="UniProtKB/TrEMBL:Q0PC02" FT /inference="protein motif:Pfam:PF04296" FT /protein_id="CAL34306.1" FT /translation="MKKHIPIRMCIVCKNRFEQNMLFRFKVVLGDIVPKAEHGRSGYLC FT QNCIEREDKVLQKAFSKICKNLNTKITQQGLKEIFLNGKD" FT misc_feature 136624..136857 FT /note="HMMPfam hit to PF04296, Protein of unknown function FT (DUF448), score 5.8e-31" FT /inference="protein motif:Pfam:PF04296" FT CDS 136856..139471 FT /transl_table=11 FT /gene="infB" FT /locus_tag="Cj0136" FT /product="translation initiation factor IF-2" FT /note="Original (2000) note: Cj0136, infB, probable FT translation initiation factor IF-2, len: 871 aa; similar to FT many e.g. IF2_ENTFC translation initiation factor IF-2 (784 FT aa), fasta scores; opt: 1893 z-score: 1909.4 E(): 0,40.0% FT identity in 865 aa overlap. 46.3% identity to HP1048. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop), FT PS01176 Initiation factor 2 signature and Pfam match to FT entry PF00009 GTP_EFTU, Elongation factor Tu family FT (contains ATP/GTP binding P-loop), score 136.20,E-value FT 6e-37" FT /note="Updated (2006) note: Characterised within FT Escherichia coli and Bacillus subtilis with acceptable FT identity scores. Thus, putative not added to product FT function. Functional classification - Protein translation FT and modification" FT /note="PMID:2110148, PMID:3025199" FT /db_xref="GOA:Q9PIZ1" FT /db_xref="InterPro:IPR000178" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR004161" FT /db_xref="InterPro:IPR005225" FT /db_xref="InterPro:IPR006847" FT /db_xref="InterPro:IPR009000" FT /db_xref="InterPro:IPR015760" FT /db_xref="InterPro:IPR023115" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIZ1" FT /inference="protein motif:Pfam:PF00009" FT /inference="protein motif:Prosite:PS01176" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34307.1" FT /translation="MAKIRIHEIAKELGYDSKEIIEKANELGLGIKTASNAVEPEIAAA FT IYEYIQTREIPEAFKKNIKTPTAKKPKKENIKEQEKLNESEKKEPKKEEKLKQEVKKEE FT LKIEKENAKEEEKQEIIDAHKPQSLASATLAKRRGLVIVKKKKDEEEIQVKKEEVKNSN FT DISINNEERLSLKTMFSNADESLKKKKKEKKSFVASKKESTEKMNFLDEHDFGDISLDD FT EDEVVLPDFSVKEQEKPQNINKKQPNFIRQAVGNSAGFGFEGGIQRRSRKKPSKKIEKK FT EVEEVGSVAISKEIRVYEFADKIGKSTSEVISKLFMLGMMTTKNDFLDEDAIEILAAEF FT GIEINIINEADEFDYVKDYEEETDEKDLVTRAPVITIMGHVDHGKTSLLDYIRKSRVAS FT GEAGGITQHVGAYMVEKNGRKITFIDTPGHEAFTAMRARGASITDIVIIVVAADDGVKP FT QTKEAINHAKAAGVPIIIAINKMDKEAANPDMVKTQLAEMEIMPVEWGGSYEFVGVSAK FT TGMGIEDLLEIVLLQADILELKANPKSFAKASIIESSVQKGRGAVATVIVQNGTLTVGS FT TVVAGEAYGKVRAMSDDQGKALKEIKPGECGVIVGLSEVADAGEILIAVKTDKEAREYA FT NKRHEYNRQKELSKSTKVSIDELGAKIKEGNLKALPVILKADVQGSLEALKASLEKLRN FT DEIKVNIIHSGVGGITQSDIELASASENSIVLGFNIRPTGEVKERAKDKGVEIKTYNVI FT YNLLDDVKALLGGMMSPIISEEQLGQAEIRQVINVPKIGQIAGCMVTEGVINRGAKIRL FT IRDGVVVYEGNVSSLKRFKDDAKEVAKGYECGVGIEGCDDMRVGDYIESYKEVEEQASL FT " FT misc_feature 136856..137014 FT /note="HMMPfam hit to PF04760, Translation initiation FT factor IF-2, N-ter, score 8.4e-15" FT /inference="protein motif:Pfam:PF04760" FT misc_feature 137729..137884 FT /note="HMMPfam hit to PF04760, Translation initiation FT factor IF-2, N-ter, score 1.2e-20" FT /inference="protein motif:Pfam:PF04760" FT misc_feature 137963..138466 FT /note="HMMPfam hit to PF00009, Elongation factor Tu GTP FT binding domain, score 2.5e-54" FT /inference="protein motif:Pfam:PF00009" FT misc_feature 137972..138301 FT /note="HMMPfam hit to PF01926, GTPase of unknown FT function,score 8.6e-10" FT /inference="protein motif:Pfam:PF01926" FT misc_feature 137990..138013 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 138533..138724 FT /note="HMMPfam hit to PF03144, Elongation factor Tu domain, FT score 1.3e-08" FT /inference="protein motif:Pfam:PF03144" FT misc_feature 139229..139435 FT /note="HMMPfam hit to PF03144, Elongation factor Tu domain, FT score 1.4e-08" FT /inference="protein motif:Pfam:PF03144" FT misc_feature 139319..139387 FT /note="PS01176 Initiation factor 2 signature" FT /inference="protein motif:Prosite:PS01176" FT CDS 139468..139830 FT /transl_table=11 FT /gene="rbfA" FT /locus_tag="Cj0137" FT /product="putative ribosome-binding factor A" FT /note="Original (2000) note: Cj0137, unknown, len: 120 aa; FT weak similarity to RBFA_BACSU P32731 ribosome-binding FT factor A (P15B PROTEIN) (117 aa), blastp scores; E= FT 0.00012, 25% identity in 106 aa overlap. 41.4% identity to FT HP1047" FT /note="Updated (2006) note: Prosite PS01319 FT RBFA,Ribosome-binding factor A identified within CDS. FT Product modified to more specific family member based on FT motif match. Characterised within Bacillus subtilis and FT Escherichia coli, however, identity scores not acceptable. FT Putative kept within product function. Functional FT classification - Misc" FT /note="PMID:12628255" FT /db_xref="GOA:Q9PIZ0" FT /db_xref="InterPro:IPR000238" FT /db_xref="InterPro:IPR015946" FT /db_xref="InterPro:IPR020053" FT /db_xref="InterPro:IPR023799" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIZ0" FT /inference="protein motif:Prosite:PS01319" FT /protein_id="CAL34308.1" FT /translation="MNPSEIKKLRTESILKELIPEALANLDDENLKNLCVVDVECKKGR FT YDAFVYLDKMFFNVHEQEKILSSLKKASRALQNYCMSEQGWYRCPNFHFKFDDRLEYQN FT HMDALFEKIKKDKNES" FT CDS 139820..140242 FT /transl_table=11 FT /locus_tag="Cj0138" FT /product="conserved hypothetical protein Cj0138" FT /note="Original (2000) note: Cj0138, unknown, len: 140 aa; FT similar to hypothetical proteins e.g. YHBC_ECOLI (152 FT aa),fasta scores; opt: 272 z-score: 436.7 E(): 4.5e-17, FT 41.4% identity in 116 aa overlap. 38.9% identity to HP1046" FT /note="Updated (2006) note: Pfam PF02576 Uncharacterised FT BCR, YhbC family was present within CDS. Conserved added to FT product function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="GOA:Q9PIY9" FT /db_xref="InterPro:IPR003728" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIY9" FT /inference="protein motif:Pfam:PF02576" FT /protein_id="CAL34309.1" FT /translation="MNLEALCKEAGLSFYDDELVSENGRKIYRIYVQKEGGVNLDDCAR FT LSEILSPIFDVESPVNGEYFLEVSSPGLERKLSKIEHFAKSIGELVKITTNEKEKFEAK FT IIAVDDENITLENLENKEKTTINFNDIKKARTFVEW" FT misc_feature 139823..140227 FT /note="HMMPfam hit to PF02576, Uncharacterised BCR, YhbC FT family COG0779, score 1e-62" FT /inference="protein motif:Pfam:PF02576" FT CDS 140289..142640 FT /transl_table=11 FT /locus_tag="Cj0139" FT /product="putative endonuclease" FT /note="Original (2000) note: Cj0139, possible endonuclease, FT len: 783 aa; similar in part to MCRB_ECOLI FT 5-methylcytosine-specific restriction enzyme B (465 FT aa),fasta scores; opt: 305 z-score: 505.4 E(): 6.7e-21, FT 40.9% identity in 186 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF07728 ATPase FT family associated with various cellular activities was FT identified within CDS. Characterised within Eschereichia FT coli with acceptable identity scores. Sequence alignment FT was only partial. Thus, putative kept within product FT function. Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:7781618" FT /db_xref="GOA:Q0PBZ8" FT /db_xref="InterPro:IPR011704" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ8" FT /inference="protein motif:Pfam:PF07728" FT /protein_id="CAL34310.1" FT /translation="MWNLDEKKLQEMLDGFLNFQEVWTLEKVKNMTLEEYTNIKKDNPN FT RDDFTFWIESKLDNLGSIWGGSAFKFGIYRRNDESQKESSSGRLYSQNYAWIAKYGNNE FT NEAFNNIKEKIIQIIQASQDNNLKTIEKIDFGDAIKWKIAFHYQDVKNIKIVNIFSKNV FT LDLISLNEFKEKLKIYQIHKKLLENKNLSLVKMIENIAIPLWNKYGMDSQNYIDKMKNL FT FSEYLNKKKLDKNTINKYIQVIENISKEFLKENLYSCDLFSFDQNINKLNKNEEFKLKN FT SNGHNMYSSALNYYRAFLIDYYEQDIFITERVQSEESNMKIIPLNQILYGPPGTGKTYH FT TIDKALEILGENLESRDEKKAKFDEYVRKGQIVFTTFHQSYGYEEFVEGIKPIIDNDEN FT SQEVKYDVKDGIFKELCDKSLKNYILSMQNENEIDLDKLIFEFANYINQDFLNKGNEFP FT LENKVSIKKILLNFKDEYRSFSLGGSIKSPQSLTIDIIKRDYLNFKNKKILSFKDIKPK FT YDSQSDYHGNAIYYFMFYNKLKEFENIQNEKFKIKKEILKSYIIIIDEINRGNVSKIFG FT ELITLIEPSKRIGEKEELKVTLPYSGEKFGVPKNVYIIGTMNTADRSITSLDTALRRRF FT EFVEMMPDVSKLSMDCEGINLQELLKAINTRIEYLLDREKTIGHAFFVSVENLEDLKKV FT FQNKIIPLLQEYFYNDYALINAVLNDNDMIFEDKKDDKYLQKIKNLDSVNSERSIYNIA FT SFDDKIWDKIEIYQAIYNDEIANKLKNENE" FT misc_feature 141279..141302 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 142633..143964 FT /transl_table=11 FT /locus_tag="Cj0140" FT /product="hypothetical protein Cj0140" FT /note="Original (2000) note: Cj0140, unknown, len: 443 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="InterPro:IPR019292" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ7" FT /protein_id="CAL34311.1" FT /translation="MNSIFSIIEHQAFSKEDLKEIFKEKAEGFYKELEDFAKNNENLLG FT FKNKNSLKAKNYVGIIQTKSGVLEILPKCTNLDSYKKEDSSSNHDKEKLRRCYELDNIS FT KNNDFYEKDFKFNPKNLLINMLKTLKNSPFKKSQISSLQSSKIPLFEVFITMFLDEFDS FT VYKKGLMRSYLSCEENRAFLKGKLLFNEHIKQNLIHKERFFTSNDEFVLDIAPNRLIKS FT TLNFLKSKTSLNKFRLIKAMQMLDEVEFSKNYEKDFSYKISRHFDYYENLLLWCKIFLK FT NESFMPYHGKNEAFALLFPMEKIFEDYVAYMLKKVNSTQDIKVQNNGKYLISKNDENCF FT MLKPDLYIKNKMILDTKWKIPNDSEDEKKQGIAQSDLYQMFAYACKFKIYDIKLVYPLC FT EKTQDLQRKIAEKFFVFKASEHLYFKEQGQKDIKVQVFFAPLPF" FT CDS complement(143953..144756) FT /transl_table=11 FT /locus_tag="Cj0141c" FT /product="putative ABC transporter integral membrane FT protein" FT /note="Original (2000) note: Cj0141c, ABC transporter FT integral membrane protein, len: 267 aa; similar to many FT e.g. MNTB_SYNY3 manganese transport system membrane protein FT (306 aa), fasta scores; opt: 425 z-score: 449.6 E(): FT 8.7e-18, 25.8% identity in 264 aa overlap. No Hp match. FT Contains Pfam match to entry PF00950 ABC-3, ABC 3 transport FT family, score 276.20, E-value 4.3e-79" FT /note="Updated (2006) note: Seven probable transmembrane FT helices predicted by TMHMM2.0. Further support given to FT product function. No specific characterisation with FT acceptable identity score identified. Thus, putative added FT to product function. Functional classification FT -Transport/binding proteins - Other" FT /db_xref="GOA:Q0PBZ6" FT /db_xref="InterPro:IPR001626" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00950" FT /protein_id="CAL34312.1" FT /translation="MLEILNFTFFQNALLGAILVSIACGIIGTLVMINRLFSMAGGITH FT GAFGGIGIAFYFSLPILLSTGIFTLFLAFLVAFLAKRYEHRSDSIIAVIWAFGMAVGII FT LIDLSPSYNTDLMAYLFGSILAVGTQDLWLMALVDSVMVLLIFLFYRQFEALSFDVEFT FT KVRGINTSFFHYLLIALMAFCIVISIRLVGLILVMALLSIPSFIAENFTKRLGFIMILA FT SFLSMIFCILGLILSYYLNLSSGACIIAIACFGFLVHLIGKFLKR" FT misc_feature complement(143968..144741) FT /note="HMMPfam hit to PF00950, ABC 3 transport family,score FT 7.6e-82" FT /inference="protein motif:Pfam:PF00950" FT misc_feature complement(join(144652..144720,144526..144594, FT 144421..144489,144307..144363,144157..144246, FT 144046..144114,143974..144042)) FT /note="7 probable transmembrane helices predicted for FT Cj0141c by TMHMM2.0 at aa 13-35, 55-77, 90-112, FT 132-150,171-200, 215-237 and 239-261" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(144016..144048) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT sig_peptide complement(144643..144756) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000065_143953_144756 by SignalP 2.0 FT HMM (Signal peptide probability 0.645) with cleavage site FT probability 0.464 between residues 38 and 39" FT misc_feature complement(144685..144717) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(144749..145603) FT /transl_table=11 FT /locus_tag="Cj0142c" FT /product="putative ABC transporter ATP-binding protein" FT /note="Original (2000) note: Cj0142c, ABC transporter FT ATP-binding protein, len: 284 aa; simlar to many e.g. FT MNTA_SYNY3 manganese transport system ATP-binding protein FT (260 aa), fasta scores; opt: 417 z-score: 613.7 E(): FT 6.2e-27, 32.9% identity in 252 aa overlap. No Hp ortholog FT but 30.4% identity to HP0250 oligopeptide ABC transporter. FT Contains PS00017 ATP/GTP-binding site motif A FT (P-loop),PS00211 ABC transporters family signature and Pfam FT match to entry PF00005 ABC_tran, ABC transporters, score FT 165.90,E-value 6.9e-46" FT /note="Updated (2006) note: Some characterisation within FT Bacillus subtilis with acceptable identity score. Sequence FT alignment was only partial. Thus, putative added to product FT function. Functional classification -Transport/binding FT proteins - Other" FT /note="PMID:10760146" FT /db_xref="GOA:Q0PBZ5" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ5" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34313.1" FT /translation="MLFFEISNLNYAYDNEIILKNINLSYDNKDFLSIIGPNGAGKSTL FT VKLILGLLKSKNEIHFKALQRKEIGYVPQHTLANPNFCPRVLEIVLMGLVSKKIFGFYG FT KKDKEKAMQALKSVGMEKFWNKTIDSLSGGQRQRVFIARALASECKMLILDEPTASVDN FT KSAIQIFELLISLHQKGMGILLICHDINLVLAYSDKIAHLNKELFLHTNTKEKEKSSFL FT KHLYENHSHFCDVEMSLNTCFCNEENCDSKKLCEQEFTRRNLKKTEFKKENFCLKFSKE FT NNA" FT misc_feature complement(144986..145519) FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 7.4e-49" FT /inference="protein motif:Pfam:PF00005" FT misc_feature complement(145169..145213) FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature complement(145475..145498) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(145616..146506) FT /transl_table=11 FT /locus_tag="Cj0143c" FT /product="putative periplasmic solute binding protein for FT ABC transport system" FT /note="Original (2000) note: Cj0143c, probable periplasmic FT solute binding protein for ABC transport system, len: 296 FT aa; similar to e.g. ZNUA_ECOLI high-affinity zinc uptake FT system protein znuA (328 aa), fasta scores; opt: 386 FT z-score: 471.6 E(): 5.2e-19, 26.4% identity in 288 aa FT overlap. No Hp match. Contains probable N-terminal signal FT sequence and Pfam match to entry PF01297 FT Lipoprotein_4,score 133.20, E-value 4.6e-36" FT /note="Updated (2006) note: Pfam domain PPF01297 FT Periplasmic solute binding protein identified within CDS. FT Further support given to product function. Some FT characterisation within Eschericia coli, however, identity FT score was marginal. Thus, putative kept within product FT function. Paper identified linking protein to glycoprotein FT (PMID:12186869). Also, found to have adhesin family FT signature. Functional classification - Transport/binding FT proteins - Other" FT /note="PMID:9680209, PMID:12186869" FT /db_xref="GOA:Q0PBZ4" FT /db_xref="InterPro:IPR006127" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ4" FT /inference="protein motif:Pfam:PF01297" FT /protein_id="CAL34314.1" FT /translation="MKKIILFILSLGIFYTFTQAKNLEQEQNTSSNLVSVSIAPQAFFV FT KKIAANTLDVNVILPPNSNEHNFEFKPSTMKKLEKSDIYFTIGLEFEKVFTDKFKQNFP FT KLQVINMQKNIALIQTHDTHEHSHEHEHHEHGHFDPHTWLDPILVQTMALNIYDTLIQK FT YPQNENLYKENLDKFLAELDSLNLQIASKLEKLKNREFVVYHPSWTYFAKRYNLTQIPV FT EILGKEPKSKDLQKLITLMKDKNLKVIFVQNGFPENAAKTLAKECDAKIYKIDHLSYDW FT ENELLKTADAFSHNL" FT misc_feature complement(145628..146494) FT /note="HMMPfam hit to PF01297, Periplasmic solute binding FT protein family, score 6.1e-62" FT /inference="protein motif:Pfam:PF01297" FT sig_peptide complement(146432..146506) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000067_145616_146506 by SignalP 2.0 FT HMM (Signal peptide probability 0.895) with cleavage site FT probability 0.415 between residues 25 and 26" FT CDS 146705..148684 FT /transl_table=11 FT /locus_tag="Cj0144" FT /product="putative methyl-accepting chemotaxis signal FT transduction protein" FT /note="Original (2000) note: Cj0144, probable FT methyl-accepting chemotaxis signal transduction FT protein,len: 659 aa; similar to mnay e.g. MCPS_ENTAE FT methyl-accepting chemotaxis serine transducer (557 FT aa),fasta scores; opt: 297 z-score: 493.4 E(): 3.2e-20, FT 28.6% identity in 377 aa overlap. No Hp ortholog. FT C-terminus contains repeat1, and is identical to the other FT repeat 1-containing genes Cj0262c and Cj1564. Contains FT N-terminal signal sequence and transmembrane anchor around FT aa 300. Also contains Pfam match to entry PF00015 FT MCPsignal,Methyl-accepting chemotaxis protein (MCP) FT signaling domain, score 110.60, E-value 4.1e-30" FT /note="Updated (2006) note: Some characterisation work FT within Bacillus subtilis and Escherichia coli, FT however,identity scores were unnacceptable. Thus, putative FT kept within product function. Functional classification FT -Chemotaxis and mobility" FT /note="PMID:6213619, PMID:7921238" FT /db_xref="GOA:Q0PBZ3" FT /db_xref="InterPro:IPR004010" FT /db_xref="InterPro:IPR004089" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ3" FT /inference="protein motif:Pfam:PF00015" FT /protein_id="CAL34315.1" FT /translation="MKSVKLKVSLIANLIAVVCLIILGVVTFIFVKQAIFHEVVNAEIN FT YVKTAKNSIESFKARNSLALESLAKSILKHPIEQLDSQDALMHYVGKDLKNFRDAGRFL FT AVYIAQPNGELVVSDPDSDAKNLDFGTYGKADNYDARTREYYIEAVKTNKLYITPSYID FT VTTNLPCFTYSIPLYKDGKFIGVLAVDILAADLQAEFENLPGRTFVFDEENKVFVSTDK FT ALLQKGYDISAIANLAKTKEDLEPFEYTRPKDGNERFAVCTKVSGIYTACVGEPIEQIE FT APVYKIAFIQTAIVIFTSIISVILLYFIVSKYLSPLAAIQTGLTSFFDFINYKTKNVST FT IEVKSNDEFGQISNAINENILATKRGLEQDNQAVKESVQTVSVVEGGNLTARITANPRN FT PQLIELKNVLNKLLDVLQARVGSDMNAIHKIFEEYKSLDFRNKLENASGSVELTTNALG FT DEIVKMLKQSSDFANALANESGKLQTAVQSLTTSSNSQAQSLEETAAALEEITSSMQNV FT SVKTSDVITQSEEIKNVTGIIGDIADQINLLALNAAIEAARAGEHGRGFAVVADEVRKL FT AERTQKSLSEIEANTNLLVQSINDMAESIKEQTAGITQINDSVAQIDQTTKDNVEIANE FT SAIISSTVSDIANNILEDVKKKRF" FT sig_peptide 146705..146830 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000068_146705_148684 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.672 between residues 42 and 43" FT misc_feature order(146732..146800,147563..147631) FT /note="2 probable transmembrane helices predicted for FT Cj0144 by TMHMM2.0 at aa 10-32 and 287-309" FT /inference="protein motif:TMHMM:2.0" FT repeat_region 147606..148684 FT /note="repeat 1: identical to complement(238817..239964) FT and 1492913..1493990 (approximate numbers)" FT misc_feature 148184..148678 FT /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis FT protein (MCP) s, score 6.4e-21" FT /inference="protein motif:Pfam:PF00015" FT CDS 148819..150600 FT /transl_table=11 FT /locus_tag="Cj0145" FT /product="putative TAT (Twin-Arginine Translocation) FT pathway signal sequence domain protein" FT /note="Original (2000) note: Cj0145, unknown, len: 593 aa; FT some similarity to a hypothetical protein from Streptomyces FT coelicolor TR:O69840 (EMBL:AL023517) SC1B5.12C (465 aa), FT fasta scores; opt: 124 z-score: 327.1 E(): 5.8e-11, 23.0% FT identity in 574 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF05787 Bacterial FT protein of unknown function (DUF83), identified within CDS. FT TIGRFAM TIGR01409 TAT_signal_seq, Tat (twin-arginine FT translocation) pathway signal sequence identified within FT CDS. Product modified to more specific family member based FT on motif search results. No specific characterisation with FT acceptable identity scores carried out yet. Thus, putative FT kept within product function. Functional classification FT -Misc" FT /note="PMID:10766774" FT /db_xref="InterPro:IPR008557" FT /db_xref="InterPro:IPR011042" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ2" FT /inference="protein motif:Pfam:PF05787" FT /protein_id="CAL34316.1" FT /translation="MERRLFLKGSALGSMVAFFASSNLSAAMLKDKDLLGFKAVSASTQ FT DKVIVPQGYEAKVLISWGDPLFSKAKPYDENKIIDMNAVKNAHLVFGDDNDGMSFFPLS FT KNRGILAVNNEYINPEIMFNHHGKNLSKEDILYEQASVGVSILEIEKKGDDWTVVLDSK FT YNRRIDANTKMQVSGAAKKEVLKNEKFVHGTFANCANGQTPWGTYITCEENFDDFFGSL FT DENLEFNDSLKRYGFNKTSLYGWEKFDERFDLAKNMDEANRFGWIVEINPFDAQSTPVK FT RTSLGRFKHENAEIIVEKDGSVIVYMGDDEMNEFIYKFVSKHKYKKGADTSKILDEGIL FT YVGQFNGNVGDFKGQGKWIALEYGKNSLNEKNGFKSQAQVLINTRLAASIVGATPMDRC FT EWIASHKQSGSKEVFATLTNNKNRQEPNAANPRTKNVYGQILKWMPKNSHKDDDFTWEI FT FALAGNPDNQQGLYKGSNNITSENKFNSPDGLKFDRDGRLWIQTDGSYSNKDEYESMGN FT NCMLAANPKTGEIRRFLTGPIACELTGIAFSEDYTTMFVGIQHPGEGLKGSTFPYGKTP FT RSSVMMIRKLDGGVIGS" FT sig_peptide 148819..148905 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000069_148819_150600 by SignalP 2.0 FT HMM (Signal peptide probability 0.997) with cleavage site FT probability 0.477 between residues 29 and 30" FT misc_feature 148819..150504 FT /note="HMMPfam hit to PF05787, Bacterial protein of unknown FT function (DUF83, score 0" FT /inference="protein motif:Pfam:PF05787" FT CDS complement(150638..151576) FT /transl_table=11 FT /gene="trxB" FT /locus_tag="Cj0146c" FT /product="thioredoxin reductase" FT /EC_number="1.8.1.9" FT /note="Original (2000) note: Cj0146c, trxB, probable FT thioredoxin reductase, len: 312 aa; similar to many e.g. FT TRXB_LISMO thioredoxin reductase (EC 1.6.4.5) (319 FT aa),fasta scores; opt: 749 z-score: 926.7 E(): 0, 38.0% FT identity in 313 aa overlap. 64.2% identity to HP0825. FT Contains PS00573 Pyridine nucleotide-disulphide FT oxidoreductases class-II active site" FT /note="Updated (2006) note: Pfam domain PF00070 Pyridine FT nucleotide-disulphide oxidoreductase identified within CDS. FT Further support given to product function. Characterised FT within Listeria monocytogenes with acceptable identity FT scores. Appropriate motifs identified. Thus, putative not FT added to product function. Functional classification - FT Biosynthesis of cofactors, prosthetic groups and carriers - FT Thioredoxin" FT /note="PMID:2644268, PMID:15358361" FT /db_xref="GOA:Q0PBZ1" FT /db_xref="InterPro:IPR000103" FT /db_xref="InterPro:IPR001327" FT /db_xref="InterPro:IPR005982" FT /db_xref="InterPro:IPR008255" FT /db_xref="InterPro:IPR013027" FT /db_xref="InterPro:IPR023753" FT /db_xref="PDB:3R9U" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ1" FT /inference="protein motif:Pfam:PF00070" FT /inference="protein motif:Prosite:PS00573" FT /protein_id="CAL34317.1" FT /translation="MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSE FT IENYPGVAQVMDGISFMAPWSEQCMRFGLKHEMVGVEQILKNSDGSFTIKLEGGKTELA FT KAVIVCTGSAPKKAGFKGEDEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYL FT ANICSKIYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVAGVKVKLKD FT GSIRDLNVPGIFTFVGLNVRNEILKQDDSKFLCNMEEGGQVSVDLKMQTSVAGLFAAGD FT LRKDAPKQVICAAGDGAVAALSAMAYIESLH" FT misc_feature complement(150716..151570) FT /note="HMMPfam hit to PF00070, Pyridine FT nucleotide-disulphide oxidoreducta, score 6e-58" FT /inference="protein motif:Pfam:PF00070" FT misc_feature complement(151115..151177) FT /note="PS00573 Pyridine nucleotide-disulphide FT oxidoreductases class-II active site" FT /inference="protein motif:Prosite:PS00573" FT CDS complement(151710..152024) FT /transl_table=11 FT /gene="trxA" FT /locus_tag="Cj0147c" FT /product="thioredoxin" FT /note="Original (2000) note: Cj0147c, trxA, FT thioredoxin,len: 104 aa; highly similar to many e.g. FT THIO_ECOLI thioredoxin 1 (108 aa), fasta scores; opt: 344 FT z-score: 590.5 E(): 1.2e-25, 45.7% identity in 105 aa FT overlap. 68.6% identity to HP0824. Contains PS00194 FT Thioredoxin family active site and Pfam match to entry FT PF00085 thiored, Thioredoxins, score 144.20, E-value FT 3.6e-42" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Thus,putative not added to product function. Appropiate FT motifs present. Paper identified linking protein to FT glycoprotein. Functional classification - Biosynthesis of FT cofactors,prosthetic groups and carriers - Thioredoxin" FT /note="PMID:12186869, PMID:15358361" FT /db_xref="GOA:Q0PBZ0" FT /db_xref="InterPro:IPR005746" FT /db_xref="InterPro:IPR012336" FT /db_xref="InterPro:IPR013766" FT /db_xref="InterPro:IPR017937" FT /db_xref="UniProtKB/TrEMBL:Q0PBZ0" FT /inference="protein motif:Pfam:PF00085" FT /inference="protein motif:Prosite:PS00194" FT /protein_id="CAL34318.1" FT /translation="MGKYIELTSDNFAQAKEGVALVDFWAPWCGPCRMLAPVIDELSND FT FDGKAKICKVNTDEQGDLAAEFGVRSIPTLIFFKNGEVVDQLVGAQSKQAISDKLNSLL FT " FT misc_feature complement(151713..152018) FT /note="HMMPfam hit to PF00085, Thioredoxin, score 6.9e-39" FT /inference="protein motif:Pfam:PF00085" FT misc_feature complement(151908..151964) FT /note="PS00194 Thioredoxin family active site" FT /inference="protein motif:Prosite:PS00194" FT CDS complement(152081..152419) FT /transl_table=11 FT /locus_tag="Cj0148c" FT /product="conserved hypothetical protein Cj0148c" FT /note="Original (2000) note: Cj0148c, unknown, len: 112 aa; FT similar to hypothetical proteins e.g. TR:G3323225 FT (EMBL:AE001259) Treponema pallidum TP0913 (126 aa), fasta FT scores; opt: 156 z-score: 253.1 E(): 7.6e-07, 31.0% FT identity in 100 aa overlap. 47.1% identity to HP0823" FT /note="Updated (2006) note: Pfam PF02021 Uncharacterised FT protein family was present within CDS. Conserved added to FT product function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="GOA:Q9PIX9" FT /db_xref="InterPro:IPR003509" FT /db_xref="InterPro:IPR011335" FT /db_xref="InterPro:IPR011856" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIX9" FT /inference="protein motif:Pfam:PF02021" FT /protein_id="CAL34319.1" FT /translation="MGVKAYLDGILGEDKACKFLKKQGFEILKRNFHSKFGEIDIIAKK FT DEILHFIEVKFTQNDYEVSERLDRKKLEKILKTIEFYHLKNGISSDFQIDLICIKNDVI FT QFCENISF" FT misc_feature complement(152120..152389) FT /note="HMMPfam hit to PF02021, Uncharacterised protein FT family UPF0102, score 6e-16" FT /inference="protein motif:Pfam:PF02021" FT CDS complement(152419..153666) FT /transl_table=11 FT /gene="hom" FT /locus_tag="Cj0149c" FT /product="homoserine dehydrogenase" FT /EC_number="1.1.1.3" FT /note="Original (2000) note: Cj0149c, hom, probable FT homoserine dehydrogenase, len: 415 aa; similar to many e.g. FT DHOM_BACSU homoserine dehydrogenase (EC 1.1.1.3) (433 aa), FT fasta scores; opt: 932 z-score: 1191.7 E(): 0, 36.4% FT identity in 426 aa overlap. 53.3% identity to HP0822. FT Contains PS01042 Homoserine dehydrogenase signature and FT Pfam match to entry PF00742 Homoserine_dh, Homoserine FT dehydrogenase, score 329.20, E-value 4.7e-95" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Amino acid FT biosynthesis - Aspartate family" FT /note="PMID:3139660" FT /db_xref="GOA:Q0PBY8" FT /db_xref="InterPro:IPR001342" FT /db_xref="InterPro:IPR002912" FT /db_xref="InterPro:IPR005106" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR016204" FT /db_xref="InterPro:IPR019811" FT /db_xref="UniProtKB/TrEMBL:Q0PBY8" FT /inference="protein motif:Pfam:PF00742" FT /inference="protein motif:Prosite:PS01042" FT /protein_id="CAL34320.1" FT /translation="MKVAILGYGTVGSAVVKFLLENDKLIRARCGQSITPVIALARSPK FT KNALIPITHSVAEILNADVDVFVELMGGVDEAFKIVSEILKKKKAVVTANKAMLAYHRY FT ELENLAKNLAFGYEASVAGGIPIIKVLKEGLSANNILAIKGILNGTSNYILSSMSQKNM FT SFKQALQIAQNLGYAEADPTFDIEGQDAAHKLLVLSSIAYNLKAKPEDILIEGISEIAP FT EDMYFANEFEFTIKLLGIAKVRENKVELRVHPTMIDKEKMLAKVDGVMNAISINGDLLG FT ESLYYGAGAGGEATASAVISDLMDIARDQVKAPMLGFVNTLEYKLLSKDEIYTKYYLRV FT KVEDKIGILSKITQLMSENNISIDSFLQKPKKNDENYSTLFFTTHLTYEKSIQNLLEIL FT RKQDFIKTKPFMMRIE" FT misc_feature complement(152437..152661) FT /note="HMMPfam hit to PF01842, ACT domain, score 2e-10" FT /inference="protein motif:Pfam:PF01842" FT misc_feature complement(152755..153291) FT /note="HMMPfam hit to PF00742, Homoserine FT dehydrogenase,score 2.7e-73" FT /inference="protein motif:Pfam:PF00742" FT misc_feature complement(153085..153153) FT /note="PS01042 Homoserine dehydrogenase signature" FT /inference="protein motif:Prosite:PS01042" FT misc_feature complement(153295..153666) FT /note="HMMPfam hit to PF03447, Homoserine dehydrogenase,NAD FT binding d, score 3.1e-13" FT /inference="protein motif:Pfam:PF03447" FT CDS complement(153670..154872) FT /transl_table=11 FT /locus_tag="Cj0150c" FT /product="aminotransferase" FT /EC_number="2.6.1.1" FT /note="Original (2000) note: Cj0150c, probable FT aminotransferase, len: 400 aa; similar to many hypothetical FT aminotransferases and to e.g. AAT2_BACSU probable aspartate FT aminotransferase (EC 2.6.1.1) (399 aa),fasta scores; opt: FT 722 z-score: 1151.8 E(): 0, 33.8% identity in 390 aa FT overlap, and AAT_BACST aspartate aminotransferase (393 aa), FT fasta scores; opt: 513 z-score: 536.0 E(): 1.3e-22, 28.9% FT identity in 377 aa overlap. No Hp ortholog. Contains Pfam FT match to entry PF00155 aminotran_1, Aminotransferases FT class-I, score 129.10,E-value 8.1e-35" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Misc" FT /note="PMID:12022921" FT /db_xref="GOA:Q0PBY7" FT /db_xref="InterPro:IPR004839" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:Q0PBY7" FT /inference="protein motif:Pfam:PF00155" FT /protein_id="CAL34321.1" FT /translation="MFDEIRFNTIERLPNYVFAEVNAIKMAARRAGEDIIDFSMGNPNG FT KTPQHIIDKLCESANKDKTSGYSTSMGIYKLRLAICNWYKRKYNVNLDPENEVVATMGS FT KEGFVNLARAIINPGDVAIVPTPAYPIHTQAFIIAGGNVAKMPLAYNEKFELDENQFFE FT NLHKTLNESIPCPKYVVVNFPHNPTTVTCEKSFYERLIATAKKERFYIISDIAYADLTY FT DDYKTPSILEIEGAKDVAVETYTLSKSYNMAGWRVGFVVGNKRLVSALKKIKSWFDYGM FT YTPIQVAATIALDGDQTCVDEIRATYDKRMHILLEAFENAGWKLQKPRASMFVWAKLPE FT SKRHLKSLEFSKQLLQRASVAVSPGVGFGEAGDEYVRIALIENENRIRQAARNIKKYLK FT E" FT misc_feature complement(153679..154629) FT /note="HMMPfam hit to PF00155, Aminotransferase class I and FT II, score 1.3e-29" FT /inference="protein motif:Pfam:PF00155" FT CDS complement(154884..155690) FT /transl_table=11 FT /locus_tag="Cj0151c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0151c, possible periplasmic FT protein, len: 268 aa; 26.0% identity to HP0555. Contains FT possible N-terminal signal sequence. Functional FT classification - Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PBY6" FT /protein_id="CAL34322.1" FT /translation="MVKKIIILTFWVNISFAISSLELAKNLVNNPSKNSQLELLFSNNS FT YIDNNGNCDIAKISQILKTNSLIALTLSNPQSLRLNFKAKADEVMFFKILSDVLTDAGY FT IYFIPTDLILREGNIDYTIQVESQYVLDPGTLYNLLKENSVYINNIKRIGVYDYEYDLN FT FSNAVLKTNTNVNLNTPKSLEKPLKDYVLDLKNATNLIIDANDLDNWFPKIFFLDKNLN FT LIKAVKSENKNNHFSELIPNGAIYAIVSDMYSLDNIRRGLKITLKK" FT sig_peptide complement(155640..155690) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000072_154884_155690 by SignalP 2.0 FT HMM (Signal peptide probability 0.634) with cleavage site FT probability 0.438 between residues 17 and 18" FT CDS complement(155684..156622) FT /transl_table=11 FT /locus_tag="Cj0152c" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0152c, possible membrane FT protein, len: 312 aa; 25.0% identity to HP0554. Contains FT one probable transmembrane domain around aa 110. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PBY5" FT /protein_id="CAL34323.1" FT /translation="MLNWKKIQELNLKEVAAKTQIELDFLEALVEKNFAVLSRFNVKGF FT VKILSREYELDFSDFNEEYEAYLNENNPTPQTKSKMITPKLDAYSQKSFNTWPFLIVLI FT VLVIIGSGIYYFDTLKTFFKDEQNNTSATVIDIIGQAQENLKSLGGNNVVVIDNNKAQE FT TNRTESVLPSQNISLQENDKNISIENNISENNTTLLDEEKNTQIQEDTNTPKTDSLKEA FT HFKTSTKIWIGLIDLKSLKKTSFVKEKDFNISLDKDQLILTGAAALTMFDQENKEQKFP FT AGISKRFLIKDGKITSISAAEFVKLNKGKEW" FT misc_feature complement(156275..156343) FT /note="1 probable transmembrane helix predicted for Cj0152c FT by TMHMM2.0 at aa 94-116" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(156615..157298) FT /transl_table=11 FT /locus_tag="Cj0153c" FT /product="putative rRNA methylase" FT /note="Original (2000) note: Cj0153c, probable rRNA FT methylase, len: 227 aa; similar to members of the spoU FT family e.g. NHS_STRAS 23S rRNA methyltransferase (274 aa), FT fasta scores; opt: 197 z-score: 247.9 E(): 1.5e-06,29.9% FT identity in 157 aa overlap. 42.7% identity to HP0553. FT Contains Pfam match to entry PF00588 SpoU_methylase, SpoU FT rRNA Methylase family, score 106.90,E-value 3.8e-28" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity score. Putative FT kept within product function. Functional classification FT -RNA synthesis, RNA modification and DNA transcription" FT /note="PMID:11698387" FT /db_xref="GOA:Q0PBY4" FT /db_xref="InterPro:IPR001537" FT /db_xref="InterPro:IPR004441" FT /db_xref="InterPro:IPR013123" FT /db_xref="UniProtKB/TrEMBL:Q0PBY4" FT /inference="protein motif:Pfam:PF00588" FT /protein_id="CAL34324.1" FT /translation="MIVYGKQIFFYILEYHKDCINELYLAKECDKITFSKIAKSGFKIK FT KLDFKTAQAYAKGGNHQGFLLDIKESSFANLNEIKKNDFIVMLYGISDVGNIGAITRTA FT YALGVGALIFIGEKLAMEGVIRTSSGAALDLPIVISNDALSVINELKQVGFYFYASDGS FT GKEIHSVKISNGKKVLVLGSEGFGLSSKIVKKCDECVGIAMKNNFDSLNVSAAFAILCD FT RMLNA" FT misc_feature complement(156633..157052) FT /note="HMMPfam hit to PF00588, SpoU rRNA Methylase FT family,score 7e-28" FT /inference="protein motif:Pfam:PF00588" FT CDS complement(157312..158136) FT /transl_table=11 FT /locus_tag="Cj0154c" FT /product="putative tetrapyrrole methylase family protein" FT /note="Original (2000) note: Cj0154c, possible FT methylase,len: 274 aa; similar to hypotehtical proteins FT e.g. YABC_BACSU (292 aa), fasta scores; opt: 453 z-score: FT 741.0 E(): 0, 32.9% identity in 289 aa overlap. 42.3% FT identity to HP0552. Contains PS01296 Uncharacterized FT protein family UPF0011 signature and Pfam match to entry FT PF00590 TP_methylase, Tetrapyrrole (Corrin/Porphyrin) FT Methylases.,score 81.20, E-value 2.2e-20" FT /note="Updated (2006) note: Pfam domain PF00590 FT Tetrapyrrole (Corrin/Porphyrin) Methylase was identified FT within CDS. Product modified to more specific family member FT due to motif match. No specific characterisation with FT acceptable identity score has yet been carried out. Thus, FT putative kept within product function. Functional FT classification - Misc" FT /db_xref="GOA:Q0PBY3" FT /db_xref="InterPro:IPR000878" FT /db_xref="InterPro:IPR008189" FT /db_xref="InterPro:IPR014777" FT /db_xref="InterPro:IPR018063" FT /db_xref="UniProtKB/TrEMBL:Q0PBY3" FT /inference="protein motif:Pfam:PF00590" FT /inference="protein motif:Prosite:PS01296" FT /protein_id="CAL34325.1" FT /translation="MLYFIPTPIGNLSDISFRALELLKTCDLVFCEDTRVSKSLISLLN FT TKFHTDIHISKFIALHSHNEKEVLASIDLKIFEKNVAYLSDAGMPGISDPGKALVEFAQ FT ENNITYEILPGANAALVALVSSAFCQKEFIFIGFLANKGKERQKDIEKILNFPYPSIIY FT ESPKRILSLVEQIMILDNQREIFLIKEISKKFEKKFKGNAKELSEILKKSNLNGEWVVV FT LQSKEQNFLQNTLCEKDIMDLELSLKAKAKLLSKINGKNAKEIYQKLLLSQD" FT misc_feature complement(157516..158136) FT /note="HMMPfam hit to PF00590, Tetrapyrrole FT (Corrin/Porphyrin) Methylas, score 9.6e-20" FT /inference="protein motif:Pfam:PF00590" FT misc_feature complement(157849..157884) FT /note="PS01296 Uncharacterized protein family UPF0011 FT signature" FT /inference="protein motif:Prosite:PS01296" FT CDS complement(158139..158339) FT /transl_table=11 FT /gene="rpmE" FT /locus_tag="Cj0155c" FT /product="50S ribosomal protein L31" FT /note="Original (2000) note: Cj0155c, rpmE, probable 50S FT ribosomal protein L31, len: 66 aa; highly similar to many FT e.g. RL31_BACSU 50S ribosomal protein L31 (66 aa), fasta FT scores; opt: 271 z-score: 544.9 E(): 4.3e-23, 54.5% FT identity in 66 aa overlap. 58.2% identity to HP0551. FT Contains PS01143 Ribosomal protein L31 signature and Pfam FT match to entry PF01197 Ribosomal_L31, Ribosomal protein FT L31, score 142.80, E-value 6.1e-39" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity scores. Thus, putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:7026537, PMID:15049826" FT /db_xref="GOA:Q9PIX2" FT /db_xref="InterPro:IPR002150" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIX2" FT /inference="protein motif:Pfam:PF01197" FT /inference="protein motif:Prosite:PS01143" FT /protein_id="CAL34326.1" FT /translation="MKKEIHPEYVECKVSCACGNTFTTKSNKAELRVDICSNCHPFFTG FT SEKIVDAAGRVEKFKKKYAMQ" FT misc_feature complement(158142..158339) FT /note="HMMPfam hit to PF01197, Ribosomal protein L31,score FT 4.2e-40" FT /inference="protein motif:Pfam:PF01197" FT misc_feature complement(158166..158222) FT /note="PS01143 Ribosomal protein L31 signature" FT /inference="protein motif:Prosite:PS01143" FT misc_feature complement(158217..158234) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT CDS complement(158418..159074) FT /transl_table=11 FT /locus_tag="Cj0156c" FT /product="conserved hypothetical protein Cj0156c" FT /note="Original (2000) note: Cj0156c, unknown, len: 218 aa; FT similar to hypothetical proteins e.g. YGGJ_ECOLI (243 aa), FT fasta scores; opt: 166 z-score: 226.2 E(): 2.4e-05,25.7% FT identity in 222 aa overlap. 43.7% identity to HP0374" FT /note="Updated (2006) note: Pfam PF04452 Protein of unknown FT function (DUF558) was present within CDS. Conserved added FT to product function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="GOA:Q0PBY1" FT /db_xref="InterPro:IPR006700" FT /db_xref="UniProtKB/TrEMBL:Q0PBY1" FT /inference="protein motif:Pfam:PF04452" FT /protein_id="CAL34327.1" FT /translation="MQFLYNKQAGEEFIQLQGENFNHLKVRRVKENSELNLRNLQDNFL FT YNYTITNLTRNSCTLKFLNKKSQNIKQSELNLALAIIDIKILEKTLPFLNELGVKKLHL FT VFTNFSQRNFKIDLERFEKIIISSCEQCGRNTKMDLIIHQSTQEFVQKFPNAIMVDFQG FT EQQSHFDEKELYFIGPEGGFNNDERLLFNRKISLKSSNILKSQTAIIAIASKILL" FT misc_feature complement(158424..158711) FT /note="HMMPfam hit to PF04452, Protein of unknown function FT (DUF558), score 1.2e-28" FT /inference="protein motif:Pfam:PF04452" FT CDS complement(159076..159483) FT /transl_table=11 FT /locus_tag="Cj0157c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0157c, probable integral FT membrane protein, len: 135 aa; no Hp match. Contains four FT probable transmembrane domains. Functional classification - FT Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PBY0" FT /protein_id="CAL34328.1" FT /translation="MDQSYEFFLALHLYSLYASGFLMLFYLILTQGNFKTEFIFIRRIR FT LFLPIYYLFLALIIFTGCLLSAMKQFQMNVNIWVMIFSWILIFALAIFHFVCFKKARRF FT RKYATFRWISCLILPFEIFLLFLPFLIERYL" FT misc_feature complement(join(159397..159456,159280..159348, FT 159193..159252,159091..159159)) FT /note="4 probable transmembrane helices predicted for FT Cj0157c by TMHMM2.0 at aa 10-29, 46-68, 78-97 and 109-131" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(159295..159327) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(159483..159908) FT /transl_table=11 FT /locus_tag="Cj0158c" FT /product="putative haem-binding lipoprotein" FT /note="Original (2000) note: Cj0158c, possible haem-binding FT lipoprotein, len: 141 aa; no Hp match. Contains N-terminal FT signal sequence with appropriately positioned PS00013 FT Prokaryotic membrane lipoprotein lipid attachment site, FT PS00190 Cytochrome c family heme-binding site signature, FT and Pfam match to entry PF00034 cytochrome_c, Cytochrome c, FT score -3.00, E-value 0.87" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores identified yet. Putative FT kept within product function. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PBX9" FT /db_xref="InterPro:IPR009056" FT /db_xref="UniProtKB/TrEMBL:Q0PBX9" FT /inference="protein motif:Pfam:PF00034" FT /inference="protein motif:Prosite:PS00190" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34329.1" FT /translation="MQKAKILIALSFFLLVLSACSNDEKNISKTQNTDQEVVQIEQNDE FT KTELSDSNLPLPVDDEAQSSNDEHEVNPSIINSLYKQKCATCHGEKGELKPKNSTAIKT FT LSNKIFIQKIKTIKDKNHSFLSDEQIQNLADFINKGK" FT misc_feature complement(159486..159689) FT /note="HMMPfam hit to PF00034, Cytochrome c, score 0.041" FT /inference="protein motif:Pfam:PF00034" FT misc_feature complement(159642..159659) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT sig_peptide complement(159831..159908) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000078_159483_159908 by SignalP 2.0 FT HMM (Signal peptide probability 0.997) with cleavage site FT probability 0.495 between residues 26 and 27" FT misc_feature complement(159849..159881) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(159908..160489) FT /transl_table=11 FT /locus_tag="Cj0159c" FT /product="putative 6-pyruvoyl tetrahydropterin synthase" FT /EC_number="4.2.3.12" FT /note="Original (2000) note: Cj0159c, unknown, len: 193 aa; FT similar in N-terminus to hypothetical proteins FT e.g.TR:O27296 (EMBL:AE000890) Methanobacterium FT thermoautotrophicum MTH1228 (161 aa), fasta scores; opt: FT 140 z-score: 234.0 E(): 8.9e-06, 37.9% identity in 66 aa FT overlap. 35.8% identity to HP0933" FT /note="Updated (2006) note: Pfam domain PF01242 6-pyruvoyl FT tetrahydropterin synthase was identified within CDS. FT Product modified to more specific family member due to FT motif match with own search. No specific characterisation FT with acceptable identity scores carried out yet. FT Thus,putative kept within product function. Functional FT classification - Misc" FT /db_xref="GOA:Q0PBX8" FT /db_xref="InterPro:IPR007115" FT /db_xref="UniProtKB/TrEMBL:Q0PBX8" FT /inference="protein motif:Pfam:PF01242" FT /protein_id="CAL34330.1" FT /translation="MIIRKLFEFENAHIVRFCSSKRCKSSIHGHSYKVEVLLESKYLDN FT AGMVYDFGLLKTYIRQIIDSFDHAITLFKYDDAKYLEEMKKYSSRWICLPVNVSAENFC FT RVFFILIDALLKQTKMVNGEQGVTLQSIIVHETRTGYAQGFREDAYSELMPKISLQDIE FT FSNGIKAEWNDIDFYNKLKNEEIFINPKEI" FT CDS complement(160486..161229) FT /transl_table=11 FT /locus_tag="Cj0160c" FT /product="putative radical SAM domain protein" FT /note="Original (2000) note: Cj0160c, unknown, len: 247 aa; FT similar to hypothetical proteins e.g. TR:O67826 FT (EMBL:AE000769) Aquifex aeolicus AQ_2035 (219 aa), fasta FT scores; opt: 130 z-score: 282.9 E(): 1.7e-08, 28.8% FT identity in 233 aa overlap. 43.1% identity to HP0934" FT /note="Updated (2006) note: Pfam domain PF04055 Radical SAM FT superfamily was identified within CDS. Product modified to FT more specific family member due to motif match. No specific FT characterisation carried out yet, so putative kept within FT product function. Functional classification - Misc" FT /db_xref="InterPro:IPR024924" FT /db_xref="UniProtKB/TrEMBL:Q0PBX7" FT /inference="protein motif:Pfam:PF04055" FT /protein_id="CAL34331.1" FT /translation="MQLVESFLSIQGEGKYNGKLAIFMRFAGCNFNCLGFNVKISKNDK FT TLIGCDTIRAVFTKDFKESYETLNANELLKRVIKLKKDFDPIVVITGGEPLIHYENPEF FT IEFIQMLLKNKFEIHFESNGSIEIDFDRYPFYKECIFALSVKLQNSGIKKDKRLNFKAL FT KAFKNYAKDSFYKFVLDANTLDNSFLEINEILKEAPNQIFCMPMGENEQNLKKNAQKIA FT EFCIKNGYNYSDRIHIRLWNDKEGV" FT misc_feature complement(160567..161163) FT /note="HMMPfam hit to PF04055, Radical SAM FT superfamily,score 3.1e-08" FT /inference="protein motif:Pfam:PF04055" FT CDS complement(161232..162194) FT /transl_table=11 FT /gene="moaA" FT /locus_tag="Cj0161c" FT /product="putative molybdenum cofactor biosynthesis protein FT A" FT /note="Original (2000) note: Cj0161c, moaA, probable FT molybdenum cofactor biosynthesis protein A, len: 320 aa; FT similar to many e.g. MOAA_ECOLI molybdenum cofactor FT biosynthesis protein A (329 aa), fasta scores; opt: 590 FT z-score: 824.3 E(): 0, 32.4% identity in 312 aa overlap. FT 51.7% identity to HP0768. Also similar to Cj1244 (29.8% FT identity in 178 aa overlap). Contains PS01305 moaA / nifB / FT pqqE family signature" FT /note="Updated (2006) note: Pfam domains PF06463 Molybdenum FT Cofactor Synthesis C and PF04055 Radical SAM superfamily FT were identified within CDS. Further support given to FT product funtion. Characterisation work carried out within FT Escherichia coli with marginal identity score. Putative FT kept within product function. Functional classification - FT Biosynthesis of cofactors, prosthetic groups and carriers - FT Molybdopterin" FT /note="PMID:8361352" FT /db_xref="GOA:Q9PIW6" FT /db_xref="InterPro:IPR000385" FT /db_xref="InterPro:IPR006638" FT /db_xref="InterPro:IPR007197" FT /db_xref="InterPro:IPR010505" FT /db_xref="InterPro:IPR013483" FT /db_xref="InterPro:IPR013785" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIW6" FT /inference="protein motif:Pfam:PF04055" FT /inference="protein motif:Pfam:PF06463" FT /inference="protein motif:Prosite:PS01305" FT /protein_id="CAL34332.1" FT /translation="MLIDQFGRKINYLRISVTQRCNFRCLYCMPKIPFDYQPKENLLSF FT EELFLFVKAAIDEGIEKIRITGGEPLLRKDLSIFIKMISDYKSDIDLAITTNGFLLKDF FT AKDLKNAGLKRLNISLDTLDHKKAKTLAQKDVLDSVLSGIDEALNLDLKVKLNTVALKN FT LNDDELISLLEFAKSKKAQIRFIEFMENTHAYGKLQGLKRDEIIQILSQKYQIQLIKKD FT EKAPVSIYKADDYEFGIIDPHSHEFCDSCNRIRLSAEGLLIPCLYFDEALSIKEAVRKG FT DIKAAVEILQEVLRNKPEKNKWSVVDNETSSRAFYQTGG" FT misc_feature complement(161286..161654) FT /note="HMMPfam hit to PF06463, Molybdenum Cofactor FT Synthesis C, score 1.5e-47" FT /inference="protein motif:Pfam:PF06463" FT misc_feature complement(161667..162152) FT /note="HMMPfam hit to PF04055, Radical SAM FT superfamily,score 5.8e-38" FT /inference="protein motif:Pfam:PF04055" FT misc_feature complement(162111..162146) FT /note="PS01305 moaA / nifB / pqqE family signature" FT /inference="protein motif:Prosite:PS01305" FT CDS complement(162207..162722) FT /transl_table=11 FT /locus_tag="Cj0162c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0162c, probable periplasmic FT protein, len: 171 aa; no Hp match. Contains probable FT N-terminal signal sequence. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="GOA:Q0PBX5" FT /db_xref="InterPro:IPR012287" FT /db_xref="UniProtKB/TrEMBL:Q0PBX5" FT /protein_id="CAL34333.1" FT /translation="MSDDVLYLVFIIVLLIAMLAYMNIKERENNAKIAKLQNVIEDITK FT ELHYFRKELGVKDDSEEDEDYKTSLLKEEIMIELDKQISSKITPVLRTLKTMEHIIEDF FT QNEQQNRLLNLEQKAQSMAKLTPNYDTEEQKIENLFKEGKSIEQIAKDLRIGTGNVELV FT LKFKKLIK" FT misc_feature complement(162651..162710) FT /note="1 probable transmembrane helix predicted for Cj0162c FT by TMHMM2.0 at aa 5-24" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(162719..163216) FT /transl_table=11 FT /locus_tag="Cj0163c" FT /product="hypothetical protein Cj0163c" FT /note="Original (2000) note: Cj0163c, unknown, len: 165 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBX4" FT /protein_id="CAL34334.1" FT /translation="MELALFKAGFEAHLECCEIENNRFLGEYLKLGAISQILKWKKLAL FT RIDFDEGEKIIFDLLLSLKEDILRLENSLDKNKELIPLKQKGVIESLNFEYLNFLDTIL FT EEDKEYYLRFDLNNQKIAIFIKAQSQTLAKIIKIKPEDKMAFDAFVVEIQRNMIRNKKG FT QE" FT CDS complement(163207..164091) FT /transl_table=11 FT /gene="ubiA" FT /locus_tag="Cj0164c" FT /product="putative 4-hydroxybenzoate octaprenyltransferase" FT /EC_number="2.5.1.-" FT /note="Original (2000) note: Cj0164c, ubiA, possible FT 4-hydroxybenzoate octaprenyltransferase, len: 294 aa; FT similar to e.g. UBIA_ECOLI 4-hydroxybenzoate FT octaprenyltransferase (EC 2.5.1.-) (290 aa), fasta scores; FT opt: 250 z-score: 303.5 E(): 1.2e-09, 23.8% identity in 227 FT aa overlap. 51.2% identity to HP1360. Contains Pfam match FT to entry PF01040 CytC_assmbly_fac, Cytochrome c oxidase FT assembly factor, score 209.90, E-value 3.7e-59" FT /note="Updated (2006) note: Eight probable transmembrane FT helices predicted by TMHMM2.0. Characterised within FT Escherichia coli, however, identity score was FT unnacceptable. Thus, putative kept within product function. FT Functional classification - Biosynthesis of cofactors, FT prosthetic groups and carriers - Menaquinone and FT ubiquinine" FT /note="PMID:15597200" FT /db_xref="GOA:Q0PBX3" FT /db_xref="InterPro:IPR000537" FT /db_xref="InterPro:IPR006371" FT /db_xref="UniProtKB/TrEMBL:Q0PBX3" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01040" FT /protein_id="CAL34335.1" FT /translation="MNTFWIKFKDILELVVFKHSIFALPFLFSSMIVASKLANDTAWFG FT FKALILGIICAVSARNFAMATNRLMDEDIDKDNPRCANRPNVSGKIGRKSVWIFIIINA FT LIFISCSYFINTLAFYLSFPVLLVLAIYSAFKRFSSLAHLVLGFCLGLAPIAGSVIIMG FT EIHIYSVILCLGVTFWTAGFDLLYSLQDMEYDKKIGLHSIPAKFGSKATLFISSFCHIL FT AVLFWLLFVWEVWGVALGKIALIGVIISGIILALEHKIVHKNFAHIDRAFFTLNGYLSI FT IFFIFIWIDLLWN" FT misc_feature complement(join(163990..164058,163903..163962, FT 163738..163806,163612..163680,163531..163599, FT 163405..163473,163324..163392,163213..163281)) FT /note="8 probable transmembrane helices predicted for FT Cj0164c by TMHMM2.0 at aa 12-34, 44-63, 96-118, FT 138-160,165-187, 207-229, 234-256 and 271-293" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(163219..164034) FT /note="HMMPfam hit to PF01040, UbiA prenyltransferase FT family, score 3.1e-52" FT /inference="protein motif:Pfam:PF01040" FT misc_feature complement(163762..163794) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 164162..165031 FT /transl_table=11 FT /gene="miaA" FT /locus_tag="Cj0166" FT /product="tRNA delta(2)-isopentenylpyrophosphate FT transferase" FT /EC_number="2.5.1.8" FT /note="Original (2000) note: Cj0166, miaA, probable tRNA FT delta(2)-isopentenylpyrophosphate transferase, len: 289 aa; FT similar to many e.g. MIAA_ECOLI tRNA FT delta(2)-isopentenylpyrophosphate transferase (316 FT aa),fasta scores; opt: 185 z-score: 464.4 E(): 1.3e-18, FT 29.2% identity in 277 aa overlap. 38.4% identity to HP1415. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF01715 IPP FT transferase identified within CDS. Further support given to FT product function. Characterised within Escherichia coli FT with marginal identity score. Putative not added to product FT function. Functional classification - Aminoacyl tRNA FT synthetases and their modification" FT /note="PMID:1999389" FT /db_xref="GOA:Q9PIW2" FT /db_xref="InterPro:IPR002627" FT /db_xref="InterPro:IPR018022" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIW2" FT /inference="protein motif:Pfam:PF01715" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34336.1" FT /translation="MFFEIALIGTTASGKTYIANTLAREFNAVVLSLDSLCVYKEINIA FT SAKPSQDDLASIKYFGVNLLSVNEHFNVELFIREYQKAKEFALARNLPLIIVGGTGFYL FT KTMIDGLSEKTLESKSSLNNDEIYALLLNIDPNYKIEKNDTYRLKKWLGIYEQTREIPS FT EFLKRTQKTGVLKDIEIYELAWDKEILKKRIKTRTKEMLDNGLLDEAKILFSKFDHKLK FT ALNSIGLKECKEYLDGEISFKELENLITIHTTQLAKRQRTFNKKFQSKALEFDKALATL FT RMKFSIEK" FT misc_feature 164186..164209 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 164267..164986 FT /note="HMMPfam hit to PF01715, IPP transferase, score FT 5.9e-46" FT /inference="protein motif:Pfam:PF01715" FT CDS complement(165017..165580) FT /transl_table=11 FT /locus_tag="Cj0167c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0167c, probable integral FT membrane protein, len: 187 aa; similar to hypothetical FT proteins e.g. YEBN_ECOLI (206 aa), fasta scores; opt: 451 FT z-score: 792.0 E(): 0, 38.1% identity in 197 aa overlap. No FT Hp match" FT /note="Updated (2006) note: Six probable transmembrane FT helices predicted by TMHMM2.0. Also, Pfam domains x2 FT PF02659 Domain of unknown function DUF were identified FT within CDS. This family consists of hypothetical FT transmembrane proteins with unknown function. Further FT support given to product function. No specific FT characterisation yet, so putative included in product FT function. Functional classification - FT Membranes,lipoproteins and porins" FT /db_xref="GOA:Q9PIW1" FT /db_xref="InterPro:IPR003810" FT /db_xref="InterPro:IPR022929" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIW1" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02659" FT /protein_id="CAL34337.1" FT /translation="MDFYSLIFLSCALGMDAFAVSLCKGFSVKKLHLKHYLIVGIYFGG FT FQALMPTIGYFIGITFASFIASIDHWIAFILLSLIGLKMIKESLENENCDSNANQFGFK FT TMLALAIATSIDALAVGVSFAFLNVNLLLAIFLIGIITFILCIIALKIGNKFGIYLKNK FT AELLGGLVLIILGVKILIEHLFFD" FT misc_feature complement(join(165512..165571,165407..165475, FT 165326..165394,165200..165268,165122..165190, FT 165026..165085)) FT /note="6 probable transmembrane helices predicted for FT Cj0167c by TMHMM2.0 at aa 4-23, 36-58, 63-85, FT 105-127,131-153 and 166-185" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(165050..165265) FT /note="HMMPfam hit to PF02659, Domain of unknown function FT DUF, score 1.5e-17" FT /inference="protein motif:Pfam:PF02659" FT misc_feature complement(165335..165565) FT /note="HMMPfam hit to PF02659, Domain of unknown function FT DUF, score 4.5e-15" FT /inference="protein motif:Pfam:PF02659" FT tRNA 165728..165802 FT /gene="tRNA-Glu" FT /note="tRNA Glu anticodon TTC, Cove score 66.15" FT CDS complement(165938..166105) FT /transl_table=11 FT /locus_tag="Cj0168c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0168c, probable periplasmic FT protein, len: 55 aa; No Hp ortholog. Some similarity in FT C-term to Cj0909 (35.0% identity in 40 aa overlap). FT Contains probable N-terminal signal sequence" FT /note="Updated (2006) note: Literature search identified FT paper giving further support to product function. FT N-terminal matches to Yersinia pestis, acid shock protein 2 FT precursor. Functional classification - Miscellaneous FT periplasmic proteins" FT /note="PMID:15632442" FT /db_xref="UniProtKB/TrEMBL:Q0PBX0" FT /protein_id="CAL34338.1" FT /translation="MKKVVLISALLGAFAANVFAANTPSDVNQTHTKAKADKKHEAKTH FT KKTKEQTPAQ" FT misc_feature complement(166043..166096) FT /note="1 probable transmembrane helix predicted for Cj0168c FT by TMHMM2.0 at aa 4-21" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(166046..166105) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000084_165938_166105 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.552 between residues 20 and 21" FT CDS 166373..167035 FT /transl_table=11 FT /gene="sodB" FT /locus_tag="Cj0169" FT /product="superoxide dismutase (Fe)" FT /EC_number="1.15.1.1" FT /note="Original (2000) note: Cj0169, sodB, superoxide FT dismutase (Fe), len: 220 aa; 99.1% identical to SODF_CAMJE, FT and highly simlar to many e.g. SODF_ECOLI superoxide FT dismutase (Fe) (EC 1.15.1.1) (192 aa), fasta scores; opt: FT 740 z-score: 1209.9 E(): 0, 57.9% identity in 195 aa FT overlap. 61.6% identity to HP0389. Contains PS00088 FT Manganese and iron superoxide dismutases signature and Pfam FT match to entry PF00081 sodfe, Iron/manganese superoxide FT dismutases (SODM), score 275.90, E-value 5.2e-79" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni, so putative not added. Paper FT identified linking protein to glycoprotein (PMID:12186869). FT Functional classification -Detoxification" FT /note="PMID:12186869, PMID:8025686, PMID:8005660" FT /db_xref="GOA:Q0PBW9" FT /db_xref="InterPro:IPR001189" FT /db_xref="InterPro:IPR019831" FT /db_xref="InterPro:IPR019832" FT /db_xref="InterPro:IPR019833" FT /db_xref="UniProtKB/Swiss-Prot:Q0PBW9" FT /inference="protein motif:Pfam:PF00081" FT /inference="protein motif:Prosite:PS00088" FT /protein_id="CAL34339.1" FT /translation="MFELRKLPYDTNAFGDFLSAETFSYHHGKHHNTYVTNLNNLIKDT FT EFAGKDLVSIIKTSNGGVFNNAAQVYNHDFYFDCIKPSTGCGCGGSCQSIDANLQAALE FT KEFGSLENFKAEFIKGATGVFGSGWFWLVYNTKNQKLEFVGTSNAATPITEDKVPLLVV FT DVWEHAYYVDHRNARPAYLEKFYAHINWEFVAKAYEWALKEGMGSVSFYANELHPVK" FT misc_feature 166373..166615 FT /note="HMMPfam hit to PF00081, Iron/manganese superoxide FT dismutases, alpha-, score 2.8e-30" FT /inference="protein motif:Pfam:PF00081" FT misc_feature 166637..166966 FT /note="HMMPfam hit to PF02777, Iron/manganese superoxide FT dismutases, C-term, score 3.3e-45" FT /inference="protein motif:Pfam:PF02777" FT misc_feature 166862..166885 FT /note="PS00088 Manganese and iron superoxide dismutases FT signature" FT /inference="protein motif:Prosite:PS00088" FT CDS join(167050..167295,167297..167794) FT /transl_table=11 FT /locus_tag="Cj0170" FT /product="hypothetical protein Cj0170" FT /note="Original (2000) note: Cj0171, unknown, len: 166 aa; FT no Hp match. Contains polyporphic sequence G(9,11) at FT N-terminus; G11 allows translation from the upstream CDS FT Cj0170, G9 (consensus) would only allow this CDS to start FT at aa 47. Similar to Cj1326 (51.9% identity in 135 aa FT overlap), which also contains a polymorphic sequence FT allowing possible translation from Cj1325" FT /note="Original (2000) note: Cj0170, unknown, len: 90 aa; FT no Hp match. Contains polyporphic sequence G(9,11) at FT C-terminus; G9 (consensus) gives this translation stop,G11 FT allows translation into the downstream CDS Cj0171. Similar FT to Cj1325 (73.8% identity in 61 aa overlap), which also FT contains a polymorphic sequence allowing possible FT translation into Cj1326" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Coding sequences have been FT merged to reflect the complete amino acid sequence for this FT gene regardless of phase. Previous annotation gave Cj0170 FT and Cj0171 as seperate CDS. Merging of these CDSs has lead FT to loss of the downstream CDS. Functional classification - FT Unknown" FT /db_xref="InterPro:IPR013216" FT /db_xref="UniProtKB/TrEMBL:Q0PBW8" FT /protein_id="CAL34340.1" FT /translation="MLEWILTLSQHSTQKGAKMDNSLSAYTQKYDKEGYGLQYPDGHVI FT RFYERILKYKLSKTSGKLLDFGCGNGVHSKYFKNITGGGIEPYGIDIVPSLKKVWEKDP FT CLDSKNFHIISPNSSFKKLFNTKMDFIFANQSLYYLTKQAFKEAVQEFYELCNEGAIIF FT ATMMSDKGYSMYERGELMDNSLREVKGCPSGRLSGSSYIRFTKDIEELKEDFKPFKPLF FT WGDYELINLYNFEGSVEHFIYIGQK" FT CDS complement(167807..169012) FT /transl_table=11 FT /locus_tag="Cj0172c" FT /product="putative saccharopine dehydrogenase" FT /EC_number="1.5.1.7" FT /note="Original (2000) note: Cj0172c, unknown, len: 401 aa; FT similar to hypothetical proteins e.g. TR:Q55131 FT (EMBL:D64001) Synechocystis sp. SLR0049 (398 aa), fasta FT scores; opt: 1534 z-score: 2324.2 E(): 0, 55.7% identity in FT 397 aa overlap. 63.8% identity to HP1507 conserved FT hypothetical ATP-binding protein" FT /note="Updated (2006) note: Pfam domain PF03435 FT Saccharopine dehydrogenase was identified within CDS. FT Product modified to more specific family member due to FT motif match. No specific characterisation has yet been FT carried out. Putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PBW7" FT /db_xref="InterPro:IPR005097" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:Q0PBW7" FT /inference="protein motif:Pfam:PF03435" FT /protein_id="CAL34341.1" FT /translation="MKNLLIIGAGGVSRVATVKCAMNSDTFSKITLASRTKSKCDEIAA FT FIKERLGVQIETAQIDADDSNAVVELIKKTEAQILLNVALPYQDLSLMDACIKAGIDYI FT DTANYEHPDLAKFEYKEQWARNDEFKQAGILGLLGSGFDPGVTNVFCAYAQQNLFDEIS FT YIDILDCNAGDHGYAFATNFNPEINLREVSAKGRYWENGKWIETQPMEIKMEWDYPEVG FT VKDSYLLYHEELESLVKNIKGLKRIRFFMTFGQSYLTHMKCLENVGMLGIKPVIHQGKE FT IIPIEFLKTLLPDPASLGPRTKGYTNIGCVIRGKKDGKDKQVYIYNVCNHEECYKETGA FT QAVSYTTGVPAMIGTKLIAKGIWQGKGVFNMEEFDAKPFMEELNSQGLPWKIIEMTPSL FT GE" FT misc_feature complement(167837..169003) FT /note="HMMPfam hit to PF03435, Saccharopine FT dehydrogenase,score 2e-236" FT /inference="protein motif:Pfam:PF03435" FT CDS complement(169054..169962) FT /transl_table=11 FT /gene="cfbpC" FT /locus_tag="Cj0173c" FT /product="putative iron-uptake ABC transport system FT ATP-binding protein" FT /note="Original (2000) note: Cj0173c, possible iron-uptake FT ABC transport system ATP-binding protein, len: 302 aa; FT similar to many e.g. HITC_HAEIN iron(iii)-transport FT ATP-binding protein hitC (356 aa), fasta scores; opt: 389 FT z-score: 783.2 E(): 0, 38.0% identity in 250 aa overlap. FT Contains PS00017 ATP/GTP-binding site motif A FT (P-loop),PS00211 ABC transporters family signature and Pfam FT match to entry PF00005 ABC_tran, ABC transporters, score FT 163.10,E-value 4.9e-45. No Hp ortholog" FT /note="Updated (2006) note: Literature search identified FT many supporting papers within Campylobacter jejuni FT (PMID:12069882) and also paper carrying out the original FT work within Serratia marcescens. Designated as FT Campylobacter ferric binding protein (Cfbp) system. FT Characterisation with acceptable identity score yet to be FT carried out. Thus, putative kept within product function. FT Functional classification - Transport/binding proteins FT -Cations" FT /note="PMID:15231804, PMID:12069882, FT PMID:15731081,PMID:2644190, PMID:7927717" FT /db_xref="GOA:Q0PBW6" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/TrEMBL:Q0PBW6" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34342.1" FT /translation="MMLEIKNLSKNFGKIQALENINLHVKEGEFLSILGGSGSGKSTLL FT RIIAKLEQASSYDLFSCKGEVALMFQNYALFPHLNVEKNILFALYDKKDKNQILNHLLK FT TFEIEDLRYKKIDEISGGQAQRVAFARAMARGCKLLLLDEPFSNLDQNLKQDLRRELKK FT MIENQGITAIMVTHDIEDAYCMSDQIAFLEKGKILAHANPKELYFKPDFKSAQILPDLN FT IIEEKLDLEDEFFAWIASKNYIFGYAELKIGNRFEAKILQKEFLGAFCRLKLLYKNIIF FT FILVSSSYDLEEKISFDIINF" FT misc_feature complement(169378..169881) FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 2.3e-45" FT /inference="protein motif:Pfam:PF00005" FT misc_feature complement(169564..169608) FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature complement(169837..169860) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(169946..171562) FT /transl_table=11 FT /gene="cfbpB" FT /locus_tag="Cj0174c" FT /product="putative iron-uptake ABC transport system FT permease protein" FT /note="Original (2000) note: Cj0174c, possible iron-uptake FT ABC transport system permease protein, len: 538 aa; similar FT to e.g. SFUB_SERMA iron(iii)-transport system permease FT protein (527 aa), fasta scores; opt: 333 z-score: 335.6 FT E(): 1.9e-11, 21.5% identity in 522 aa overlap. No Hp FT match. Contains Pfam match to entry PF00528 FT BPD_transp,Binding-protein-dependent transport systems FT inner membrane component, score 27.90, E-value 0.00024" FT /note="Updated (2006) note: Literature search identified FT many supporting papers within Campylobacter jejuni FT (PMID:12069882) and also paper carrying out the original FT work within Serratia marcescens. Designated as FT Campylobacter ferric binding protein (Cfbp) system. FT Characterisation with acceptable identity score yet to be FT carried out. Thus, putative kept within product function. FT Functional classification - Transport/binding proteins FT -Cations" FT /note="PMID:15231804, PMID:12069882, FT PMID:15731081,PMID:2644190, PMID:7927717" FT /db_xref="GOA:Q0PBW5" FT /db_xref="InterPro:IPR000515" FT /db_xref="UniProtKB/TrEMBL:Q0PBW5" FT /inference="protein motif:Pfam:PF00528" FT /protein_id="CAL34343.1" FT /translation="MYKTLKYYKLGAILLALFLALPIFGIFAELFYILFQNFNTSDLTQ FT FSSIKENLSHFFDYLFLKFIKDTFIISMGVLCLSLILGVSSAYLIANYDFYFCKILEKL FT LILPLAIPAYILAFVYVGIMDFQGFFHENFGFRIDFFNHYGVIFVLAISLYPYIYLFAK FT TAFKSEAKEAYEVAKIMKYSEFRIFTRVALLSARPAIFSGALLVLMETLSDYGASAYLG FT VDTFSAGIFKLWYDLNDSYSSSVLSGILMLFVFLIMYVDYYYKNKHHYSFNQNLALFIK FT KRKLNPIKQILSCIYCFMIAFVGFILPFIWLVYWGLKDHKLFESQFYIISFQTIILALI FT TALITTFLAYFLMFSSRIVKNHFFNLFILKISSLGYSIPAAALGISIIVLFVFLDKFFH FT MSLLGNSLLVLVFAYIIRFLASAIYSLEGGYNKIHLNIDEASLNLRTSYFILFFKIHTP FT LMKHFLFLAFIIVFIDTIKELPLSRILAPFGFETLSVKAFWFASDERIYDAALPSLFIV FT FLSLMVVVWMDKITRKDDVRN" FT misc_feature complement(join(171458..171526,171290..171358, FT 171191..171253,171065..171133,170936..171004, FT 170774..170842,170621..170689,170510..170578, FT 170384..170452,170273..170341,170144..170212, FT 169982..170050)) FT /note="12 probable transmembrane helices predicted for FT Cj0174c by TMHMM2.0 at aa 13-35, 69-91, 104-124, FT 144-166,187-209, 241-263, 292-314, 329-351, 371-393, FT 408-430,451-473 and 505-527" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(170753..171382) FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 5.4e-07" FT /inference="protein motif:Pfam:PF00528" FT sig_peptide complement(171473..171562) FT /note="Signal peptide predicted for cfbpB by SignalP 2.0 FT HMM (Signal peptide probability 0.942) with cleavage site FT probability 0.300 between residues 30 and 31" FT CDS complement(171562..172566) FT /transl_table=11 FT /gene="cfbpA" FT /locus_tag="Cj0175c" FT /product="putative iron-uptake ABC transport FT system,periplasmic iron-binding protein" FT /note="Original (2000) note: Cj0175c, possible iron-uptake FT ABC transport system periplasmic iron-binding protein,len: FT 334 aa; similar to e.g. HITA_HAEIN iron-utilization FT periplasmic protein precursor (332 aa), fasta scores; opt: FT 466 z-score: 500.8 E(): 1.2e-20, 29.8% identity in 332 aa FT overlap. No Hp match. Contains N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF01547 Bacterial FT extracellular solute-binding protein identified within CDS. FT Further support given to product function. Literature FT search identified many supporting papers within FT Campylobacter jejuni (PMID:12069882) and also paper FT carrying out the original work within Serratia marcescens. FT Designated as Campylobacter ferric binding protein (Cfbp) FT system. Characterisation with acceptable identity score yet FT to be carried out. Thus, putative kept within product FT function. Paper identified linked protein to glycoprotein FT (PMID:15231804). Functional classification FT -Transport/binding proteins - Cations" FT /note="PMID:15613474, PMID:15231804, FT PMID:12069882,PMID:12186869, PMID:2644190" FT /db_xref="GOA:Q0PBW4" FT /db_xref="InterPro:IPR006059" FT /db_xref="PDB:1Y4T" FT /db_xref="PDB:3E13" FT /db_xref="UniProtKB/TrEMBL:Q0PBW4" FT /inference="protein motif:Pfam:PF01547" FT /protein_id="CAL34344.1" FT /translation="MKKIFFMFLTAVSFLGASELNIYSARHYNADFEIIKKFEEKTGIK FT VNHTQAKASELIKRLSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKYLEEFIPAH FT LRDKDKEWFAITKRARIIAYNKNTNIDISKMKNYEDLAKAEFKGEIVMRSATAPYSKTL FT LASIIANDGNKEAKAWAKGVLENLATNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKN FT SKNPKDVEVGNSLGIIFPNQDNRGTHINISGIAMTKSSKNQDAAKKFMEFMLSPEIQKI FT LTDSNYEFPIRNDVELSQTVKDFGTFKEDQIPVSKIAENIKEAVKIYDEVGFR" FT misc_feature complement(171727..172566) FT /note="HMMPfam hit to PF01547, Bacterial extracellular FT solute-binding prot, score 4.7e-14" FT /inference="protein motif:Pfam:PF01547" FT sig_peptide complement(172495..172566) FT /note="Signal peptide predicted for cfbpA by SignalP 2.0 FT HMM (Signal peptide probability 0.944) with cleavage site FT probability 0.410 between residues 24 and 25" FT CDS complement(172563..172694) FT /transl_table=11 FT /locus_tag="Cj0176c" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0176c, probable lipoprotein, FT len: 43 aa; no Hp match. Contains N-terminal signal FT sequence with appropriately positioned PS00013 Prokaryotic FT membrane lipoprotein lipid attachment site" FT /note="Updated (2006) note: Literature search identified FT papers giving further clues to product function. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PBW3" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34345.1" FT /translation="MSMKKIILFLLCVGFAFACSEHSHTDFKDLNKTEYNSQLKDKI" FT sig_peptide complement(172626..172694) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000086_172563_172694 by SignalP 2.0 FT HMM (Signal peptide probability 0.989) with cleavage site FT probability 0.509 between residues 23 and 24" FT misc_feature complement(172638..172670) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 172916..173767 FT /transl_table=11 FT /locus_tag="Cj0177" FT /product="putative iron transport protein" FT /note="Original (2000) note: Cj0177, probable FT lipoprotein,len: 283 aa; simlar to TR:O68876 FT (EMBL:AF055999) hypothetical protein PhuW from Pseudomonas FT aeruginosa hemin uptake locus (295 aa), fasta scores; opt: FT 375 z-score: 307.6 E(): 7.1e-10, 31.3% identity in 246 aa FT overlap. No Hp match. Contains N-terminal signal sequence FT with appropriately positioned PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site" FT /note="Updated (2006) note: Pfam domain PF04187 Protein of FT unknown function, DUF399 identified within CDS. Literature FT search identified papers giving further clues to product FT function. Product function modified to putative iron FT transport protein based on information from literature. No FT specific characterisation with acceptable identity scores FT has been carried out yet. Thus, putative kept within FT product function. Functional classification FT -Transport/binding proteins - Cations" FT /note="PMID:12069882, PMID:15231804, PMID:15231804" FT /db_xref="GOA:Q0PBW2" FT /db_xref="InterPro:IPR007314" FT /db_xref="InterPro:IPR016773" FT /db_xref="PDB:2G5G" FT /db_xref="UniProtKB/TrEMBL:Q0PBW2" FT /inference="protein motif:Pfam:PF04187" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34346.1" FT /translation="MKFYTILSILFISFMLSACAVLQKSSPLQENKDFYILDTHTQKKI FT SFEDMILELLKADVILLGEKHDEVKHKISQVMIFNALEGNLSSQNINFDVALEMLASTE FT QNHLDKAFKNKKTIKANELTNALNWDKVWKWKDYEQFVNVVFYSKSKILGANLSRSEIT FT SIYNGAQPLKGYVSTTNEVKKQLFDIISLSHKLNPEENKELLDKLVEIQQFKDRRMADV FT LVHHVNKVLLLAGSYHTSKKIGIPLHIQDFKSSKKIVVVNLSYGEIDLKDSDYVLIYKG FT EE" FT sig_peptide 172916..172999 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000087_172916_173767 by SignalP 2.0 FT HMM (Signal peptide probability 0.995) with cleavage site FT probability 0.342 between residues 28 and 29" FT misc_feature 172916..173764 FT /note="HMMPfam hit to PF04187, Protein of unknown function, FT DUF399, score 5e-164" FT /inference="protein motif:Pfam:PF04187" FT misc_feature 172940..172972 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 173764..176031 FT /transl_table=11 FT /locus_tag="Cj0178" FT /product="putative TonB-denpendent outer membrane receptor" FT /note="Original (2000) note: Cj0178, possible outer FT membrane siderophore receptor, len: 755 aa; similar to e.g. FT YC17_HAEIN probable tonB-dependent receptor HI1217 (913 FT aa), fasta scores; opt: 440 z-score: 1818.4 E(): 0,32.7% FT identity in 912 aa overlap, and TR:O68881 (EMBL:AF055999) FT outer membrane hemin receptor PhuR from Pseudomonas FT aeruginosa (764 aa), fasta scores; opt: 145 z-score: 207.4 FT E(): 0.00027 22.3% identity in 806 aa overlap. No Hp match. FT Contains N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domains PF07715 FT TonB-dependent Receptor Plug Domain and PF00593 TonB FT dependent receptor identified within CDS. Literature search FT identified papers giving further clues to product function. FT Product function modified to more specific family member. FT No specific characterisation with acceptable identity FT scores has been carried out yet. Thus,putative kept within FT product function. Functional classification - FT Transport/binding proteins - Cations" FT /note="PMID:15731081, PMID:15632442, FT PMID:15231804,PMID:12069882" FT /db_xref="GOA:Q0PBW1" FT /db_xref="InterPro:IPR000531" FT /db_xref="InterPro:IPR012910" FT /db_xref="UniProtKB/TrEMBL:Q0PBW1" FT /inference="protein motif:Pfam:PF00593" FT /inference="protein motif:Pfam:PF07715" FT /protein_id="CAL34347.1" FT /translation="MKKLSLFCAVGLCFASFAFSEELEFDSLEISGSKIKNDEKPFVTP FT GATSTREGIGSDTQSIDSIVRSIPGTYTNTDQAQGTVQVNIRGMSGFGRVNTMIDGVTQ FT TFYGSASDDPARFHSQTGTSAFGAVIDTNFLIGVDVTRGTFEGVGGANALMGSANFKTI FT GINDIVHDGNIFGFLGRFSYGSNGIGPSYMSAVAGKTELENNGYVGALFGYSAKRITQN FT YTVGGGGKIGSSMVDTDGDGIADTNIAPFDPDFLTQKPNSQLFKLEYVPNSFTNTIFSY FT RRYQNELAGRKIHNDNYQLDFWHNPNEWLNVNTLIAYNQGIQTYGSKSTFAANDAIANT FT KAKNTATTFDISDTLEGEWHRFNLNIRFGANILLNDYKNTLNTSIQGVNSIPFQPRGKQ FT NLFTYYLDNSLNYGIFTLDTNVNLLDWNIKGHRPACDEVNFMCFPKAATDIDKNGLRLN FT ASVMLSAAIHELITPFVSFARTNRAPNVQEMFFSNNEGNGINSFLKPEQANTWQIGFNS FT FKHGLLKDDDRFGFKAVYYHTKIKDYIYNEQFYLEDPSKDPPSSQFYMHLNSADDTIFK FT GVELELSYDLGFAYAKAMYSRQDTSSTISQTSGPLLGSFSASKIMELPKDYANVELGFR FT LNDKISFGGIAKYTGKAKRVNPNTDDWNKDPNNPYYPKPTTQDLPKIPIIVDLYWNIEW FT FKNLTMRAEVQNLFDKNYMDALNAYNSLDNQLQYNGAGDPIYLFSNSARGRTFIVSFEY FT KY" FT sig_peptide 173764..173823 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000088_173764_176031 by SignalP 2.0 FT HMM (Signal peptide probability 0.998) with cleavage site FT probability 0.873 between residues 20 and 21" FT misc_feature 173881..174234 FT /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug FT Domain, score 9.2e-13" FT /inference="protein motif:Pfam:PF07715" FT misc_feature 175135..176028 FT /note="HMMPfam hit to PF00593, TonB dependent FT receptor,score 1.5e-22" FT /inference="protein motif:Pfam:PF00593" FT CDS 176043..176804 FT /transl_table=11 FT /gene="exbB1" FT /locus_tag="Cj0179" FT /product="biopolymer transport protein" FT /note="Original (2000) note: Cj0179, exbB1, biopolymer FT transport protein, len: 253 aa; highly similar to e.g. FT EXBB_ECOLI biopolymer transport exbB protein (244 aa),fasta FT scores; opt: 537 z-score: 811.2 E(): 0, 46.3% identity in FT 216 aa overlap. No Hp ortholog" FT /note="Updated (2006) note: Pfam domain PF01618 FT MotA/TolQ/ExbB proton channel family identified within CDS. FT Also, three probable transmembrane helices predicted by FT TMHMM2.0. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Thus, putative not added. Cj0179-Cj0181 FT (exbB1, exbD1, tonB1) function as an outer-membrane energy FT transducer system. Functional classification FT -Transport/binding proteins - Other" FT /note="PMID:7642501, PMID:8437515, FT PMID:15632442,PMID:12069882" FT /db_xref="GOA:Q0PBW0" FT /db_xref="InterPro:IPR002898" FT /db_xref="UniProtKB/TrEMBL:Q0PBW0" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01618" FT /protein_id="CAL34348.1" FT /translation="MLKKCFYFVFLLLNLNAEANATDTNLSFDSSKIETEAPKIELSLS FT SLYQNADEVVKGVIYILVLFSILAWAVFISKLMQFYFMKKNLDLSIQKIKELKNLNELD FT QTKDFAGVLSLEIQDELEKSEYKNDHIKERIELRLQNTISKQITASKNGLSLLASIGAS FT APFIGLFGTVWGIMNAFIGIANLGNASLAVVAPGIAEALFATAFGLIAAIPAVLFYNYL FT TRKNLKLMHHLDELANFVYILFHRSYFNDKN" FT sig_peptide 176043..176099 FT /note="Signal peptide predicted for exbB1 by SignalP 2.0 FT HMM (Signal peptide probability 0.911) with cleavage site FT probability 0.584 between residues 19 and 20" FT misc_feature order(176211..176264,176505..176573,176631..176699) FT /note="3 probable transmembrane helices predicted for FT Cj0179 by TMHMM2.0 at aa 57-74, 155-177 and 197-219" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 176322..176756 FT /note="HMMPfam hit to PF01618, MotA/TolQ/ExbB proton FT channel family, score 8.6e-47" FT /inference="protein motif:Pfam:PF01618" FT CDS 176791..177201 FT /transl_table=11 FT /gene="exbD1" FT /locus_tag="Cj0180" FT /product="biopolymer transport protein" FT /note="Original (2000) note: Cj0180, exbD1, biopolymer FT transport protein, len: 136 aa; highly similar to e.g. FT EXBD_ECOLI biopolymer transport exbD protein (141 aa),fasta FT scores; opt: 356 z-score: 629.2 E(): 8.7e-28, 42.9% FT identity in 119 aa overlap. No Hp ortholog" FT /note="Updated (2006) note: Pfam domain PF02472 Biopolymer FT transport protein ExbD/TolR identified within CDS. Also,one FT probable transmembrane helices predicted by TMHMM2.0. FT Further support given to product function. Characterised FT within Escherichia coli with acceptable identity scores. FT Thus, putative not added. Cj0179-Cj0181 (exbB1, FT exbD1,tonB1) function as an outer-membrane energy FT transducer system. Functional classification - FT Transport/binding proteins - Other" FT /note="PMID:7642501, PMID:8437515, FT PMID:15632442,PMID:12069882" FT /db_xref="GOA:Q0PBV9" FT /db_xref="InterPro:IPR003400" FT /db_xref="UniProtKB/TrEMBL:Q0PBV9" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02472" FT /protein_id="CAL34349.1" FT /translation="MIKTEMAHKEEELSEINITPFIDIMLVLLIVFMAVTPLITSSIKI FT ELPKSSQQAEDKLKNPIILYLNTDNTLAINDDKLSLENLSSALDIKTKGNKEEIIYFHI FT DKSVKYEDIMQVMQKLKENGYGKIALSSKKMD" FT misc_feature 176815..177195 FT /note="HMMPfam hit to PF02472, Biopolymer transport protein FT ExbD/TolR, score 8.4e-22" FT /inference="protein motif:Pfam:PF02472" FT misc_feature 176827..176895 FT /note="1 probable transmembrane helix predicted for Cj0180 FT by TMHMM2.0 at aa 13-35" FT /inference="protein motif:TMHMM:2.0" FT CDS 177203..177949 FT /transl_table=11 FT /gene="tonB1" FT /locus_tag="Cj0181" FT /product="TonB transport protein" FT /note="Original (2000) note: Cj0181, tonB1, possible tonB FT transport protein, len 248 aa; similar to e.g. TONB_PSEPU FT tonB protein (243 aa), fasta scores; opt: 220 z-score: FT 317.2 E(): 2.1e-10, 29.5% identity in 149 aa overlap. No Hp FT match" FT /note="Updated (2006) note: One probable transmembrane FT helices predicted by TMHMM2.0. Characterised within FT Pseudomonas putida with marginal identity score. Putative FT not added. Cj0179-Cj0181 (exbB1, exbD1, tonB1) function as FT an outer-membrane energy transducer system. Functional FT classification - Transport/binding proteins - Other" FT /note="PMID:7642501, PMID:8437515, FT PMID:15632442,PMID:12069882" FT /db_xref="GOA:Q0PBV8" FT /db_xref="InterPro:IPR006260" FT /db_xref="UniProtKB/TrEMBL:Q0PBV8" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34350.1" FT /translation="MKSSVIFGFVLSLILHTLVLMFFLFSFYTQEKSSGVDFKQGAEFT FT SIMMVSEFPIGELKEVSIDQKKSNSQDKNKKQDERISFNSQDKNAVLKVQKKIEKQDEN FT QAQKEIANASENSKFKNESLSAPLQSNKDKTQTIVSGNAKEQVKSYQALLMAHLTKFKK FT YPQEAIMQKQEGVVRIRVSIDESGNVLSKELKKSCPYAALNDEALSLFKRASPLPKPPK FT EMLKNGDKISFVMPIDYNIKDYLGKK" FT sig_peptide 177203..177301 FT /note="Signal peptide predicted for tonB1 by SignalP 2.0 FT HMM (Signal peptide probability 0.715) with cleavage site FT probability 0.592 between residues 33 and 34" FT misc_feature 177221..177289 FT /note="1 probable transmembrane helix predicted for Cj0181 FT by TMHMM2.0 at aa 7-29" FT /inference="protein motif:TMHMM:2.0" FT CDS 177995..179200 FT /transl_table=11 FT /locus_tag="Cj0182" FT /product="putative transmembrane transport protein" FT /note="Original (2000) note: Cj0182, probable transmembrane FT transport protein, len: 401 aa; similar to e.g. SBMA_ECOLI FT sbmA protein (406 aa), fasta scores; opt: 450 z-score: FT 1235.4 E(): 0, 35.4% identity in 395 aa overlap. No Hp FT ortholog" FT /note="Updated (2006) note: Prosite domain PS50929, ABC FT transporter integral membrane type-1 fused domain profile FT identified within CDS. Six probable transmembrane helices FT predicted by TMHMM2.0. Further support given to product FT function. No specific characterisation with acceptable FT identity scores (with full sequence alignment), has been FT carried out yet. Functional classification FT -Transport/binding proteins - Other" FT /db_xref="GOA:Q0PBV7" FT /db_xref="InterPro:IPR009248" FT /db_xref="InterPro:IPR011527" FT /db_xref="InterPro:IPR017940" FT /db_xref="UniProtKB/TrEMBL:Q0PBV7" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Prosite:PS50929" FT /protein_id="CAL34351.1" FT /translation="MIMFSSFFKSKKWALWAYLGLFLLLFFLYIQTSLNVAINSWYSDF FT YNVLQKPKIELLDSNSTQKIEENLENNATLIQEANQRAEQNFQKANFINKGALYYYQNL FT LEYFFNSRAMIEKPNYSASDFYALILVFLAIAIPYVLIATINIYFASVYAFKWREAMTF FT SYLKFWKNKDDNIEGSSQRIQEDTYNFSKIVESLGLSFIKALMTLVAFIPILWSLSDVV FT SKALFANLSENSFFYFLKNIDGLLVYIALLISLGGLVVSWFVGIKLPGLEYNNQKAEAA FT FRKELVYAEDNRKEYAKNETMIELFTGLKFNYKRLFLHYGYFNIWLILFEQMIVIVPFL FT IMAPGLFAGAIGLGIVMQINNAFDQVRSSFSIFITNWTTITQLRSIYKRLKEFEKNISY FT KS" FT sig_peptide 177995..178102 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000089_177995_179200 by SignalP 2.0 FT HMM (Signal peptide probability 0.990) with cleavage site FT probability 0.535 between residues 36 and 37" FT misc_feature order(178031..178099,178373..178441,178583..178651, FT 178724..178792,178940..178984,178994..179062) FT /note="6 probable transmembrane helices predicted for FT Cj0182 by TMHMM2.0 at aa 13-35, 127-149, 197-219, FT 244-266,316-330 and 334-356" FT /inference="protein motif:TMHMM:2.0" FT CDS 179299..180657 FT /transl_table=11 FT /locus_tag="Cj0183" FT /product="putative integral membrane protein with FT haemolysin domain" FT /note="Original (2000) note: Cj0183, probable integral FT membrane protein with haemolysin domain, len: 452 aa; FT similar to many members of the UPF0053 family e.g. FT YUGS_BACSU (434 aa), fasta scores; opt: 999 z-score: 1508.9 FT E(): 0, 38.1% identity in 430 aa overlap. Also similar in FT C-terminal half to haemolysins e.g. HLYC_TREHY Treponema FT hyodysenteriae hemolysin C (268 aa), fasta scores; opt: 447 FT z-score: 468.1 E(): 8.1e-19, 32.5% identity in 237 aa FT overlap. 54.3% identity to HP1490. Contains 2x Pfam match FT to entry PF00571 CBS, CBS domain,scores 26.10, E-value FT 0.00082 and 40.50, E-value 3.7e-08" FT /note="Updated (2006) note: Four probable transmembrane FT helices predicted by TMHMM2.0. No specific characterisation FT with acceptable identity scores identified yet. Thus, FT putative kept within product function. Functional FT classification - Pathogenicity" FT /db_xref="GOA:Q0PBV6" FT /db_xref="InterPro:IPR000644" FT /db_xref="InterPro:IPR002550" FT /db_xref="InterPro:IPR005170" FT /db_xref="InterPro:IPR016169" FT /db_xref="UniProtKB/TrEMBL:Q0PBV6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00571" FT /protein_id="CAL34352.1" FT /translation="MDPSQVLDLNQTSTASFDAGYSILMVVVALALVFLNGFFVLSEFS FT IVKVRRSKLEEMVKEKKAGAKKALEVTSRLDTYLSACQLGITLSSLALGWIGEPAIAKM FT LEIPLINLGFSTVIIHTMAFIIAFSIITLLHVVLGELVPKSIAIAVADKAVLFIARPLH FT WFWMLFLPCIKIFDFLAAISLKLFGIKPAKESELTHSEEEIKIIASESQKGGVLDEFET FT EIIRNAVDFSDTVAKEIMTPRKDMICLNKQKSYEENMQIICEHKHTRFPYIDGSKDTIL FT GMIHIRDIIQNELNHKSQNLDTFVKPLILVPENISISKVLVMMNKERSHTALVVDEYGG FT TAGILTMEDIMEEIIGEIKSEHEEDSYKKLAENIYEFQGRCDIETVEEMLVINYDEDLE FT QVTIGGYVFNLLGRLPMVGDRIEDELCYYEVKKMDGNSIERVKVVKKTNKDEE" FT misc_feature order(179356..179424,179521..179589,179647..179715, FT 179782..179850) FT /note="4 probable transmembrane helices predicted for FT Cj0183 by TMHMM2.0 at aa 20-42, 75-97, 117-139 and 162-184" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 179368..179961 FT /note="HMMPfam hit to PF01595, Domain of unknown function FT DUF21, score 3.2e-83" FT /inference="protein motif:Pfam:PF01595" FT misc_feature 180016..180180 FT /note="HMMPfam hit to PF00571, CBS domain, score 2.5e-08" FT /inference="protein motif:Pfam:PF00571" FT misc_feature 180202..180363 FT /note="HMMPfam hit to PF00571, CBS domain, score 6.5e-12" FT /inference="protein motif:Pfam:PF00571" FT misc_feature 180400..180639 FT /note="HMMPfam hit to PF03471, Transporter associated FT domain, score 1.3e-22" FT /inference="protein motif:Pfam:PF03471" FT CDS complement(180702..181856) FT /transl_table=11 FT /locus_tag="Cj0184c" FT /product="putative serine/threonine protein phosphatase" FT /note="Original (2000) note: Cj0184c, possible FT serine/threonine protein phosphatase, len: 384 aa; similar FT in part to many eukarotic serine/threonine protein FT phosphatases e.g. PP12_SCHPO serine/threonine protein FT phosphatase PP1-2 (322 aa), fasta scores; opt: 140 z-score: FT 290.0 E(): 6.8e-09, 31.3% identity in 131 aa overlap. No Hp FT match. Contains Pfam match to entry PF00149 STphosphatase, FT Ser/Thr protein phosphatases, score 6.90,E-value 0.39" FT /note="Updated (2006) note: Pfam domain PF00149 FT STphosphatase was changed in Pfam database to FT Calcineurin-like phosphoesterase. Characterisation work has FT been carried out mainly in eukaryotes with marginal FT identity scores. Possible was changed to putative. FT Functional classification - Signal transduction" FT /db_xref="GOA:Q0PBV5" FT /db_xref="InterPro:IPR004843" FT /db_xref="InterPro:IPR006186" FT /db_xref="UniProtKB/TrEMBL:Q0PBV5" FT /inference="protein motif:Pfam:PF00149" FT /protein_id="CAL34353.1" FT /translation="MRILLVLRGNYYAGQEEFIKNNKLQNYTLDLNALRLLSGSVKNIV FT SEYKILNVKNDEDLSKILLKLLEMRMQKGEFSIINAYNETLKIYKDLAKQYRYKIYVIV FT FDSSLKQCQEKNLLEAKKNGYIIPYALLEKTQDLLKKNPKKYPILDSRDWKKCLYQMPN FT LSKYKKIHHIGDLQGCYSVLKEYIKTIKEDEFYIFLGDYINRGIENGKVIKFLLKICEK FT ENVCLLEGNHERHLIKWANGELSNSKEFNENTLKDFRKEKLTPRDARKLYPHLKECLYY FT KFQNKFIFCSHGGVNFIPSKPEKISFIPSHDFIYGVGGYEDSQKVANQFCNFTSDNLYQ FT IFGHRNKEKLPMKIAKRVFLCEGKIDDGGYLRVVTLDEKGFECV" FT misc_feature complement(180813..181355) FT /note="HMMPfam hit to PF00149, Calcineurin-like FT phosphoesterase, score 6.6e-12" FT /inference="protein motif:Pfam:PF00149" FT CDS complement(181866..182075) FT /transl_table=11 FT /locus_tag="Cj0185c" FT /product="putative phnA domain protein" FT /note="Original (2000) note: Cj0185c, unknown, len: 69 aa; FT similar to part of phnA proteins (involved in FT alkylphosphonate uptake) from several organisms e.g. FT PHNA_ECOLI phnA protein (111 aa), fasta scores; opt: 238 FT z-score: 482.4 E(): 1.3e-19, 55.9% identity in 68 aa FT overlap. 45.6% identity in 68 aa overlap to HP0872 (109 FT aa)" FT /note="Updated (2006) note: Pfam domain PF03831 PhnA FT protein was identified within CDS. Characterisation work FT within Escherichia coli has been carried out with FT acceptable identity scores. However, sequence alignment was FT only partial. Product changed from phnA-like protein to FT putative phnA domain protein. Functional classification - FT Transport/binding proteins - Other" FT /note="PMID:9300819" FT /db_xref="InterPro:IPR013988" FT /db_xref="UniProtKB/TrEMBL:Q0PBV4" FT /inference="protein motif:Pfam:PF03831" FT /protein_id="CAL34354.1" FT /translation="MAKDANGIELNAGDSVSIIKDLKVKGASTTLKRGTTIKNIKLTSK FT EGEIEARVDKFGVIVLKTEFLKKI" FT misc_feature complement(181911..182075) FT /note="HMMPfam hit to PF03831, PhnA protein, score 3.1e-30" FT /inference="protein motif:Pfam:PF03831" FT CDS complement(182068..182787) FT /transl_table=11 FT /locus_tag="Cj0186c" FT /product="putative TerC family integral membrane protein" FT /note="Original (2000) note: Cj0186c, probable integral FT membrane protein, len: 239 aa; similar to many hypothetical FT proteins e.g. YGDQ_HAEIN HI0056 (237 aa),fasta scores; opt: FT 964 z-score: 1727.7 E(): 0, 64.3% identity in 230 aa FT overlap. 50.0% identity to HP1343" FT /note="Updated (2006) note: Pfam domain PF03741 Integral FT membrane protein TerC family was identified within CDS. FT Seven probable transmembrane helices predicted by TMHMM2.0. FT Further support given to product function. Product modified FT to more specific family member based on motif match. No FT specific characterisation with acceptable identity scores FT has been carried out yet. Thus, putative kept within FT product function. Functional classification -Membranes, FT lipoproteins and porins" FT /db_xref="GOA:Q0PBV3" FT /db_xref="InterPro:IPR005496" FT /db_xref="UniProtKB/TrEMBL:Q0PBV3" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03741" FT /protein_id="CAL34355.1" FT /translation="MFEWIFSIDAWITLATLSALEIVLGIDNIIFLAILVSKLPPEHRD FT KGRILGLAFAMITRILLLLSLFWVMKLVTPLFSVLGNEISGRDLVLLLGGLFLIVKSIK FT EIKEQISHQEESQSHFKASNKLWIVVAEIAVIDIVFSLDSVITAVGIAQDVTIMIIAVI FT IAVAVMLFASKPIADFVEKYPSIKILALAFLVLIGVVLVAESFDIHIDKAYIYTAMAFA FT LVVQILNILDQKKEKNG" FT misc_feature complement(join(182677..182745,182581..182640, FT 182479..182538,182350..182418,182269..182337, FT 182179..182232,182095..182151)) FT /note="7 probable transmembrane helices predicted for FT Cj0186c by TMHMM2.0 at aa 15-37, 50-69, 84-103, FT 124-146,151-173, 186-203 and 213-231" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(182110..182751) FT /note="HMMPfam hit to PF03741, Integral membrane protein FT TerC family, score 2.9e-96" FT /inference="protein motif:Pfam:PF03741" FT CDS complement(182859..183425) FT /transl_table=11 FT /gene="purN" FT /locus_tag="Cj0187c" FT /product="phosphoribosylglycinamide formyltransferase" FT /EC_number="2.1.2.2" FT /note="Original (2000) note: Cj0187c, purN, probable FT phosphoribosylglycinamide formyltransferase, len: 188 aa; FT similar to e.g. PUR3_ECOLI phosphoribosylglycinamide FT formyltransferase (EC 2.1.2.2) (212 aa), fasta scores; opt: FT 406 z-score: 654.6 E(): 3.3e-29, 38.6% identity in 189 aa FT overlap. No Hp ortholog. Contains Pfam match to entry FT PF00551 formyl_transf, Formyl transferase, score 177.90, FT E-value 4.4e-50" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity scores. Putative FT not added to product function. Functional classification FT -Purine ribonucleotide biosynthesis" FT /note="PMID:3301838" FT /db_xref="GOA:Q0PBV2" FT /db_xref="InterPro:IPR002376" FT /db_xref="InterPro:IPR004607" FT /db_xref="UniProtKB/TrEMBL:Q0PBV2" FT /inference="protein motif:Pfam:PF00551" FT /protein_id="CAL34356.1" FT /translation="MLVKLAVLFSGNGSNLENILEKLHKKTIGENTYEIVLCLCNKKDA FT FGIQRAKKFGLNTVIIDHKAYNTREEFDTILVQKIKESGANLTVLAGFMRILSPVFTKN FT IKAINLHPSLLPLFKGAHAIKESYESDMKVAGVSVHWVSEELDGGMIIAQKAFEKRNLS FT FEEFEEKIHSLEHEILPLSVIEIFS" FT misc_feature complement(182877..183419) FT /note="HMMPfam hit to PF00551, Formyl transferase, score FT 2.9e-50" FT /inference="protein motif:Pfam:PF00551" FT CDS complement(183416..184786) FT /transl_table=11 FT /locus_tag="Cj0188c" FT /product="putative kinase" FT /note="Original (2000) note: Cj0188c, unknown, len: 456 aa; FT similar to members of the UPF0031 family e.g. YJEF_ECOLI FT (515 aa), fasta scores; opt: 267 z-score: 441.8 E(): FT 2.4e-17, 29.9% identity in 418 aa overlap. 35.9% identity FT to HP1363. Contains PS01050 Uncharacterized protein family FT UPF0031 signature 2 and Pfam match to entry PF01256 FT UPF0031, Uncharacterized protein family UPF0031,score FT 96.30, E-value 6e-25" FT /note="Updated (2006) note: Previous uncharacterised Pfam FT motifs have now been designated as PF01256 Carbohydrate FT kinase and PF03853 YjeF-related protein N-terminus. Product FT modified to more specific family member based on motif FT match. No specific characterisation has yet been carried FT out. Putative kept within product function. Functional FT classification - Misc" FT /db_xref="GOA:Q0PBV1" FT /db_xref="InterPro:IPR000631" FT /db_xref="InterPro:IPR004443" FT /db_xref="InterPro:IPR017953" FT /db_xref="UniProtKB/TrEMBL:Q0PBV1" FT /inference="protein motif:Pfam:PF03853" FT /inference="protein motif:Pfam:PF01256" FT /inference="protein motif:Prosite:PS01050" FT /protein_id="CAL34357.1" FT /translation="MKAIIDNIKILEQNAINKGLDELILMENAGLNLAKLIKKEAKKIR FT IQRKIRKVKILFLLGGGNNASDGLVALRNLKHAKAYKIGFKENTLFKKQEQILQNYAFK FT FCKKEPNFKKFHIIIDCILGTGSNRCLDEKTSLIIQKVNQSKALKIACDIPTNLGFYPC FT FKADITFCMGALKEILLEDFAKEFVGRIKIANLGIRSKKFYPNSQAFLLEKKDLKTIDR FT KINANKGNFGHIYIVANASAGTLAGLGALNFGAGLVSLVAQKSFSPLLMLKEKIENNAS FT AIALGMGLENLDFLKDEILQNTPLILDANCFLSEALLWYLNRKDVVITPHPKEFIKLYK FT MCFDENLDIETLQKNRFFYARKFSQNYDCVLVLKGANPIIVQKEKLFVVNLGNQALAKG FT GSGDVLSGMIAAHLGFGFSALEAAKNATLAHGLVAKKYKFNKNSFDALKLIKGLKCL" FT misc_feature complement(183422..184087) FT /note="HMMPfam hit to PF01256, Carbohydrate kinase, score FT 4.5e-26" FT /inference="protein motif:Pfam:PF01256" FT misc_feature complement(183560..183592) FT /note="PS01050 Uncharacterized protein family UPF0031 FT signature 2" FT /inference="protein motif:Prosite:PS01050" FT misc_feature complement(184253..184735) FT /note="HMMPfam hit to PF03853, YjeF-related protein FT N-terminus, score 2.1e-54" FT /inference="protein motif:Pfam:PF03853" FT CDS complement(184770..185468) FT /transl_table=11 FT /locus_tag="Cj0189c" FT /product="conserved hypothetical protein Cj0189c" FT /note="Original (2000) note: Cj0189c, unknown, len: 232 aa; FT similar to hypothetical proteins e.g. TR:P73622 FT (EMBL:D90908) Synechocystis sp. (249 aa), fasta scores; FT opt: 351 z-score: 629.7 E(): 8.1e-28, 30.1% identity in 246 FT aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam PF01936 Protein of unknown FT function (DUF88) was present within CDS. Conserved added to FT product function. Functional classification -Conserved FT hypothetical proteins" FT /db_xref="InterPro:IPR021139" FT /db_xref="UniProtKB/TrEMBL:Q0PBV0" FT /inference="protein motif:Pfam:PF01936" FT /protein_id="CAL34358.1" FT /translation="MENKSIAIFIDAENIPAKYAKSIFDIASDYGEVIIKRIYGDWTQK FT NIQGWREQIAEYSLIAMQQFNFAANKNSSDMYLITEIMSIFYEKNIDIFVIVSSDSDYT FT SLIQKLRENKKQVIGMGLEKSIKSYVNAFSEFFYLDKDESKKEDILSKDYLRALINITE FT QLIDEKGRAEYAQIRTNMNRKYSDFHPQNYGFKNFRALIQKFLPKMKKFEEEREKNIYF FT LVKKDYESYY" FT misc_feature complement(185037..185462) FT /note="HMMPfam hit to PF01936, Protein of unknown function FT DUF88, score 1.1e-05" FT /inference="protein motif:Pfam:PF01936" FT CDS complement(185470..186975) FT /transl_table=11 FT /locus_tag="Cj0190c" FT /product="conserved hypothetical protein Cj0190c" FT /note="Original (2000) note: Cj0190c, unknown, len: 501 aa; FT similar to prokaryotic hypothetical proteins e.g. FT YIFB_ECOLI (516 aa), fasta scores; opt: 670 z-score: 1088.3 FT E(): 0, 34.0% identity in 497 aa overlap, and more FT distantly to members of the eukaryotic MCM family of DNA FT replication regulatory factors e.g. MCM6_RAT DNA FT replication licensing factor MCM6 (509 aa), fasta scores; FT opt: 152 z-score: 247.8 E(): 1.5e-06, 23.5% identity in 345 FT aa overlap. 47.7% identity to HP0792 (anotated as sigma-54 FT interacting protein). Contains PS00017 ATP/GTP-binding site FT motif A (P-loop) and Pfam match to entry PF01078 FT Mg_chelatase, Magnesium chelatase, subunit ChlI, score FT 127.80, E-value 2e-34. Functional classification - Misc" FT /db_xref="GOA:Q0PBU9" FT /db_xref="InterPro:IPR000523" FT /db_xref="InterPro:IPR004482" FT /db_xref="InterPro:IPR020568" FT /db_xref="UniProtKB/TrEMBL:Q0PBU9" FT /inference="protein motif:Pfam:PF01078" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34359.1" FT /translation="MKKLKCISFHEGLDIIEVESTFTRGLPNLSIVGLASTAIKESVER FT IKATLLSCDFAFPAKKITINLSPSGIPKKGSHFDLAIALLILLQNEELDDFFVVGELGL FT DGSIKSTNELFSLLLFLSAKIKKAKIVVPKSIAQKASMIPNLEVYGLENLNEAIEFFKE FT KNYENFRFSHNHPLFANPLQIENEIFLQNMDFKLDFKDIKGQEKAKRACMIAALGMHNI FT LFEGSPGSGKSMCAKRLVYIMPPQSLSEILMQNAYMSLDSKDCEFTKIRAFRHPHHTST FT RASIFGGGTKNARIGEVALANGGVLFFDEFPHFNKQIIESLREPLEDHKIHISRVNSKI FT TYETKFSFIAAQNPCPCGNLFSKNLSCVCSENEIKKYKNHISAPIMDRIDLYVAMDEIS FT KDDKTSISSKEMSEKILQAFIFSKKRGQKEFNGKLKDEDLSRFCVLEKDAKDTLDLAIS FT RYNLSLRSLNKILKVSRSIADLEQSLNISKTHILEALSFRARN" FT misc_feature complement(185923..186927) FT /note="HMMPfam hit to PF01078, Magnesium chelatase,subunit FT ChlI, score 9.4e-40" FT /inference="protein motif:Pfam:PF01078" FT misc_feature complement(186277..186300) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(186972..187499) FT /transl_table=11 FT /gene="def" FT /locus_tag="Cj0191c" FT /product="polypeptide deformylase" FT /EC_number="3.5.1.88" FT /note="Original (2000) note: Cj0191c, def, polypeptide FT deformylase, len: 175 aa; simlar to many e.g. DEF_ECOLI FT polypeptide deformylase (EC 3.5.1.31) (168 aa), fasta FT scores; opt: 376 z-score: 549.9 E(): 2.2e-23, 38.2% FT identity in 165 aa overlap. 55.6% identity to HP0793" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Protein translation and modification" FT /note="PMID:7896716" FT /db_xref="GOA:Q9PIT8" FT /db_xref="InterPro:IPR000181" FT /db_xref="InterPro:IPR023635" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIT8" FT /protein_id="CAL34360.1" FT /translation="MVRKIITYPNPRLFLNSEIVNKFDTELHTLLDDMYETMIASNGVG FT LAAIQVDIPLRVLLVNIFDENDEQKKEDLLEIINPEIIPLDEEMITCTEGCLSVPDFFE FT EVKRYNHILLKYQDRFGEFKELEAKGFLAVAIQHENDHLNGHLFIEKISFAKRQKFDKE FT FKKKKKNHKKEK" FT misc_feature complement(187026..187496) FT /note="HMMPfam hit to PF01327, Polypeptide FT deformylase,score 4.7e-50" FT /inference="protein motif:Pfam:PF01327" FT CDS complement(187535..188119) FT /transl_table=11 FT /gene="clpP" FT /locus_tag="Cj0192c" FT /product="ATP-dependent Clp protease proteolytic subunit" FT /EC_number="3.4.21.92" FT /note="Original (2000) note: Cj0192c, clpP, ATP-dependent FT clp protease proteolytic subunit, len: 194 aa; similar to FT many e.g. CLPP_ECOLI ATP-dependent clp protease proteolytic FT subunit (EC 3.4.21.92) (207 aa), fasta scores; opt: 887 FT z-score: 1437.6 E(): 0, 68.6% identity in 188 aa overlap. FT 78.8% identity to HP0794. Contains PS00381 Endopeptidase FT Clp serine active site, PS00382 Endopeptidase Clp histidine FT active site and Pfam match to entry PF00574 CLP_protease, FT Clp protease, score 425.00,E-value 6.7e-124" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity scores. Putative FT not added to product function. Functional classification FT -Degradation of macromolecules - Proteins, peptides and FT glycopeptides" FT /note="PMID:2197275, PMID:7670637" FT /db_xref="GOA:P54413" FT /db_xref="InterPro:IPR001907" FT /db_xref="InterPro:IPR018215" FT /db_xref="InterPro:IPR023562" FT /db_xref="UniProtKB/Swiss-Prot:P54413" FT /inference="protein motif:Pfam:PF00574" FT /inference="protein motif:Prosite:PS00382" FT /inference="protein motif:Prosite:PS00381" FT /protein_id="CAL34361.1" FT /translation="MFIPYVIEKSSRGERSYDIYSRLLKDRIIMLSGEIHDELAASIVA FT QLLFLEAEDPTKDIYLYINSPGGVITSGFSIYDTMNYIKPDVCTICIGQAASMGAFLLS FT CGAEGKRFALPNSRIMIHQPLGGARGQATDIEIQAKEILRLKTILNDILAKNTKQKVAK FT IAKDTERDFFMSAQEAKEYGLIDKVLEKSFK" FT misc_feature complement(187544..188089) FT /note="HMMPfam hit to PF00574, Clp protease, score 4e-136" FT /inference="protein motif:Pfam:PF00574" FT misc_feature complement(187748..187789) FT /note="PS00382 Endopeptidase Clp histidine active site" FT /inference="protein motif:Prosite:PS00382" FT misc_feature complement(187805..187837) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature complement(187820..187855) FT /note="PS00381 Endopeptidase Clp serine active site" FT /inference="protein motif:Prosite:PS00381" FT CDS complement(188119..189453) FT /transl_table=11 FT /gene="tig" FT /locus_tag="Cj0193c" FT /product="trigger factor (peptidyl-prolyl cis /trans FT isomerase, chaperone)" FT /EC_number="5.2.1.8" FT /note="Original (2000) note: Cj0193c, tig, trigger factor FT (peptidyl-prolyl cis/trans isomerase, chaperone), len: 444 FT aa; 97.0% identical to TIG_CAMJE (410 aa) and similar to FT e.g. TIG_ECOLI trigger factor (432 aa), fasta scores; opt: FT 596 z-score: 615.1 E(): 5.2e-27, 29.7% identity in 437 aa FT overlap. 42.0% identity to HP0795" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Putative not added to product FT function. Functional classification - FT Chaperones,chaperonins, heat shock" FT /note="PMID:7670637" FT /db_xref="GOA:Q46108" FT /db_xref="InterPro:IPR001179" FT /db_xref="InterPro:IPR005215" FT /db_xref="InterPro:IPR008880" FT /db_xref="InterPro:IPR008881" FT /db_xref="UniProtKB/Swiss-Prot:Q46108" FT /protein_id="CAL34362.1" FT /translation="MEVKAKQLDSVNATASVKIPSGMIKSEVENLAKKASKSVKMDGFR FT PGKVPVSAVLKRYERELTQDAEQNLFKSAVNSALQELKKENKELVGEPYFEKFDRKDGE FT IIAELILSFKPEIKLEGYEKLIPEYQTPKVSKKEIDEKKDELLKRFATPEAIKTKRALK FT EGDFAKFDFEGFVDDKAFEGGKAENYVLEIGSKQFIPGFEDGMVGMKIGEEKDIKVTFP FT KEYGAAHLAGKDAVFKVKLHEIQELKIPELDDEMLKKLLPGEEKASVEVLDEKLKEQIK FT NEKLFKLVNDELKGKFADALIEKYNFDLPKGIVEQETDMQMRAAFNTFSEKEIEELKAS FT KEKYQEKRDSFKEEAQKSVKLTFIIDELAKLRKIEVNDQELIQAIYFEAYRYGMNPKEH FT LENYKKQGALPAVKMALIEEKLFNDIFIPKTEKSEKVSKKEKEDK" FT misc_feature complement(188185..188727) FT /note="HMMPfam hit to PF05698, Bacterial trigger factor FT protein (TF) C-ter, score 2e-42" FT /inference="protein motif:Pfam:PF05698" FT misc_feature complement(188728..188985) FT /note="HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl FT cis-trans isomera, score 1.2e-27" FT /inference="protein motif:Pfam:PF00254" FT misc_feature complement(188995..189453) FT /note="HMMPfam hit to PF05697, Bacterial trigger factor FT protein (TF), score 1.3e-44" FT /inference="protein motif:Pfam:PF05697" FT CDS 189596..190168 FT /transl_table=11 FT /gene="folE" FT /locus_tag="Cj0194" FT /product="GTP cyclohydrolase I" FT /EC_number="3.5.4.16" FT /note="Original (2000) note: Cj0194, folE, GTP FT cyclohydrolase I, len: 190 aa; identical to, but slightly FT longer than, GCH1_CAMJE (179 aa), and highly similar to FT many e.g. GCH1_SYNY3 GTP cyclohydrolase I (EC 3.5.4.16) FT (234 aa), fasta scores; opt: 760 z-score: 1327.9 E(): FT 0,60.8% identity in 181 aa overlap. 49.7% identity to FT HP0928. Contains PS00859 GTP cyclohydrolase I signature 1 FT and Pfam match to entry PF01227 GTP_cyclohydro_I, GTP FT cyclohydrolase I, score 377.10, E-value 1.8e-109" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni and many others. Putative not added. FT Functional classification - Biosynthesis of FT cofactors,prosthetic groups and carriers - Folic acid" FT /note="PMID:7670637, PMID:1459137" FT /db_xref="GOA:P51594" FT /db_xref="InterPro:IPR001474" FT /db_xref="InterPro:IPR018234" FT /db_xref="InterPro:IPR020602" FT /db_xref="UniProtKB/Swiss-Prot:P51594" FT /inference="protein motif:Pfam:PF01227" FT /inference="protein motif:Prosite:PS00859" FT /protein_id="CAL34363.1" FT /translation="MQKKFEDCVKTMLEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQ FT NVKEILNDALFESSNNEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPR FT LVEVFARRLQIQEQLTEQIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSA FT LRGIFLKNEKTREEFFSLINSAKQVRF" FT misc_feature 189779..189829 FT /note="PS00859 GTP cyclohydrolase I signature 1" FT /inference="protein motif:Prosite:PS00859" FT misc_feature 189779..190093 FT /note="HMMPfam hit to PF01227, GTP cyclohydrolase I, score FT 9.9e-56" FT /inference="protein motif:Pfam:PF01227" FT CDS 190168..191553 FT /transl_table=11 FT /gene="fliI" FT /locus_tag="Cj0195" FT /product="flagellum-specific ATP synthase" FT /EC_number="3.6.3.14" FT /note="Original (2000) note: Cj0195, FT fliI,flagellum-specific ATP synthase, len: FLII_ECOLI FT flagellum-specific ATP synthase (EC 3.6.1.34) (457 FT aa),fasta scores; opt: 1115 z-score: 1219.0 E(): 0, 43.8% FT identity in 443 aa overlap. 63.9% identity to HP1420. FT Contains PS00017 ATP/GTP-binding site motif A FT (P-loop),PS00152 ATP synthase alpha and beta subunits FT signature and Pfam match to entry PF00006 ATP-synt_ab, ATP FT synthase alpha and beta subunits, score 349.10, E-value FT 4.7e-101" FT /note="Updated (2006) note: Characterised within FT Helicobacter pylori with acceptable identity score. FT Putative not added to product function. Functional FT classification - Surface structures" FT /note="PMID:9231413, PMID:10225855" FT /db_xref="GOA:Q0PBU4" FT /db_xref="InterPro:IPR000194" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR005714" FT /db_xref="InterPro:IPR020003" FT /db_xref="UniProtKB/TrEMBL:Q0PBU4" FT /inference="protein motif:Pfam:PF00006" FT /inference="protein motif:Prosite:PS00152" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34364.1" FT /translation="MNLEKLRSKLGKENLSAIFGEITKISATSIEIRGLKTGVGDIVKL FT VSNENENLNTLAMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVV FT DPFMRPKDGKGAIEATKYMPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGI FT FAGSGVGKSTLMGMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKLDDTVIIVATSD FT DSALMRKYGAFCAMSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPP FT SVLSLLPQLMERTGKEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTD FT FGIYPPINIQNSASRVMSDIISPEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKEL FT DEAISKKEFMQKFLGQNPEESFEFNQTLELLSQIDTPNTPLPPTQNINVGSASATLPNP FT NLK" FT misc_feature 190597..191229 FT /note="HMMPfam hit to PF00006, ATP synthase alpha/beta FT family, nucleotid, score 4.1e-104" FT /inference="protein motif:Pfam:PF00006" FT misc_feature 190660..190683 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 191200..191229 FT /note="PS00152 ATP synthase alpha and beta subunits FT signature" FT /inference="protein motif:Prosite:PS00152" FT CDS complement(191556..192893) FT /transl_table=11 FT /gene="purF" FT /locus_tag="Cj0196c" FT /product="amidophosphoribosyltransferase" FT /EC_number="2.4.2.14" FT /note="Original (2000) note: Cj0196c, FT purF,amidophosphoribosyltransferase, len: 445 aa; highly FT similar to many e.g.PUR1_BACSU FT amidophosphoribosyltransferase precursor (EC 2.4.2.14) (476 FT aa), fasta scores; opt: 1328 z-score: 1541.6 E(): 0,46.1% FT identity in 451 aa overlap. No Hp ortholog. Contains FT PS00103 Purine/pyrimidine phosphoribosyl transferases FT signature and Pfam match to entry PF00310 FT GATase_2,Glutamine amidotransferases class-II, score FT 169.50,E-value 4e-57" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Purine FT ribonucleotide biosynthesis" FT /note="PMID:9271502, PMID:6411717" FT /db_xref="GOA:Q0PBU3" FT /db_xref="InterPro:IPR000583" FT /db_xref="InterPro:IPR000836" FT /db_xref="InterPro:IPR005854" FT /db_xref="InterPro:IPR017932" FT /db_xref="UniProtKB/TrEMBL:Q0PBU3" FT /inference="protein motif:Pfam:PF00310" FT /inference="protein motif:Prosite:PS00103" FT /protein_id="CAL34365.1" FT /translation="MCAVVGVINSKNASTYAYYALFAMQHRGQEASGISVSNGKNIKTI FT KAKGEVSQIFNPDNLKTLEGEIAIGHNRYSTAGNSSLNDAQPIAATSVLGDIALAHNGN FT LVNKEEVRSRLIQDGAIFQTNMDTENVVHLIARSKQESLKDRFIESLKECIGAYCFVLA FT SKDKLYVVRDPHGVRPLSLGRLKDGGYIVASETCAFDLIEAEFIRDVKPGEMLIFTQGN FT DKFESIELFSQTPRICAFEYIYFARPDSIVEGKSVYEVRKKMGEALAKKFAYKADFVVP FT VPDSGVSAAIGFAQYLQIPLEMAIVRNHYVGRTFIEPTQELRNLKVKLKLNPMRKVLEG FT KEIVVIDDSLVRGTTSKKIISLLRAAGASKIHLAIACPEIKFPDTYGIDTPTFEELISA FT NKNAEEVREYVEADTLSFLSIEELTQSIGDERKYSLISFDGDYFIK" FT misc_feature complement(191730..192149) FT /note="HMMPfam hit to PF00156, Phosphoribosyl transferase FT domain, score 2.2e-12" FT /inference="protein motif:Pfam:PF00156" FT misc_feature complement(191829..191867) FT /note="PS00103 Purine/pyrimidine phosphoribosyl FT transferases signature" FT /inference="protein motif:Prosite:PS00103" FT misc_feature complement(192306..192890) FT /note="HMMPfam hit to PF00310, Glutamine amidotransferases FT class-II, score 2.8e-27" FT /inference="protein motif:Pfam:PF00310" FT CDS complement(192895..193623) FT /transl_table=11 FT /gene="dapB" FT /locus_tag="Cj0197c" FT /product="dihydrodipicolinate reductase" FT /EC_number="1.3.1.26" FT /note="Original (2000) note: Cj0197c, dapB, probable FT dihydrodipicolinate reductase, len: 242 aa; highly similar FT to many e.g. DAPB_ECOLI dihydrodipicolinate reductase (EC FT 1.3.1.26) (273 aa), fasta scores; opt: 544 z-score: 912.5 FT E(): 0, 39.6% identity in 265 aa overlap. 42.0% identity to FT HP0510. Contains PS01298 Dihydrodipicolinate reductase FT signature and Pfam match to entry PF01113 FT DapB,Dihydrodipicolinate reductase, score 164.40, E-value FT 1.9e-45" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Amino acid biosynthesis - Aspartate family" FT /note="PMID:9398235, PMID:6094578" FT /db_xref="GOA:Q9PIT2" FT /db_xref="InterPro:IPR000846" FT /db_xref="InterPro:IPR011770" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR022663" FT /db_xref="InterPro:IPR022664" FT /db_xref="InterPro:IPR023940" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIT2" FT /inference="protein motif:Pfam:PF01113" FT /inference="protein motif:Prosite:PS01298" FT /protein_id="CAL34366.1" FT /translation="MIKIGIYGAKGRMGKQIEECLKSETQARISILYDKGGNLGELFEK FT SDVIIDFSSPSGTHELLNYARTMPKPLVIGTTGLDEKILHLMQSASEVMPIFYATNMSL FT GVAVLNYLASKASQMLRNFDIEILEMHHRHKKDAPSGTAMTLAQSVAKARNLELEKVRV FT SGRDGIIGERSKDEIAVMSLRGGDIVGRHTVGFYEDGEFLELNHTATSRATFAKGAIKI FT AIWLSKQEAKMYSINDFLGI" FT misc_feature complement(192901..193311) FT /note="HMMPfam hit to PF05173, Dihydrodipicolinate FT reductase, C-terminus, score 1e-75" FT /inference="protein motif:Pfam:PF05173" FT misc_feature complement(193195..193248) FT /note="PS01298 Dihydrodipicolinate reductase signature" FT /inference="protein motif:Prosite:PS01298" FT misc_feature complement(193318..193620) FT /note="HMMPfam hit to PF01113, Dihydrodipicolinate FT reductase, N-terminus, score 1.7e-38" FT /inference="protein motif:Pfam:PF01113" FT CDS complement(193686..194867) FT /transl_table=11 FT /locus_tag="Cj0198c" FT /product="helicase-like protein" FT /note="Original (2000) note: Cj0198c, unknown, len: 393 aa; FT similar to hypothetical proteins e.g. YCAJ_ECOLI (447 aa), FT fasta scores; opt: 339 z-score: 796.4 E(): 0, 32.8% FT identity in 381 aa overlap, and less strongly to several FT helicases e.g. RUVB_HELPY holliday junction DNA helicase FT ruvB (336 aa), fasta scores; opt: 204 z-score: 280.5 E(): FT 2.3e-08, 28.8% identity in 278 aa overlap. 49.9% identity FT to HP1026. Contains PS00017 ATP/GTP-binding site motif A FT (P-loop)" FT /note="Updated (2006) note: Pfam domain PF00004 ATPase FT family associated with various cellular activities FT (AAA),was identified within CDS. Further support given to FT product function. No specific characterisation has been FT carried out yet. Product function unchanged. Functional FT classification - DNA replication,restriction/modification, FT recombination and repair" FT /db_xref="GOA:Q0PBU1" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR008824" FT /db_xref="InterPro:IPR021886" FT /db_xref="UniProtKB/TrEMBL:Q0PBU1" FT /inference="protein motif:Pfam:PF00004" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34367.1" FT /translation="MSLALTFRPENFDDILGQYELIEIFKKFTALQKLPHSIFFGTAGS FT GKTTFARVVAKEFGLDFYEFDGGNFKLEELRKILDNYKNSLYKPLIFIDEIHRLSKTQQ FT EMLLIPMENYRLILIGASTENPYFVLSSGIRSRSMLFEFKSLGAKELETLLLRVQEKMK FT FSIDKEAKDFLLKSADARAMLNLLEFVLVLDEKHISLENLKKLRNTINSEGVSSKDTHY FT ILASAMIKSLRGSDVDAAIYYLARLIDAGESADFIARRLVIFSSEDVGNADPNALNLAV FT STLDAVKNIGYPEARIILAQCVVYLASTIKSNASYKAINEALNYVKNNEALEIPNYLNN FT NHQEKQNYLYPHDFGGWVEQKYLGKNLKFYHSKGLGEEAKLLDNLYKLKNHKA" FT misc_feature complement(194262..194762) FT /note="HMMPfam hit to PF00004, ATPase family associated FT with various cellul, score 6.5e-07" FT /inference="protein motif:Pfam:PF00004" FT misc_feature complement(194724..194747) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(194867..195988) FT /transl_table=11 FT /locus_tag="Cj0199c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0199c, probable periplasmic FT protein, len: 373 aa; no Hp match. Contains N-terminal FT signal sequence. Functional classification - Miscellaneous FT periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PBU0" FT /protein_id="CAL34368.1" FT /translation="MKKWIFIVFCFILGFIIHIFYIGYTNELLFNKFIKNSNPDYTITD FT IYFKKGFLTSKGSFTLNHSHTQLSTKINLKFNNYFFLNKIIKGNFTNPFDFLDEVLKNN FT KLGTFTLKLHDNNSKIFLNIKDINLSNEGGDTIINGGYIEVLMNKNLEIKNMKIHFDMI FT NFSQFYTKFVLQNLNYEQFFNNPVQFYELNLFSDSQQEINFDYLVLDNNKINSFYSKNQ FT VNFNEENSAVNLNIQGKSNEIDLKSLLGQNLNFDKTKFNITINKFFNSNFNISHFIQKN FT LDLKIQNLILEKNKQNISLQGNLNINNSYQAKLQVISSDEPDEIFPWTKDYGGLNQYFL FT KENNNFFLNLSYDSLANPQLKINGSEFSNMDLN" FT misc_feature complement(195917..195976) FT /note="1 probable transmembrane helix predicted for Cj0199c FT by TMHMM2.0 at aa 5-24" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(196123..196470) FT /transl_table=11 FT /locus_tag="Cj0200c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0200c, probable periplasmic FT protein, len: 115 aa; no Hp match. Contains N-terminal FT signal sequence" FT /note="Updated (2006) note: Literature search papers giving FT further clues to product function. Paper (PMID:12186869) FT links protein to glycoprotein. Functional classification - FT Miscellaneous periplasmic proteins" FT /note="PMID:15554967, PMID:12186869" FT /db_xref="UniProtKB/TrEMBL:Q0PBT9" FT /protein_id="CAL34369.1" FT /translation="MKKSILFASALLASSMLFADSLKLEGTIAQIYDNNKTLLIDSIYG FT GQMAIKVLPNTEIEMDDCGIFGTDKDGTFKDLQVGNFLESKISYGTPATPNTQAIPVAR FT KIEIQCYKKAY" FT sig_peptide complement(196414..196470) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000099_196123_196470 by SignalP 2.0 FT HMM (Signal peptide probability 0.998) with cleavage site FT probability 0.642 between residues 19 and 20" FT CDS complement(196534..197139) FT /transl_table=11 FT /locus_tag="Cj0201c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0201c, probable integral FT membrane protein, len: 201 aa; no Hp match. Contains FT possible transmembrane domain at N-terminus and PS00216 FT Sugar transport proteins signature 1. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PBT8" FT /inference="protein motif:Prosite:PS00216" FT /protein_id="CAL34370.1" FT /translation="MFYLNKILYFFLILFLLIGILGFFINSNPSNQIIKKPYLPFLEIG FT DLVFRAGIGSESFLIENLSQSPYSHIAMVVKTSPTILIHATTDDDKNAKNQVILSSMDD FT FLKLSHKIAIKRLKFDEKTKQKIVAKDLEHLGRKFIISTDKDAFYCTTFLEQSINSITP FT FHLQYTLIKAPFNEGLYLFPQTFFENNQSVLIYESQNF" FT misc_feature complement(196711..196758) FT /note="PS00216 Sugar transport proteins signature 1" FT /inference="protein motif:Prosite:PS00216" FT sig_peptide complement(197044..197139) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000100_196534_197139 by SignalP 2.0 FT HMM (Signal peptide probability 0.992) with cleavage site FT probability 0.527 between residues 32 and 33" FT misc_feature complement(197062..197121) FT /note="1 probable transmembrane helix predicted for Cj0201c FT by TMHMM2.0 at aa 7-26" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(197123..197464) FT /transl_table=11 FT /locus_tag="Cj0202c" FT /product="hypothetical protein Cj0202c" FT /note="Original (2000) note: Cj0202c, unknown, len: 113 aa. FT No Hp match. Functional classification - Unknown" FT /db_xref="InterPro:IPR024267" FT /db_xref="PDB:3K7C" FT /db_xref="UniProtKB/TrEMBL:Q0PBT7" FT /protein_id="CAL34371.1" FT /translation="MAYGSSNPEDLAKNFTKDLYSGDTKSVMSYIDLSEAKSDEEKTFV FT SDKITQVVAENAAKAKRMGGVKDIQIEEKTINKDSAKIRVLVLFNNDNNQSSNVFLAKK FT DRKWLVLLK" FT CDS 197707..199053 FT /transl_table=11 FT /locus_tag="Cj0203" FT /product="putative citrate transporter" FT /note="Original (2000) note: Cj0203, probable transmembrane FT transport protein, len: 448 aa; some similarity to e.g. FT CITM_BACSU Mg2+/citrate complex secondary transporter (433 FT aa), fasta scores; opt: 702 z-score: 964.3 E(): 0, 28.7% FT identity in 449 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF03600 Citrate FT transporter was identified within CDS. Twelve probable FT transmembrane helices predicted by TMHMM2.0. Product FT modified to more specific family member due to motif match. FT Some characterisation work has been carried out within FT Bacillus subtilis, however, identity scores were marginal. FT Putative kept within product function. Functional FT classification - Transport/binding proteins -Other" FT /note="PMID:8892821" FT /db_xref="GOA:Q0PBT6" FT /db_xref="InterPro:IPR004680" FT /db_xref="InterPro:IPR014738" FT /db_xref="UniProtKB/TrEMBL:Q0PBT6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03600" FT /protein_id="CAL34372.1" FT /translation="MEIFLALLGFFSLGLIVWLLLKDYTTPALAFISVSISVACILLIL FT ERLGFGVGVALGVKGGVFDIKTLVVFIKDGVKSVTDTAALFVFSILFFSVLNASGFFTK FT ILNAFLSKMKANVYQVCILTVFIAAAVHLDGSGASTFLIVIPALLPIYERLGIRKTSML FT LIITSAMGVMNVIPWGGPTLRAATNIGMDANLLWHHIIPIQIVGLVLSLLLAIWIAKIE FT IKRGAGAGNLSGINLNIEKSEHHNEKWFWLNLLVAIGVIGLLISGIIPSYICFMIGLAI FT ILPLNYPNLKTAKKVLDRASAGAMLMYITLIGAGILIGVFDKSGIMEKMGVLILNFVPD FT YLGAYIPLMVGILAVPMAIIFCTDSYFYGVMPIVLSVTKAFGAEPLTIAIIMVIARNCA FT TFISPVVPATLLGCGLAEVNIKDHIKRSFFYIWGISIICLIFAEVAGII" FT sig_peptide 197707..197796 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000102_197707_199053 by SignalP 2.0 FT HMM (Signal peptide probability 0.691) with cleavage site FT probability 0.650 between residues 30 and 31" FT misc_feature order(197716..197769,197788..197841,197854..197922, FT 197956..198024,198082..198150,198187..198246, FT 198289..198357,198451..198552,198610..198669, FT 198727..198795,198823..198891,198988..199047) FT /note="12 probable transmembrane helices predicted for FT Cj0203 by TMHMM2.0 at aa 4-21, 28-45, 50-72, FT 84-106,126-148, 161-180, 195-217, 249-282, 302-321, FT 341-363,373-395 and 428-447" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 197728..198906 FT /note="HMMPfam hit to PF03600, Citrate transporter, score FT 7.1e-122" FT /inference="protein motif:Pfam:PF03600" FT misc_feature 197794..197826 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 198913..198945 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 199236..201233 FT /transl_table=11 FT /locus_tag="Cj0204" FT /product="putative oligopeptide transporter, OPT family" FT /note="Original (2000) note: Cj0204, probable integral FT membrane protein, len: 665 aa; 98.9% identity in 369 aa FT overlap to TR:Q46110 (EMBL:X76062) C. jejuni ORF CJO1.1 FT (381 aa). Similar to hypothetical proteins e.g. Y561_HAEIN FT HI0561/560 (633 aa), fasta scores; opt: 2119 z-score: FT 1501.8 E(): 0, 53.6% identity in 640 aa overlap, and in FT C-terminus to TR:Q51156 (EMBL:L09189) Neisseria FT meningitidis ORF associated with capsule gene complex (282 FT aa), fasta scores; opt: 880 z-score: 1097.6 E(): 0, 51.3% FT identity in 273 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF03169 OPT FT oligopeptide transporter protein was identified within CDS. FT Sixteen probable transmembrane helices predicted by FT TMHMM2.0. Product modified to more specific family member FT due to motif match. Putative kept within product function. FT Functional classification - Transport/binding proteins FT -Other" FT /note="PMID:7489896" FT /db_xref="GOA:Q0PBT5" FT /db_xref="InterPro:IPR004813" FT /db_xref="InterPro:IPR004814" FT /db_xref="UniProtKB/TrEMBL:Q0PBT5" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03169" FT /protein_id="CAL34373.1" FT /translation="MMYKKQNLPELTLRGLILGSILTIIFTASNVYLGLKVGLTFSSSI FT PAVVISMAVLSLFKTSNILENNMVQTQASAAGTLSSVIFVIPGLFMCGYWSEFPLWQTF FT MICLCGGGLGVLFTIPLRRTMVVESKLAYPEGRAAAEILKVANKDQSSKKGKQGIKEIA FT LGSFIAAIFSLLSNGFKLAASESNFAFIWNKMAFGFSMGYSLALLGAGYLVGLAGAIAL FT FVGMFLAWGIFTPYLSNFEFDSTKNAVDLASSVWSSKVRLIGTGAIAIAALWTLIELLK FT PVIEGIKEIVKNVKITNQEKNERTNIDLSLKSIFILFVLMVVGLFITFYSFVEDANLSI FT YYQMLFSFVGTLVSVLIGFFVAAACGYMAGLVGSSSSPISGIGLIGVIISSIVFLVLGV FT ELFQDPMLSKFAVALAIFTTSVILATAAISNDNLQDLKTGHLVGATPWKQQVALLVGCV FT FGALAIVPVLNLLYQAYGFVGAMPREGMDASSALAAPQANLMSTIAQGIFHHNIEWGYM FT AFGVFVGILMIIIDKILKGTQKMSLPPLAVGIGIYLPPAVNIPLVIGGILKYIVMQHLT FT KKYAKNSHKEEKLASCEQRGTLFASGLIVGESIFGVIIAGITVFSVSMGGSENPLALNL FT ANFHDSELFALIFFVGVVLYFIKRIVKKDA" FT misc_feature 199263..201092 FT /note="HMMPfam hit to PF03169, OPT oligopeptide transporter FT protein, score 1.1e-95" FT /inference="protein motif:Pfam:PF03169" FT misc_feature order(199272..199340,199350..199418,199452..199520, FT 199530..199598,199719..199787,199797..199865, FT 199869..199937,200175..200234,200268..200336, FT 200364..200432,200451..200519,200583..200651, FT 200757..200825,200868..200936,201027..201095, FT 201138..201206) FT /note="16 probable transmembrane helices predicted for FT Cj0204 by TMHMM2.0 at aa 13-35, 39-61, 73-95, FT 99-121,162-184, 188-210, 212-234, 314-333, 345-367, FT 377-399,406-428, 450-472, 508-530, 545-567, 598-620 and FT 635-657" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 200298..200330 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 201307..202110 FT /transl_table=11 FT /gene="uppP" FT /locus_tag="Cj0205" FT /product="undecaprenyl-diphosphatase" FT /EC_number="3.6.1.27" FT /note="Original (2000) note: Cj0205, bacA, possible FT undecaprenol kinase (bacitracin resistance protein), len: FT 267 aa; 98.6% identity in 138 aa overlap to TR:Q46111 C. FT jejuni ORF CJO1.2 (138 aa). Simlar to e.g. BACA_ECOLI FT bacitracin resistance protein (putative undecaprenol FT kinase) (273 aa), fasta scores; opt: 483 z-score: 947.5 FT E(): 0, 43.7% identity in 270 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF02673 Bacitracin FT resistance protein BacA was identified within CDS. Seven FT probable transmembrane helices predicted by TMHMM2.0. FT Literature search identified characterisation papers within FT Escherichia coli that show further specification with FT product functionality (PMID:15778224). Product function FT modified to more specific family member. Identity scores FT were acceptable. Thus, putative not added to product FT function. Functional classification -Drug/analogue FT sensitivity" FT /note="PMID:7489896, PMID:8389741, FT PMID:15138271,PMID:15778224" FT /db_xref="GOA:Q9PIS4" FT /db_xref="InterPro:IPR003824" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIS4" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02673" FT /protein_id="CAL34374.1" FT /translation="MENLYALILGIIEGLTEFLPISSTGHMILGTTILGIDIDEFWKSF FT LIIIQLGSILAVIFVFWRKLFQGLDIWLKLAVGFFPTGVIGLFVAKYLNALFNGWVVVG FT MLIFGGVVFILIELAHKNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGG FT LLLEFNRKVAAEFSFLLAIPTMIIATAYSIYKEPELLGNANSLIPLGIGFITAFIVAVL FT VIKFFLKFISKFDFIPFGIYRIILGFVFFYLYYSGILNAGSEFKL" FT misc_feature 201319..202056 FT /note="HMMPfam hit to PF02673, Bacitracin resistance FT protein BacA, score 3.2e-133" FT /inference="protein motif:Pfam:PF02673" FT misc_feature order(201325..201393,201436..201504,201517..201576, FT 201604..201663,201820..201888,201931..201999, FT 202012..202080) FT /note="7 probable transmembrane helices predicted for FT Cj0205 by TMHMM2.0 at aa 7-29, 44-66, 71-90, FT 100-119,172-194, 209-231 and 236-258" FT /inference="protein motif:TMHMM:2.0" FT CDS 202241..204049 FT /transl_table=11 FT /gene="thrS" FT /locus_tag="Cj0206" FT /product="threonyl-tRNA synthetase" FT /EC_number="6.1.1.3" FT /note="Original (2000) note: Cj0206, thrS, threonyl-tRNA FT synthetase, len: 602 aa; similar to many e.g. SYT_ECOLI FT threonyl-tRNA synthetase (EC 6.1.1.3) (642 aa), fasta FT scores; opt: 1669 z-score: 1426.5 E(): 0, 43.0% identity in FT 603 aa overlap. 64.4% identity to HP0123. Contains PS00179 FT and PS00339 Aminoacyl-transfer RNA synthetases class-II FT signatures 1 and 2, and Pfam match to entry PF00587 FT tRNA-synt_2b, tRNA synthetases class II (Gly, His,Pro and FT Ser), score 284.30, E-value 1.5e-81" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Aminoacyl tRNA synthetases and their modification" FT /note="PMID:6353409, PMID:10881191" FT /db_xref="GOA:Q9PIS3" FT /db_xref="InterPro:IPR002314" FT /db_xref="InterPro:IPR002320" FT /db_xref="InterPro:IPR004154" FT /db_xref="InterPro:IPR006195" FT /db_xref="InterPro:IPR012947" FT /db_xref="InterPro:IPR018163" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIS3" FT /inference="protein motif:Pfam:PF00587" FT /inference="protein motif:Prosite:PS00339" FT /inference="protein motif:Prosite:PS00179" FT /protein_id="CAL34375.1" FT /translation="MEKEVIAYLDNETIIDSQSVKNTNLKEIYFDNSKESLEVIRHSCA FT HLMAQAIKSLYPEAKFFVGPVIEDGFYYDFRVESKIGEEDLVKIEKKMKELAEAKIEIS FT KYEITKSEALAKFQNDDLKQEVLLRIPDRAVSIYKQGEFEDLCRGPHVPNTKFLRFFKL FT TRVAGAYLGGDEKREMLTRIYGTAFADKESLKEYLTIIEEAKKRDHRKLGTELKLFTFD FT DEIGGGLPIWLSNGARLRSKLEHMLYKIHRLRGYEPVRGPELLKADAWKISGHYANYKE FT NMYFTQIDEQEYGIKPMNCVGHIKIYQSDVRSYRDLPLKFFEYGVVHRHEKSGVLHGLF FT RVREFTQDDAHIFCMPSQIKEQVLEILAFVDNLMKLFDFSYEMEISTKPEKAIGDDEIW FT EIATKALKEALDEQGLKYGIDEGGGAFYGPKIDIKITDALKRKWQCGTIQVDFNLPSRF FT KLEYTDSDNEKKQPVMLHRAILGSFERFIGILTEHCAGEFPFFIAPTAVGIVPIGEAHI FT AYAKEIQKELLELNIDSEVYEKNESLSKKIRIAEKQKLPMILVLGDDEVAKRSVALRDR FT RAKEQKNLSLDEFIKLVKEKMSEVHF" FT misc_feature 202922..203383 FT /note="HMMPfam hit to PF00587, tRNA synthetase class II FT core domain (, score 1e-48" FT /inference="protein motif:Pfam:PF00587" FT misc_feature 203222..203287 FT /note="PS00179 Aminoacyl-transfer RNA synthetases class-II FT signature 1" FT /inference="protein motif:Prosite:PS00179" FT misc_feature 203678..203707 FT /note="PS00339 Aminoacyl-transfer RNA synthetases class-II FT signature 2" FT /inference="protein motif:Prosite:PS00339" FT misc_feature 203756..204028 FT /note="HMMPfam hit to PF03129, Anticodon binding FT domain,score 2.9e-26" FT /inference="protein motif:Pfam:PF03129" FT CDS 204046..204564 FT /transl_table=11 FT /gene="infC" FT /locus_tag="Cj0207" FT /product="translation initiation factor IF-3" FT /note="Original (2000) note: Cj0207, infC, translation FT initiation factor IF-3, len: 172 aa; similar to e.g. FT IF3_BACSU translation initiation factor IF-3 (171 aa),fasta FT scores; opt: 523 z-score: 933.6 E(): 0, 46.4% identity in FT 166 aa overlap. 66.1% identity to HP0124. Contains PS00938 FT Initiation factor 3 signature and Pfam match to entry FT PF00707 IF3, Translation initiation factor IF-3, score FT 158.60, E-value 1.1e-43" FT /note="Updated (2006) note: Characterised within Bacillus FT stearothermophilus with acceptable identity score. Putative FT not added to product function. Functional classification - FT Protein translation and modification" FT /note="PMID:2779520" FT /db_xref="GOA:Q9PIS2" FT /db_xref="InterPro:IPR001288" FT /db_xref="InterPro:IPR019813" FT /db_xref="InterPro:IPR019814" FT /db_xref="InterPro:IPR019815" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIS2" FT /inference="protein motif:Pfam:PF00707" FT /inference="protein motif:Prosite:PS00938" FT /protein_id="CAL34376.1" FT /translation="MSKEKEVLLNEEIRADEIRCVGDDGKVYGIISSDEALEIANRLGL FT DLVMIAADAKPPVCKIMDYGKFRYQQEKKQKEAKKKQKVIDIKEIKLSVKIAQNDINYK FT VKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYV FT NMLVTPKKA" FT misc_feature 204055..204282 FT /note="HMMPfam hit to PF05198, Translation initiation FT factor IF-3, N-termin, score 2.5e-47" FT /inference="protein motif:Pfam:PF05198" FT misc_feature 204223..204264 FT /note="PS00938 Initiation factor 3 signature" FT /inference="protein motif:Prosite:PS00938" FT misc_feature 204295..204558 FT /note="HMMPfam hit to PF00707, Translation initiation FT factor IF-3, C-termin, score 3.5e-31" FT /inference="protein motif:Pfam:PF00707" FT CDS 204603..205694 FT /transl_table=11 FT /locus_tag="Cj0208" FT /product="putative DNA modification methylase FT (adenine-specific methyltransferase)" FT /EC_number="2.1.1.72" FT /note="Original (2000) note: Cj0208, probable DNA FT modification methylase (adenine-specific FT methyltransferase), len: 363 aa; similar to many e.g. FT MTN3_NEILA modification methylase NlaIII (EC 2.1.1.72) (334 FT aa), fasta scores; opt: 215 z-score: 401.1 E(): 4.4e-15, FT 31.7% identity in 366 aa overlap. 29.6% identity to HP1208 FT ulcer associated adenine specific DNA methyltransferase. FT Contains PS00092 N-6 Adenine-specific DNA methylases FT signature" FT /note="Updated (2006) note: Pfam domain PF02086 D12 class FT N6 adenine-specific DNA methyltransferase was identified FT within CDS. Further support given to product function. FT Characterised within Neisseria lactamica with marginal FT identity scores. Putative kept within product function. FT Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:2277628" FT /db_xref="GOA:Q0PBT1" FT /db_xref="InterPro:IPR002052" FT /db_xref="InterPro:IPR012327" FT /db_xref="UniProtKB/TrEMBL:Q0PBT1" FT /inference="protein motif:Pfam:PF02086" FT /inference="protein motif:Prosite:PS00092" FT /protein_id="CAL34377.1" FT /translation="MKENPSFLKEQIITYLGNKRALLSFLNNGFKVAKKELGKDKFSFC FT DIFSGSGVVSRFAKAHSNYILANDLEDYSKLINECYLANKDKDLLQNIKKYYKNLIQNL FT DFQKGFISELYAPKDDDDIKKNERVFYTFKNALYLDTIRQKIENEIPKELRHFFIAPLI FT YEASVHSNTSGVFKGFYKGKDGIGKFGGEGQNALKRIKGEIELKMPIFSNFSCEFEVMQ FT KDANMLAKELDFFDVVYLDPPYNQHPYSSNYFMLNLIANYKKPEEISKISGIPKDWNRS FT TFNKSKFAQDALFELINDLKARVILLSYNCEGFVKKEIFLKRLSTLGKCRILEQKYNTF FT RASRNLKNRNIHLHEQLYILVKN" FT misc_feature 204645..205571 FT /note="HMMPfam hit to PF02086, D12 class N6 FT adenine-specific DNA met, score 2.6e-08" FT /inference="protein motif:Pfam:PF02086" FT misc_feature 205314..205334 FT /note="PS00092 N-6 Adenine-specific DNA methylases FT signature" FT /inference="protein motif:Prosite:PS00092" FT CDS join(206063..206308,206308..206691,206724..206939, FT 206939..206974,206974..207063,207095..207310, FT 207314..207637,207636..207770,207775..207843, FT 207843..207980,208012..208203,208203..208337, FT 208336..208473,208475..208666,208673..208846, FT 208852..208950,208954..209055,209055..209195) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0223" FT /product="pseudogene (putative IgA protease family FT protein)" FT /EC_number="3.4.21.72" FT /note="Original (2000) note: Cj0223, probable FT pseudogene,len: 3423 bp similar to several members of the FT IgA protease/haemaglutinin/sepA family e.g. IGA2_HAEIN FT immunoglobulin A1 protease precursor (EC FT 3.4.21.72),TR:Q54151 (EMBL:U35656) Shigella flexneri she FT hemagglutinin, and TR:Q54165 (EMBL:Z48219) Shigella FT flexneri sepA gene precursor. No apparent Hp match" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity score (aligning whole FT sequence),has been carried out yet. Thus, putative added to FT product function. Coding sequence has been updated to FT reflect the complete amino acid sequence for the encoded FT protein regardless of its expression. This will cause FT differences from the amino acid sequence of the previous FT annotation. Functional classification - Pathogenicity" FT /note="PMID:10225873, PMID:10531204" FT CDS 209279..210307 FT /transl_table=11 FT /gene="argC" FT /locus_tag="Cj0224" FT /product="N-acetyl-gamma-glutamyl-phosphate reductase" FT /EC_number="1.2.1.38" FT /note="Original (2000) note: Cj0224, argC, probable FT N-acetyl-gamma-glutamyl-phosphate reductase, len: 342 aa; FT similar to many e.g. ARGC_BACSU FT N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) FT (346 aa), fasta scores; opt: 980 z-score: 1444.4 E(): FT 0,46.2% identity in 338 aa overlap. No Hp ortholog. FT Contains Pfam match to entry PF01118 Semialdhyde_dh, FT Semialdehyde dehydrogenase, score 259.10, E-value 5.8e-74" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Amino acid FT biosynthesis - Glutamate family" FT /note="PMID:10588044, PMID:3106155" FT /db_xref="GOA:Q9PIS0" FT /db_xref="InterPro:IPR000534" FT /db_xref="InterPro:IPR000706" FT /db_xref="InterPro:IPR012280" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR023013" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIS0" FT /inference="protein motif:Pfam:PF01118" FT /protein_id="CAL34379.1" FT /translation="MKIKVGILGASGYAGNELVRILLNHPKVEISYLGSSSSVGQNYQD FT LYPNTPLNLCFENKNLDELELDLLFLATPHKFSAKLLNENLLKKMKIIDLSADFRLKNP FT KDYELWYKFTHPNQELLQNAVYGLCELYKEEIKKASLVANPGCYTTCSILSLYPLFKEK FT IIDFSSVIIDAKSGVSGAGRSAKVENLFCEVNENIKAYNLALHRHTPEIEEHLSYAAKE FT KITLQFTPHLVPMQRGILISAYANLKEDLQEQDIRDIYTKYYQNNKFIRLLPPQSLPQT FT RWVKSSNFADINFSVDQRTKRVIVLGAIDNLIKGAAGQAVQNMNLMFDFDEDEGLKFFA FT NL" FT misc_feature 209282..209707 FT /note="HMMPfam hit to PF01118, Semialdehyde FT dehydrogenase,NAD bindi, score 1.1e-35" FT /inference="protein motif:Pfam:PF01118" FT misc_feature 209744..210220 FT /note="HMMPfam hit to PF02774, Semialdehyde FT dehydrogenase,dimerisat, score 2.1e-41" FT /inference="protein motif:Pfam:PF02774" FT CDS 210317..210763 FT /transl_table=11 FT /locus_tag="Cj0225" FT /product="putative acetyltransferase" FT /EC_number="2.3.-.-" FT /note="Original (2000) note: Cj0225, probable FT acetyltransferase, len: 148 aa; some simlarity to STA_ECOLI FT streptothricin acetyltransferase (plasmid borne)(EC FT 2.3.-.-) (174 aa), fasta scores; opt: 118 z-score: 186.2 FT E(): 0.0041, 27.3% identity in 110 aa overlap. No Hp match. FT Contains Pfam match to entry PF00583 Acetyltransf, FT Acetyltransferase (GNAT) family, score 57.00, E-value FT 4.1e-13" FT /note="Updated (2006) note: Characterisation carried out FT within Escherichia coil, however, identity score was FT marginal. Putative kept within product function. Functional FT classification - Misc" FT /note="PMID:2157196" FT /db_xref="GOA:Q0PBS9" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:Q0PBS9" FT /inference="protein motif:Pfam:PF00583" FT /protein_id="CAL34380.1" FT /translation="MLIRAMQKSDYEAVYKLWCEIKGFGIRSIDDSKENIENFLDRNPN FT LSVVAVIDEEIVGSILCGHDGRTGGFYHVCVHKDHRKKGIAHEMAKFCLEALKAQKINK FT IALIAFKNNDLGNEFWKHYGFTLREDANYYDLSLNEYNQTSFNA" FT misc_feature 210458..210694 FT /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT) FT family, score 4.1e-15" FT /inference="protein motif:Pfam:PF00583" FT CDS 210767..211612 FT /transl_table=11 FT /gene="argB" FT /locus_tag="Cj0226" FT /product="acetylglutamate kinase" FT /EC_number="2.7.2.8" FT /note="Original (2000) note: Cj0226, argB, probable FT acetylglutamate kinase, len: 281 aa; similar to many e.g. FT ARGB_PORPU acetylglutamate kinase (EC 2.7.2.8) (283 FT aa),fasta scores; opt: 784 z-score: 1169.3 E(): 0, 43.6% FT identity in 282 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF00696 Amino acid FT kinase family was identified within CDS. Further support FT given to product function. Characterised within Escherichia FT coli with acceptable identity score. Putative not added to FT product function. Functional classification -Amino acid FT biosynthesis - Glutamate family" FT /note="PMID:10588044, PMID:2851495, PMID:12005432" FT /db_xref="GOA:Q9PIR8" FT /db_xref="InterPro:IPR001048" FT /db_xref="InterPro:IPR001057" FT /db_xref="InterPro:IPR004662" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIR8" FT /inference="protein motif:Pfam:PF00696" FT /protein_id="CAL34381.1" FT /translation="MIMQKYLEKANVLIEALPYIRKFNSKIILIKYGGSAMENEELKHC FT VMQDIALLKLVGLKPIIVHGGGKDISAMCEKLGVKSEFKNGLRVSDKATIEVASMVLNH FT INKNLVHSLQNLGVKAIGLCGKDGALLECVKKDENLAFVGTIQKVNSKILEELLEKDFL FT PIIAPIGMDENFNTYNINADDAACAIAKALRAEKLAFLTDTAGLYEDFNDKNSLISKIS FT LEQAKILAPKIEGGMHVKLKSCIDACENGVKKVHILDGRVKHSLLLEFFTDEGIGTLVG FT " FT misc_feature 210842..211543 FT /note="HMMPfam hit to PF00696, Amino acid kinase FT family,score 3.1e-51" FT /inference="protein motif:Pfam:PF00696" FT CDS 211616..212803 FT /transl_table=11 FT /gene="argD" FT /locus_tag="Cj0227" FT /product="putative acetylornithine/succinyldiaminopimelate FT aminotransferase" FT /EC_number="2.6.1.11" FT /EC_number="2.6.1.17" FT /note="Original (2000) note: Cj0227, argD, probable FT acetylornithine aminotransferase, len: 395 aa; simlar to FT many e.g. ARGD_ECOLI acetylornithine aminotransferase (EC FT 2.6.1.11) (406 aa), fasta scores; opt: 921 z-score: 1042.0 FT E(): 0, 36.6% identity in 385 aa overlap. No Hp ortholog. FT Contains Pfam match to entry PF00202 FT aminotran_3,Aminotransferases class-III FT pyridoxal-phosphate, score 378.20, E-value 5.1e-131" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Based on FT current literature, product function has been modified and FT additional EC number has been added. Putative kept within FT product function. Functional classification - Amino acid FT biosynthesis - Glutamate family" FT /note="PMID:10588044, PMID:10074354" FT /db_xref="GOA:Q9PIR7" FT /db_xref="InterPro:IPR004636" FT /db_xref="InterPro:IPR005814" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="PDB:3NX3" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIR7" FT /inference="protein motif:Pfam:PF00202" FT /protein_id="CAL34382.1" FT /translation="MKMDYKEQSHIIPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGI FT GVCALGYNHAKFNAKIKAQVDKLLHTSNLYYNENIAAAAKNLAKASALERVFFTNSGTE FT SIEGAMKTARKYAFNKGVKGGQFIAFKHSFHGRTLGALSLTANEKYQKPFKPLISGVKF FT AKYNDISSVEKLVNEKTCAIILESVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQ FT CGMGRSGKFFAYEHAQILPDIMTSAKALGCGLSVGAFVINQKVASNSLEAGDHGSTYGG FT NPLVCAGVNAVFEIFKEEKILENVNKLTPYLEQSLDELINEFDFCKKRKGLGFMQGLSL FT DKSVKVAKVIQKCQENALLLISCGENDLRFLPPLILQKEHIDEMSEKLRKALKSF" FT misc_feature 211643..212800 FT /note="HMMPfam hit to PF00202, Aminotransferase FT class-III,score 4.3e-133" FT /inference="protein motif:Pfam:PF00202" FT CDS complement(212822..213451) FT /transl_table=11 FT /gene="pcm" FT /locus_tag="Cj0228c" FT /product="protein-L-isoaspartate O-methyltransferase" FT /EC_number="2.1.1.77" FT /note="Original (2000) note: Cj0228c, pcm, probable FT protein-L-isoaspartate O-methyltransferase, len: 209 aa FT PIMT_ECOLI protein-L-isoaspartate O-methyltransferase (EC FT 2.1.1.77) (207 aa), fasta scores; opt: 463 z-score: 633.3 FT E(): 5.1e-28, 35.3% identity in 204 aa overlap. 53.8% FT identity to HP0363. Contains Pfam match to entry PF01135 FT PCMT, Protein-L-isoaspartate(D-aspartate) FT O-methyltransferase (PCMT), score 181.40, E-value 1.4e-50" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Protein translation and modification" FT /note="PMID:1860862" FT /db_xref="GOA:Q0PBS6" FT /db_xref="InterPro:IPR000682" FT /db_xref="UniProtKB/TrEMBL:Q0PBS6" FT /inference="protein motif:Pfam:PF01135" FT /protein_id="CAL34383.1" FT /translation="MNAFEQKRCQNMAEEIAQKVFINEELFNAFCQIPREIFSPLKAHA FT YRLDALPLANSQWISSPLTVAKMTMALDFKNADSILEIGCGSGYQAAILSKVIRRVFTI FT ERIENLAKKAAQTFRELELFNINVKFDDGQNGWKNYAPYDRILFSAYATQIPEILLDQL FT SDDGILVAPILHNGKQFITRLRKNGTNLQKEILEECLFVPIVDGKE" FT misc_feature complement(212825..213439) FT /note="HMMPfam hit to FT PF01135,Protein-L-isoaspartate(D-aspartate) O-methyl, score FT 1e-51" FT /inference="protein motif:Pfam:PF01135" FT CDS 213540..214088 FT /transl_table=11 FT /locus_tag="Cj0229" FT /product="putative acetyltransferase" FT /note="Original (2000) note: Cj0229, possible FT acetyltransferase, len: 182 aa; similar to e.g. CAIE_ECOLI FT carnitine operon protein caiE (203 aa), fasta scores; opt: FT 251 z-score: 517.5 E(): 1.4e-21, 33.1% identity in 169 aa FT overlap. No Hp ortholog. Contains 3x Pfam match to entry FT PF00132 hexapep, Bacterial transferase hexapeptide (four FT repeats), scores 16.60, E-value 0.0071; 9.10, E-value 0.97 FT and 24.70, E-value 3.7e-05" FT /note="Updated (2006) note: Some characterisation work FT within Escherichia coli, however, identity score was FT marginal. Putative kept within product function. Functional FT classification - Misc" FT /note="PMID:7815937" FT /db_xref="GOA:Q0PBS5" FT /db_xref="InterPro:IPR001451" FT /db_xref="InterPro:IPR011004" FT /db_xref="UniProtKB/TrEMBL:Q0PBS5" FT /inference="protein motif:Pfam:PF00132" FT /protein_id="CAL34384.1" FT /translation="MLIKFKNHSPKLGQNVFVAEGAKIIGEIEIGDESSIWFNCVLRAD FT VNFIKIGKRTNIQDLSTVHVWHREFDEKGKLKDAGFPTIIGDDVTIGHNCVIHACVIKN FT RVLIGMNAVIMDNALIEEDSIVGAGSVVTKGKKFPPRSLILGNPAKFVRELNDEEVSFL FT KQSALNYVDFKNEFLKDLQ" FT misc_feature 213582..213635 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 7.6" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 213681..213734 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 1.1e+02" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 213783..213836 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 0.0059" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 213837..213887 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 21" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 213888..213941 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 8.1" FT /inference="protein motif:Pfam:PF00132" FT CDS complement(214057..215430) FT /transl_table=11 FT /locus_tag="Cj0230c" FT /product="putative transferase protein" FT /EC_number="2.4.2.11" FT /note="Original (2000) note: Cj0230c, unknown, len: 457 aa; FT similar to hypothetical proteins e.g. TR:O51580 FT (EMBL:AE001165) Borrelia burgdorferi BB0635 (481 aa),fasta FT scores; opt: 1037 z-score: 1499.1 E(): 0, 41.1% identity in FT 479 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF04095 Nicotinate FT phosphoribosyltransferase (NAPRTase) family was identified FT within CDS. Product modified to more specific family member FT due to motif match. No specific characterisation has been FT carried out yet. Putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PBS4" FT /db_xref="InterPro:IPR002638" FT /db_xref="InterPro:IPR006405" FT /db_xref="InterPro:IPR007229" FT /db_xref="InterPro:IPR015977" FT /db_xref="UniProtKB/TrEMBL:Q0PBS4" FT /inference="protein motif:Pfam:PF04095" FT /protein_id="CAL34385.1" FT /translation="MMTSKTSLALLCDFYEFTMSQGYFKNNKKDQICYFDIFFRKIPDS FT GSFAIFAGLEDILDFVENLSFDAEDIEFLRKQGIFDTEFLDFLANFKFKGEIYAMREGE FT VIFPNEPLLCIKATTIEAQLLETFLLLSLNHQSLIATKTNRIVRAAKDSKILEFGSRRA FT QGSEAALKGARAAFIGGCIGSACTLAGKIYNIPINGTMAHSWVQMFENELEAFKAYVKI FT YPKNPVFLIDTYDCLNSGLKNAIKVFKEFGIQEGGVRIDSGNLLELSLKIRQELDQAGL FT QKCKIIVSNALDEWSIKKLKEQNAPIDIFGVGERLITASSDPIFSCVYKLAALEDQGIK FT PKIKISENNEKSTLPHFKKLFRVYDKNTQKILFDELYVFDENPNQDENLERKELLELVY FT KEKRLLKKSSLNTIQDYTKEQISKLDESFLDLDRFVKFEVKLSPKLQNITEDLLKTRF" FT misc_feature complement(214336..215409) FT /note="HMMPfam hit to PF04095, Nicotinate FT phosphoribosyltransferase (NAPRTa, score 3.6e-11" FT /inference="protein motif:Pfam:PF04095" FT misc_feature complement(214873..214905) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(215417..216439) FT /transl_table=11 FT /gene="nrdB" FT /locus_tag="Cj0231c" FT /product="ribonucleoside-diphosphate reductase beta chain" FT /EC_number="1.17.4.1" FT /note="Original (2000) note: Cj0231c, nrdB, probable FT ribonucleoside-diphosphate reductase beta chain, len: 340 FT aa; similar to many e.g. RIR2_ECOLI FT ribonucleoside-diphosphate reductase 1 beta chain (EC FT 1.17.4.1) (375 aa), fasta scores; opt: 223 z-score: 509.0 FT E(): 4.3e-21, 26.6% identity in 361 aa overlap. 58.2% FT identity to HP0364. Contains Pfam match to entry PF00268 FT ribonuc_red, Ribonucleotide reductases, score FT 126.50,E-value 8e-43" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity score. Putative not FT added to product function. Functional classification FT -2'-deoxyribonucleotide biosynthesis" FT /note="PMID:6087316, PMID:3511029, PMID:9558317" FT /db_xref="GOA:Q0PBS3" FT /db_xref="InterPro:IPR000358" FT /db_xref="InterPro:IPR009078" FT /db_xref="InterPro:IPR012348" FT /db_xref="UniProtKB/TrEMBL:Q0PBS3" FT /inference="protein motif:Pfam:PF00268" FT /protein_id="CAL34386.1" FT /translation="MQRKRIYNPSSNETLGDRKVFDGNPHGILNFTKAKYTWALKLWDL FT MEANTWFPKEVDTTKDALDYRCNLTAGEKRMYDLVWSQLISMDSFQTNNLADNINPYIT FT APEINAVLARQAYEEANHSKSYAVMVEAICDNTDLIYEMEKHDETLREKNDFISSIYEE FT LAGDVDDNKLLLAMVANQILEGVYFYSGFTAIYALARAGKMLGSAQMIRFIQRDEITHL FT LLFQNMINSVRKERPDLFHDENINKIYDMFKKAGDLEIKWGKYITQNQIMGFTDDIIEE FT YIHYLVDQRLSAINLDKLYNAKHPIKWVDDFSKFNDQKSNFFESKVTNYSKGSISFDDF FT " FT misc_feature complement(215504..216388) FT /note="HMMPfam hit to PF00268, Ribonucleotide FT reductase,small chain, score 1.8e-30" FT /inference="protein motif:Pfam:PF00268" FT CDS complement(216453..216863) FT /transl_table=11 FT /locus_tag="Cj0232c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0232c, probable integral FT membrane protein, len: 136 aa; 37.9% identity to HP1258 FT (called conserved hypothetical mitochondrial protein 4). FT Contains three possible transmembrane domains" FT /note="Updated (2006) note: Pfam domain PF06271 RDD family FT was identified within CDS. This family of proteins contain FT three highly conserved amino acids: one arginine and two FT aspartates, hence the name of RDD family. This region FT contains two predicted transmembrane regions. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="InterPro:IPR010432" FT /db_xref="UniProtKB/TrEMBL:Q0PBS2" FT /inference="protein motif:Pfam:PF06271" FT /protein_id="CAL34387.1" FT /translation="MKTKAKISSRWLRFRALLIDIFLIYVPILYLFYFLLGSKEAFLNN FT HFITTLCTFLFGLIQAIFLTKKAQSPGLKAYDLYLIDIKTGKKLSFLRILLRYVIFIIS FT FGLLFGLFVSFVRKDRLNLHDILTQSCIATKA" FT misc_feature complement(216462..216845) FT /note="HMMPfam hit to PF06271, RDD family, score 1e-13" FT /inference="protein motif:Pfam:PF06271" FT misc_feature complement(join(216753..216821,216672..216740, FT 216516..216584)) FT /note="3 probable transmembrane helices predicted for FT Cj0232c by TMHMM2.0 at aa 15-37, 42-64 and 94-116" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(216864..217472) FT /transl_table=11 FT /gene="pyrE" FT /locus_tag="Cj0233c" FT /product="putative orotate phosphoribosyltransferase" FT /EC_number="2.4.2.10" FT /note="Original (2000) note: Cj0233c, pyrE, possible FT orotate phosphoribosyltransferase, len: 202 aa; similar to FT e.g. PYRE_THETH orotate phosphoribosyltransferase (EC FT 2.4.2.10) (183 aa), fasta scores; opt: 369 z-score: 372.7 FT E(): 1.7e-13, 33.9% identity in 192 aa overlap. 58.4% FT identity to HP1257. Contains PS00103 Purine/pyrimidine FT phosphoribosyl transferases signature and Pfam match to FT entry PF00156 Pribosyltran, Purine/pyrimidine FT phosphoribosyl transferases, score -4.80, E-value 0.0013" FT /note="Updated (2006) note: Characterised within Thermus FT thermophilus, however, identity score was marginal. FT Putative kept within product function. Functional FT classification - Pyrimidine ribonucleotide biosynthesis" FT /note="PMID:7635839" FT /db_xref="GOA:Q9PIR1" FT /db_xref="InterPro:IPR000836" FT /db_xref="InterPro:IPR006273" FT /db_xref="InterPro:IPR023031" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIR1" FT /inference="protein motif:Pfam:PF00156" FT /inference="protein motif:Prosite:PS00103" FT /protein_id="CAL34388.1" FT /translation="MNLEQIYKDCGAYLEGHFLLSSGKHSQFYLQSAKVLEDPKLAAKL FT CDELAKIIASYKIEFDSICSPALGGILAGYELARACSKRFIFTERVNKEMTLRRGFEVK FT KGEKFIICEDIITTGGSALESAKIIESLGGIVVGFAALANRGFCAVENLKSPRKDNAKL FT PENLPLFTLGNFEFEIYDETNCPLCKKGNKAIKPGSRGN" FT misc_feature complement(217017..217382) FT /note="HMMPfam hit to PF00156, Phosphoribosyl transferase FT domain, score 2.3e-22" FT /inference="protein motif:Pfam:PF00156" FT misc_feature complement(217110..217148) FT /note="PS00103 Purine/pyrimidine phosphoribosyl FT transferases signature" FT /inference="protein motif:Prosite:PS00103" FT CDS complement(217475..218038) FT /transl_table=11 FT /gene="frr" FT /locus_tag="Cj0234c" FT /product="ribosome recycling factor" FT /note="Original (2000) note: Cj0234c, frr, probable FT ribosome recycling factor, len: 187 aa; highly similar to FT many e.g. RRF_ECOLI ribosome recycling factor (ribosome FT releasing factor) (185 aa), fasta scores; opt: 514 z-score: FT 821.2 E(): 0 40.2% identity in 184 aa overlap. 64.3% FT identity to HP1256" FT /note="Updated (2006) note: Pfam domain PF01765 Ribosome FT recycling factor was identified within CDS. Further support FT given to product functionality. Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification - FT Protein translation and modification" FT /note="PMID:2684966, PMID:8183897" FT /db_xref="GOA:Q9PIR0" FT /db_xref="InterPro:IPR002661" FT /db_xref="InterPro:IPR023584" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIR0" FT /inference="protein motif:Pfam:PF01765" FT /protein_id="CAL34389.1" FT /translation="MIMLNEIFNKQKTQSEKSLEALKKDFTTLRTGKVNIHILDHITVD FT YYGTQTPLNQVATVLASDASTISITPWEKPLLKTIESAIAAANIGVNPNNDGESVKLFF FT PPMTREQREENVKQAKAMGEKAKVSIRNIRKDANDAVKKLEKDKAISEDEAKKAYDEVQ FT KLTDTYTTKIDEGVKSKESELLKV" FT misc_feature complement(217484..217978) FT /note="HMMPfam hit to PF01765, Ribosome recycling FT factor,score 4.9e-88" FT /inference="protein motif:Pfam:PF01765" FT CDS complement(218048..218419) FT /transl_table=11 FT /gene="secG" FT /locus_tag="Cj0235c" FT /product="putative protein-export membrane protein" FT /note="Original (2000) note: Cj0235c, secG, possible FT protein-export membrane protein, len: 123 aa; similar to FT e.g. SECG_PSESY protein-export membrane protein secG (126 FT aa), fasta scores; opt: 157 z-score: 210.5 E(): FT 0.00018,25.2% identity in 119 aa overlap. 48.8% identity to FT HP1255" FT /note="Updated (2006) note: Pfam domain PF03840 Preprotein FT translocase SecG subunit was identified within CDS. FT Also,two probable transmembrane helices predicted by FT TMHMM2.0. Further support given to product function. No FT specific characterisation with acceptable identity scores FT have been carried out yet. Putative kept within product FT function. Functional classification - Protein and peptide FT secretion" FT /db_xref="GOA:Q0PBR9" FT /db_xref="InterPro:IPR004692" FT /db_xref="UniProtKB/TrEMBL:Q0PBR9" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03840" FT /protein_id="CAL34390.1" FT /translation="MITLLIILQFIIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKG FT PAGFLAKFTFVMGILLIANTIGLGYLYNKASKDSLAEKIKVENNNTTIPSAPIVPTTPN FT TNSIAPSAPQLPSDVNSSK" FT misc_feature complement(218201..218416) FT /note="HMMPfam hit to PF03840, Preprotein translocase SecG FT subunit, score 2.8e-24" FT /inference="protein motif:Pfam:PF03840" FT misc_feature complement(join(218354..218407,218207..218275)) FT /note="2 probable transmembrane helices predicted for FT Cj0235c by TMHMM2.0 at aa 5-22 and 49-71" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(218339..218419) FT /note="Signal peptide predicted for secG by SignalP 2.0 HMM FT (Signal peptide probability 0.840) with cleavage site FT probability 0.433 between residues 27 and 28" FT CDS complement(218523..219218) FT /transl_table=11 FT /locus_tag="Cj0236c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0236c, probable integral FT membrane protein, len: 231 aa similar to members of the FT UPF0005 family e.g. YCCA_PSEAE (222 aa), fasta scores; opt: FT 377 z-score: 628.9 E(): 8.9e-28, 37.7% identity in 207 aa FT overlap. 49.1% identity to HP0920. Contains Pfam match to FT entry PF01027 UPF0005, Uncharacterized protein family, FT score 128.30, E-value 1.4e-34" FT /note="Updated (2006) note: Six probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="GOA:Q9PIQ8" FT /db_xref="InterPro:IPR006214" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIQ8" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01027" FT /protein_id="CAL34391.1" FT /translation="MSLYDRDYSRSKEFENTRSSELSIFIKQTYQLFAASLLAATVGAY FT VGIFALASFFIQSQVTFWILFAVEIGLLFALQWKKREAPLNLVLLFGFTFCSGLTLTPL FT LISVLALPAGGIIIAQAFALTTVAFAGLSVFAMNTKKDFTVMGKALFIVLIVIVAASLL FT NLFFQSSIVNLAISAVAAILFSFYILYDTQNIIRGNYETPIEGAVALYLDFVNLFVSLL FT NILRSFNSR" FT misc_feature complement(218532..219167) FT /note="HMMPfam hit to PF01027, Uncharacterised protein FT family UPF0005, score 2.5e-36" FT /inference="protein motif:Pfam:PF01027" FT misc_feature complement(join(219057..219125,218991..219044, FT 218886..218954,218805..218873,218718..218786, FT 218649..218708)) FT /note="6 probable transmembrane helices predicted for FT Cj0236c by TMHMM2.0 at aa 32-54, 59-76, 89-111, FT 116-138,145-167 and 171-190" FT /inference="protein motif:TMHMM:2.0" FT CDS 219378..220013 FT /transl_table=11 FT /gene="cynT" FT /locus_tag="Cj0237" FT /product="carbonic anyhydrase" FT /EC_number="4.2.1.1" FT /note="Original (2000) note: Cj0237, cynT, probable FT carbonic anyhydrase, len: 211 aa; similar to e.g. FT CYNT_ECOLI carbonic anhydrase (EC 4.2.1.1) (219 aa), fasta FT scores; opt: 541 z-score: 776.7 E(): 0, 41.2% identity in FT 204 aa overlap. 43.5% identity to HP0004. Contains PS00704 FT and PS00705 Prokaryotic-type carbonic anhydrases signatures FT 1 and 2, and Pfam match to entry PF00484 Pro_CA, FT Prokaryotic-type carbonic anhydrases, score 208.10, E-value FT 2.7e-59" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Central intermediary metabolism - General" FT /note="PMID:1740425, PMID:14563877" FT /db_xref="GOA:Q0PBR7" FT /db_xref="InterPro:IPR001765" FT /db_xref="InterPro:IPR015892" FT /db_xref="UniProtKB/TrEMBL:Q0PBR7" FT /inference="protein motif:Pfam:PF00484" FT /inference="protein motif:Prosite:PS00705" FT /inference="protein motif:Prosite:PS00704" FT /protein_id="CAL34392.1" FT /translation="MENLISGAIKFMQEDFKEHEELFESLKNKQNPHTLFIGCSDSRVI FT PNLITNTGPGELFVIRNIANIVPPYRVGEDYLATTSAIEYALNSLHIKNIVVCGHSNCG FT GCNALYYSDEELNKIPNVKKWLTMLDPIKKDVMIFARDDLAMRSWLTEKLNLVNSLQNI FT LTYPGVQEALDEGKIEVHAWYYIIETGEIYEYDFKAKIFTLIQDRKVQ" FT misc_feature 219456..219965 FT /note="HMMPfam hit to PF00484, Carbonic anhydrase, score FT 1.9e-45" FT /inference="protein motif:Pfam:PF00484" FT misc_feature 219492..219515 FT /note="PS00704 Prokaryotic-type carbonic anhydrases FT signature 1" FT /inference="protein motif:Prosite:PS00704" FT misc_feature 219627..219689 FT /note="PS00705 Prokaryotic-type carbonic anhydrases FT signature 2" FT /inference="protein motif:Prosite:PS00705" FT CDS 220010..221893 FT /transl_table=11 FT /locus_tag="Cj0238" FT /product="putative mechanosensitive ion channel family FT protein" FT /note="Original (2000) note: Cj0238, probable integral FT membrane protein, len: 627 aa; similar in C-terminus to FT many hypothetical proteins, e.g. YB43_METJA MJ1143 (361 FT aa), fasta scores; opt: 413 z-score: 535.7 E(): FT 1.4e-22,23.9% identity in 372 aa overlap. 36.3% identity in FT 608 aa overlap to HP0415. Contains Pfam match to entry FT PF00924 UPF0003, Uncharacterized protein family UPF0003, FT score 145.90, E-value 6.9e-40" FT /note="Updated (2006) note: Pfam domain PF00924 FT Mechanosensitive ion channel was identified within CDS. FT Product modified to more specific family member due to FT motif match. Paper identified linking protein to FT glycoprotein. No specific characterisation has been carried FT out yet, so putative kept within product function. FT Functional classification - Transport/binding proteins FT -Other" FT /db_xref="GOA:Q0PBR6" FT /db_xref="InterPro:IPR006685" FT /db_xref="InterPro:IPR010920" FT /db_xref="InterPro:IPR011014" FT /db_xref="InterPro:IPR011066" FT /db_xref="UniProtKB/TrEMBL:Q0PBR6" FT /inference="protein motif:Pfam:PF00924" FT /protein_id="CAL34393.1" FT /translation="MKKIIFSLCFFILHLGAQEFKFIDANISKEDEGIYALVEKYVDLN FT NQIKEFKKNNDENSSTFNGILSEFEKDKKTILAKIPDMIVGQKINEEAVARFLKAKEKL FT LDVQKKNINKPYIYTDATLNLVYFNIVESFYSSLFEVEKLFKNTASSEDLIATVDKAME FT NLQNSSNVNLDSFKSKITNPEELEKITLKERYISNAVDSYSEILKYLRSNADLLESNYI FT FSLLELQVWIDRINEAIGVSFVNIGKIVISALVLVFFISLRRFFANIVYFFLVQLFYRN FT KNDVDDIKVIFIENIKKPVGFLLIVYAISLCLTIATYPAPLSVNLSNFFHIVYAVLIAW FT LILRMLDGYGVVLVSKLAQKSGKKEVVNLIIKILYFVIIIIALLYILAQLGFNISAIIA FT SLGIGGLAVALAAKDIIANFFASILLLFDNSFNQGDWVEVSGIEGTVVETGLRKTTIRT FT FDNCLVFLPNSTIMGANIKNWSKRRMGRHVRMYLGVGYDATPEKLEQCVKDLREFLHTS FT DLVAHDEDSALKYGDHTTKYRQNLVSINDLEGYKNACYVALSEFADSSINIELYFYIKE FT IGGKDFREARQSLMLEFMRIIEKNGLTFAFPSRSIYIENLPPLDLQAKAIK" FT misc_feature order(220721..220789,220802..220846,220907..220975, FT 221003..221071,221105..221173,221183..221242) FT /note="6 probable transmembrane helices predicted for FT Cj0238 by TMHMM2.0 at aa 238-260, 265-279, 300-322,332-354, FT 366-388 and 392-411" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 221123..221824 FT /note="HMMPfam hit to PF00924, Mechanosensitive ion FT channel, score 2e-68" FT /inference="protein motif:Pfam:PF00924" FT CDS complement(221916..222887) FT /transl_table=11 FT /locus_tag="Cj0239c" FT /product="NifU protein homolog" FT /note="Original (2000) note: Cj0239c, nifU protein homolog, FT len: 323 aa; similar to many e.g. NIFU_AZOVI nifU protein FT (312 aa), fasta scores; opt: 627 z-score: 910.4 E(): 0, FT 37.0% identity in 330 aa overlap. 68.8% identity to HP0221. FT Also similar in C-terminus to Cj1639 (38.2% identity in 76 FT aa overlap). Contains Pfam match to entry PF01106 FT NifU-like, NifU-like domain, score 100.40, E-value 3.5e-26" FT /note="Updated (2006) note: Pfam domains PF01592 NifU-like FT N terminal domain and PF04324 which is a BFD-like [2Fe-2S] FT binding domain identified within CDS. Further support given FT to product function. Functional classification -Conserved FT hypothetical proteins" FT /note="PMID:7947754, PMID:10819462" FT /db_xref="GOA:Q0PBR5" FT /db_xref="InterPro:IPR001075" FT /db_xref="InterPro:IPR002871" FT /db_xref="InterPro:IPR007419" FT /db_xref="InterPro:IPR016217" FT /db_xref="UniProtKB/TrEMBL:Q0PBR5" FT /inference="protein motif:Pfam:PF04324" FT /inference="protein motif:Pfam:PF01592" FT /inference="protein motif:Pfam:PF01106" FT /protein_id="CAL34394.1" FT /translation="MGKNSLIGGSIWDEYSQKVQDRMNNPQHMGEFSEEDAKARNAKLI FT VADFGAESCGDAVRLFWLVDEKTDKIIDAKFKSFGCGTAIASSDTMVDLCIGKTVDEAV FT KITNLDVEFAMRDNPETPAVPPQKMHCSVMAYDVIKQAAAHYKGISPEDFEDQIIVCEC FT ARVSLGTIKEVIKLNDLHSVEEITQYTKAGAFCKSCIKPGGHEKRDYYLVDILAETRAE FT IDREKLKNTMKSDVAFDEMTVVGQLKAVESVLDAEIRPMLHNDGGDLEVIDIQKAEGAA FT IDVYIRYLGACSGCSSGSGATLYAIETILQEELSPNIRVMPV" FT misc_feature complement(221919..222140) FT /note="HMMPfam hit to PF01106, NifU-like domain, score FT 2.1e-27" FT /inference="protein motif:Pfam:PF01106" FT misc_feature complement(222255..222416) FT /note="HMMPfam hit to PF04324, BFD-like [2Fe-2S] binding FT domain, score 5.7e-15" FT /inference="protein motif:Pfam:PF04324" FT misc_feature complement(222429..222848) FT /note="HMMPfam hit to PF01592, NifU-like N terminal domain, FT score 2.9e-64" FT /inference="protein motif:Pfam:PF01592" FT CDS complement(222897..224078) FT /transl_table=11 FT /gene="iscS" FT /locus_tag="Cj0240c" FT /product="cysteine desulfurase (NifS protein homolog)" FT /EC_number="2.8.1.7" FT /note="Original (2000) note: Cj0240c, probable FT aminotransferase (nifS protein homolog), len: 393 aa; FT similar to many e.g. NIFS_KLEPN nifS protein (397 aa),fasta FT scores; opt: 1067 z-score: 1533.6 E(): 0, 47.0% identity in FT 383 aa overlap. 62.8% identity to HP0220. Contains PS00132 FT Zinc carboxypeptidases, zinc-binding region 1 signature, FT PS00595 Aminotransferases class-V pyridoxal-phosphate FT attachment site, and Pfam match to entry PF00266 FT aminotran_5, Aminotransferases class-V,score 358.80, FT E-value 5.9e-104" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Product FT modified to more specific family member based on FT characterisation papers. Putative not added to product FT function. Functional classification - Misc" FT /note="PMID:10908675, PMID:10781607, FT PMID:12860127,PMID:3040672, PMID:8464885" FT /db_xref="GOA:Q0PBR4" FT /db_xref="InterPro:IPR000192" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="InterPro:IPR016454" FT /db_xref="InterPro:IPR017773" FT /db_xref="InterPro:IPR020578" FT /db_xref="UniProtKB/TrEMBL:Q0PBR4" FT /inference="protein motif:Pfam:PF00266" FT /inference="protein motif:Prosite:PS00595" FT /inference="protein motif:Prosite:PS00132" FT /protein_id="CAL34395.1" FT /translation="MKVYLDNNATTMLDPNAYELMLPFLKDMYGNPNSLHQYGSATHPA FT LREALDKLYAGLGANDLDDIVVTSCATESINWVLKGVYFDHILDKERNEVIISSVEHPA FT VTAAAYFLKSLGVKVIELPVNEEGVSTVEDLRKVISDKTALVSVMWANNETGMIFDIKA FT MAELAHEFGALFHTDATQAVGKIKVNLTQVGVDFASFSAHKFHGPKGVGGLFIKKGLKL FT TPLLHGGEHMGGRRSGTLNVPYIVAMGEALRIANTMLDFEDSHIRRLRDKLEDQILALP FT DTTVVGKREHRVPNTILASIKGVEGEAMLWDLNKNGIAASTGSACASEALESNPIMEAI FT GAEHDLAHTALRLSLSRFNTEEEIDYAAKQIKNATQRLRAISCTYAYNPNNYK" FT misc_feature complement(222978..224042) FT /note="HMMPfam hit to PF00266, Aminotransferase FT class-V,score 3.2e-105" FT /inference="protein motif:Pfam:PF00266" FT misc_feature complement(223101..223133) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature complement(223359..223427) FT /note="PS00132 Zinc carboxypeptidases, zinc-binding region FT 1 signature" FT /inference="protein motif:Prosite:PS00132" FT misc_feature complement(223437..223496) FT /note="PS00595 Aminotransferases class-V FT pyridoxal-phosphate attachment site" FT /inference="protein motif:Prosite:PS00595" FT CDS complement(224256..224657) FT /transl_table=11 FT /locus_tag="Cj0241c" FT /product="putative iron-binding protein" FT /note="Original (2000) note: Cj0241c, possible iron-binding FT protein, len: 133 aa; Weak similarity to members of the FT eukaryotic iron-binding hemerythrin family,e.g. HEMT_LINUN FT hemerythrin alpha chain (117 aa), fasta scores; opt: 93 FT z-score: 135.4 E(): 3.1, 27.3% identity in 77 aa overlap. FT Note that all of the iron-binding residues are conserved. FT No Hp match. Also similar to Cj1224 (34.7% identity in 118 FT aa overlap), Cj0072c (40.5% identity in 79 aa overlap) and FT Cj0045c (30.9% identity in 123 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF01814 Hemerythrin FT HHE cation binding domain identified within CDS. No FT specific characterisation with acceptable identity score FT has been carried out yet. Thus, putative kept within FT product function. Functional classification FT -Transport/binding proteins - Cations" FT /db_xref="GOA:Q9PIQ3" FT /db_xref="InterPro:IPR012827" FT /db_xref="InterPro:IPR016131" FT /db_xref="InterPro:IPR023504" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIQ3" FT /inference="protein motif:Pfam:PF01814" FT /protein_id="CAL34396.1" FT /translation="MTYNEKIISMNNDLLDHQHKELFEISKKLSLMNQRHVGTKELKIV FT LRELLIMINRHFSDEEAFMREIEYPYINHHTRIHRKIILEIEEIIISEAKFVNIMTEKL FT NLVVQDFIFKHTAKEDSKIVKYYEEKFKK" FT misc_feature complement(224280..224447) FT /note="HMMPfam hit to PF01814, Hemerythrin HHE cation FT binding domain, score 0.0029" FT /inference="protein motif:Pfam:PF01814" FT misc_feature complement(224457..224627) FT /note="HMMPfam hit to PF01814, Hemerythrin HHE cation FT binding domain, score 0.0079" FT /inference="protein motif:Pfam:PF01814" FT CDS complement(224794..225960) FT /transl_table=11 FT /locus_tag="Cj0243c" FT /product="hypothetical protein Cj0243c" FT /note="Original (2000) note: Cj0243c, unknown, len: 388 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBR2" FT /protein_id="CAL34397.1" FT /translation="MTINSANPYQNLTLSNPLQNSSALNLIKDSKALDQEGNENSLEQL FT SYIFNNTTYASEFGFRINEEGFFDKDLNKIANIPESYDINIKSVRSIAKELAKQDENLN FT YNKIDLPYLLNSYHSSLKSINSEFLQDDNAYLSRDLISKLSSGFSTDNGEFLGQISRIY FT NNQEEIDLALSNITNLNTLMLDNKITNFHFDKAIENTSSNEILKPYLTKNAEVSKSGLL FT MNFIYHDIKTQNEKEFNFFMKPATLELSSHQNLQKILKGETDIEDYIKKENEKKMSFDL FT YLYINGVDKKTSTQDKLSVFFQQYINYQKDMDLREFANSSSIFQIYIDQNRNDFDALKK FT QYQNQSQDTQRLEEANQLRSSSIENFLDRRQKQANINKILNSYMSVMV" FT CDS 226116..226307 FT /transl_table=11 FT /gene="rpmI" FT /locus_tag="Cj0244" FT /product="50s ribosomal protein L35" FT /note="Original (2000) note: Cj0244, rpmI, 50s ribosomal FT protein L35, len: 63 aa; similar to many e.g. RL35_ECOLI FT 50s ribosomal protein L35 (64 aa), fasta scores; opt: 133 FT z-score: 282.3 E(): 1.8e-08. 45.6% identity in 57 aa FT overlap. 60.7% identity to HP0125" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:16272117" FT /db_xref="GOA:Q9PIQ1" FT /db_xref="InterPro:IPR001706" FT /db_xref="InterPro:IPR018265" FT /db_xref="InterPro:IPR021137" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIQ1" FT /protein_id="CAL34398.1" FT /translation="MPKMKSVKSAVKRFKVGKNKIKRGSAFRSHILTKKPAKRMRGLRT FT AKYVHSTNVKAVEKMLGI" FT misc_feature 226125..226298 FT /note="HMMPfam hit to PF01632, Ribosomal protein L35,score FT 4.9e-18" FT /inference="protein motif:Pfam:PF01632" FT CDS 226401..226754 FT /transl_table=11 FT /gene="rplT" FT /locus_tag="Cj0245" FT /product="50S ribosomal protein L20" FT /note="Original (2000) note: Cj0245, rplT, 50S ribosomal FT protein L20, len: 117 aa; similar to many e.g. RL20_ECOLI FT 50S ribosomal protein L20 (117 aa), fasta scores; opt: 447 FT z-score: 836.3 E(): 0, 58.6% identity in 116 aa overlap; FT 74.8% identity to HP0126. Contains PS00937 Ribosomal FT protein L20 signature and Pfam match to entry PF00453 FT L20,Ribosomal protein L20, score 178.20, E-value 1.3e-55" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:381019" FT /db_xref="GOA:Q9PIQ0" FT /db_xref="InterPro:IPR005813" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIQ0" FT /inference="protein motif:Pfam:PF00453" FT /inference="protein motif:Prosite:PS00937" FT /protein_id="CAL34399.1" FT /translation="MARVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSLVY FT AYRDRRRKKRDFRRLWIVRINAACRLNDLSYSRFINGLKKAGIELDRKILADLAMNDAA FT AFAKIAEAAKKAL" FT misc_feature 226404..226727 FT /note="HMMPfam hit to PF00453, Ribosomal protein L20,score FT 4.5e-51" FT /inference="protein motif:Pfam:PF00453" FT misc_feature 226560..226610 FT /note="PS00937 Ribosomal protein L20 signature" FT /inference="protein motif:Prosite:PS00937" FT CDS complement(226807..227934) FT /transl_table=11 FT /locus_tag="Cj0246c" FT /product="putative MCP-domain signal transduction protein" FT /note="Original (2000) note: Cj0246c, probable MCP-domain FT signal transduction protein, len: 375 aa; similar in FT C-terminus to many MCP-domain containing proteins e.g. FT MCPA_BACSU methyl-accepting chemotaxis protein mcpA (661 FT aa), fasta scores; opt: 257 z-score: 408.0 E(): FT 1.8e-15,33.2% identity in 205 aa overlap. No Hp ortholog. FT Contains Pfam match to entry PF00015 MCPsignal, FT Methyl-accepting chemotaxis protein (MCP) signaling domain, FT score 93.20,E-value 3.9e-25" FT /note="Updated (2006) note: Characterisation within FT Bacillus subtilis, however, identity score was marginal. FT Putative kept within product function. Functional FT classification - Signal transduction" FT /note="PMID:8188684" FT /db_xref="GOA:Q0PBQ9" FT /db_xref="InterPro:IPR004089" FT /db_xref="InterPro:IPR004090" FT /db_xref="InterPro:IPR019494" FT /db_xref="UniProtKB/TrEMBL:Q0PBQ9" FT /inference="protein motif:Pfam:PF00015" FT /protein_id="CAL34400.1" FT /translation="MQEYTFALKIGEDYLISPMEINPNKTLFSYCDIESAQELSLLKKT FT NFIEAIKKDYEKFSLNKPKPLGAIFNDCILRRLHNKEHLNQIHFNDFPIVGFSSFGEIY FT GVGIAKSLVAIFFYEVENFNDFKPRYLKTFIQKYSDFKYYYLNIRAQKLEMTNEINKII FT LNQLKQNTSEIDKNTSIFKEIFEELENIRRSLTTISESFTNFTNYLEYNLYQSEEKMNL FT EKEVQSSLKNIDQLNSILDLISGIAEQTILLSLNAGIEAARAGKLGRGFAVVADEVRKL FT SENTQMGLGEMEGAIKLVIQTIQSIAKSSNSSTQEMNFIRDKTNEFSKIISNLINSGKE FT ISDKLEQRSNVSEDFEKNVNQLKCYEDVLAKLNQY" FT misc_feature complement(226813..227370) FT /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis FT protein (MCP) s, score 4.2e-09" FT /inference="protein motif:Pfam:PF00015" FT CDS complement(227910..228443) FT /transl_table=11 FT /locus_tag="Cj0247c" FT /product="hypothetical protein Cj0247c" FT /note="Original (2000) note: Cj0247c, unknown, len: 177 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to proteins from other FT bacteria. Functional classification - Unknown" FT /db_xref="InterPro:IPR013702" FT /db_xref="UniProtKB/TrEMBL:Q0PBQ8" FT /protein_id="CAL34401.1" FT /translation="MIENLCTNKIKLFSDIKDYTERKKLIEKEVLFINIPFEAHCINTL FT YYLIYDGLSQSESSLLELLYKHNPYPCALVGGGSSGNMDFSGAFIFYNGEILKNQALSI FT HVQFKPKYRFNLMKSQNFNPQSNITFTILDVSLYDKTVRELINKKPFRLKLYVIILTAL FT LKNLKIKCKNILLL" FT CDS 228946..229803 FT /transl_table=11 FT /locus_tag="Cj0248" FT /product="hypothetical protein Cj0248" FT /note="Original (2000) note: Cj0248, unknown, len: 285 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to proteins from other FT bacteria. Literature search identified papers giving FT structural characterisation and clues to product function. FT Currently unknown function but may be some kind of FT hydrolase or signal-transduction protein. Cj0248 has been FT implicated as a virulence factor and has been shown to play FT a role in motility. Functional classification -Unknown" FT /note="PMID:16287129, PMID:15066034, PMID:11298288" FT /db_xref="InterPro:IPR013976" FT /db_xref="PDB:1VQR" FT /db_xref="UniProtKB/TrEMBL:Q0PBQ7" FT /protein_id="CAL34402.1" FT /translation="MIGDMNELLLKSVEVLPPLPDTVSKLRKYVSEANSNIETMKVAEI FT ISSDPLMTAKLLQLANSPYYGFTREITTINQVITLLGVGNIINIVMADSIRDNFKIDVS FT PYGLNTQNFLKTCNEEATFIANWLNDEDKKLSHLLVPCAMLLRLGIVIFSNFLIQNHKD FT KDFLAFLNKNENLALAENEFLGVDHISFLGFLLHRWNFDDVLIESICFVRTPHAAREKV FT KKSAYALAITDHLFAPHDGSSPFNAKAAVALLKEAKTQGINFDLNNLLSKLPNKAKENL FT NKED" FT CDS 229831..230310 FT /transl_table=11 FT /locus_tag="Cj0249" FT /product="hypothetical protein Cj0249" FT /note="Original (2000) note: Cj0249, unknown, len: 159 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBQ6" FT /protein_id="CAL34403.1" FT /translation="MMKSLILPPNEFLDHYILNAEFHRFAGISKNAYKFWKNAEIGRYQ FT GTRIIFLHRNCILEKHQQALRQCSGLNGFVLASAFCSFTGLAPSHLVEKNNSSIYKLLE FT LKEICGIKFVNLKKFYDFLGLNYHQHIYIEKCHFFSPAPFEKRIKITESMCVGYY" FT CDS complement(230279..231589) FT /transl_table=11 FT /locus_tag="Cj0250c" FT /product="putative MFS (Major Facilitator Superfamily) FT transport protein" FT /note="Original (2000) note: Cj0250c, probable FT transmembrane transport protein, len: 436 aa; similar to FT many members of the sugar transport protein family, e.g. FT PROP_ECOLI proline/betaine transporter (500 aa), fasta FT scores; opt: 602 z-score: 791.3 E(): 0, 31.7% identity in FT 394 aa overlapCIT1_SALTY citrate-proton symport (citrate FT transporter) (434 aa), fasta scores; opt: 580 z-score: FT 734.9 E(): 0, 28.0% identity in 396 aa overlap. 50.9% FT identity to HP0936. Contains Pfam match to entry PF00083 FT sugar_tr, Sugar (and other) transporters, score FT 93.10,E-value 5.5e-24" FT /note="Updated (2006) note: Pfam domain PF07690 Major FT Facilitator Superfamily was identified within CDS in FT addition to previous PF0083. Prosite domain PS50850 FT MFS,Major facilitator superfamily was also identified. FT Also,twelve probable transmembrane helices predicted by FT TMHMM2.0. Product modified to more specific family member FT due to motif match. Putative kept within product function. FT Functional classification - Transport/binding proteins FT -Other" FT /db_xref="GOA:Q0PBQ5" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR016196" FT /db_xref="InterPro:IPR020846" FT /db_xref="UniProtKB/TrEMBL:Q0PBQ5" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF07690" FT /inference="protein motif:Pfam:PF00083" FT /inference="protein motif:Prosite:PS50850" FT /protein_id="CAL34404.1" FT /translation="MSKTLNQKDIKVLGLSSLGGTLEFYDFIIFVFFANYISTNFFPKD FT LSSFWQMFNTYGIFAAGYLARPLGGVILAHFGDKFGRKRMFMISILLMVIPTFTLAFIP FT NYESIGFLCIVLLVFIRICQGIAIGGELPGAWVFVYEHAPQGQKRTYLGILTASVVGGI FT LLGSLVFLIMNKIYTQEELHEWAWRIPFFLGGIFGIISAYLRKFLRETPVFEQMKKDKA FT LEKFPLKEVFKKAKMGIVLSMMITWVLTGCIVVMILLMPSYMAKILQINTSIQTYLQIG FT GILLICLGCIISGILADKIGVIKSCVFFSVFFGIASLLYFNTLYRQNADFNLVACLYLL FT VCFFSGVMNFCPLIMSEVFDAKIKFSGLSFSYNIAYAIAGGLTPQLAFFLHSFALNNLS FT NFWRFSLGLYVFFLAIIALLCAFIFSYLNNTQRTYSQ" FT misc_feature complement(230288..231556) FT /note="HMMPfam hit to PF00083, Sugar (and other) FT transporter, score 4.5e-24" FT /inference="protein motif:Pfam:PF00083" FT misc_feature complement(join(231485..231553,231359..231427, FT 231281..231340,231200..231268,231071..231139, FT 230966..231034,230810..230878,230699..230767, FT 230618..230686,230522..230590,230420..230488, FT 230309..230377)) FT /note="12 probable transmembrane helices predicted for FT Cj0250c by TMHMM2.0 at aa 13-35, 55-77, 84-103, FT 108-130,151-173, 186-208, 238-260, 275-297, 302-324, FT 334-356,368-390 and 405-427" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(230426..231508) FT /note="HMMPfam hit to PF07690, Major Facilitator FT Superfamily, score 3.4e-20" FT /inference="protein motif:Pfam:PF07690" FT misc_feature complement(230834..230866) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(231592..231747) FT /transl_table=11 FT /locus_tag="Cj0251c" FT /product="highly acidic protein" FT /note="Original (2000) note: Cj0251c, highly acidic FT protein, len: 51 aa; 47.9% identity to HP0756. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PBQ4" FT /protein_id="CAL34405.1" FT /translation="MAYEDEEDLNYDDYENEDEEYPQNHHKNYNYDDDDYEYDDDNNDD FT DFYEMD" FT CDS 231840..232313 FT /transl_table=11 FT /gene="moaC" FT /locus_tag="Cj0252" FT /product="molybdenum cofactor biosynthesis protein C" FT /note="Original (2000) note: Cj0252, moaC, probable FT molybdenum cofactor biosynthesis protein C, len: 157 aa; FT simlar to many e.g. MOAC_ECOLI molybdenum cofactor FT biosynthesis protein C. (160 aa), fasta scores; opt: 401 FT z-score: 741.9 E(): 0, 43.8% identity in 153 aa overlap. FT 64.3% identity to HP0798" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Biosynthesis of cofactors, prosthetic groups and carriers FT - Molybdopterin" FT /note="PMID:10903949, PMID:8361352" FT /db_xref="GOA:Q9PIP3" FT /db_xref="InterPro:IPR002820" FT /db_xref="InterPro:IPR023045" FT /db_xref="InterPro:IPR023046" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIP3" FT /protein_id="CAL34406.1" FT /translation="MKLSHLDEKNHPKMVDVSDKNITLRIATASGIIYMSQEAFDVIKN FT NTAKKGPVLQTAIVAAIMGVKKTSEIIPMCHPLMLSKVETNIVEFVKECAFKLIVTVKC FT EGKTGVEMEALSGVSIGLLTIYDMIKAIDKSMRITDIVLESKEGGKSGKFVRS" FT misc_feature 231879..232286 FT /note="HMMPfam hit to PF01967, MoaC family, score 6.3e-78" FT /inference="protein motif:Pfam:PF01967" FT CDS 232291..232554 FT /transl_table=11 FT /locus_tag="Cj0253" FT /product="hypothetical protein Cj0253" FT /note="Original (2000) note: Cj0253, unknown, len: 87 aa; FT 33.8% identity to HP0495. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="InterPro:IPR007454" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIP2" FT /protein_id="CAL34407.1" FT /translation="MVNLCDLKKEPQINYPTFWDYKVIFEVHVKASEIFEEILGQREYK FT FKHSNSSASGKYQSYLLNVYVDSKKDRLDIFDKLKAKAKFVL" FT CDS 232544..233704 FT /transl_table=11 FT /locus_tag="Cj0254" FT /product="hypothetical protein Cj0254" FT /note="Original (2000) note: Cj0254, unknown, len: 386 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBQ1" FT /protein_id="CAL34408.1" FT /translation="MYFKKEGKMKNTLIIFENSLSNLGKDEASDLLEDLSFNLAYKQIS FT HNPHETKKVLNSLLVEFLTILKKLDFFDDENVTKVIKALVKASIVDAQNSLYEYISEAE FT LLNKQIENQKNLIKNQISDNFFEFENILQECSFCDEFSGGLNDAILFDIEMLGILKETA FT ESAFLTTLEKAEDIELTSSEIAKNLVYNAICEAHFEKERILKISSIILNTAFEIANESM FT AYAKDLCLGVIKGTRDGIVLAMEKFKASLTYANFEEDVSLKSKELIGIEDDFIALLKKE FT IQLQNDPCKSIVENLLEHELDNLFAKFRRLAGESREQLILVLNDIKKNPKINDFNKLTQ FT RKLNRFKQEIFELEKIASEKYKDLNSKKAKKLGVRLWEKAKKFVKK" FT CDS complement(233723..234481) FT /transl_table=11 FT /gene="exoA" FT /locus_tag="Cj0255c" FT /product="exodeoxyribonuclease" FT /EC_number="3.1.11.2" FT /note="Original (2000) note: Cj0255c, probable FT exodeoxyribonuclease, len: 252 aa; similar to many e.g. FT EXOA_BACSU exodeoxyribonuclease (EC 3.1.11.2)(252 aa),fasta FT scores; opt: 676 z-score: 868.1 E(): 0, 40.5% identity in FT 259 aa overlap. 41.1% identity to HP1526. Contains Pfam FT match to entry PF01260 AP_endonulease1, AP endonucleases FT family 1, score 282.10, E-value 7.3e-81" FT /note="Updated (2006) note: Pfam domain FT PF03372,Endonuclease/Exonuclease/phosphatase family FT identified within CDS. Further support given to product FT function. Characterised within Bacillus subtilis with FT acceptable identity score. Putative not added to product FT function. Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:10540738" FT /db_xref="GOA:Q0PBQ0" FT /db_xref="InterPro:IPR000097" FT /db_xref="InterPro:IPR004808" FT /db_xref="InterPro:IPR005135" FT /db_xref="UniProtKB/TrEMBL:Q0PBQ0" FT /inference="protein motif:Pfam:PF03372" FT /inference="protein motif:Pfam:PF01260" FT /protein_id="CAL34409.1" FT /translation="MKLLSWNVNGLRAICDKNALDWIAQEQIDFIGFQEIKAHEDKFPK FT KIYEYPFKHMYFNSAKRAGYSGVMSLCNFNSEVKKCEFFDDEEGRVLEHRFKNIALFNI FT YFPNGQKDEERLNFKMQFYADFLVYLDKLLKDGFEIIICGDVNTAHKEIDLTHPKANAN FT TSGFLPIERAWIDDLLKLGFIDTFREINGEIKEKYSWWSYRMKARERNVGWRIDYFFIS FT KGLKDKLKNAFIRDDIFGSDHAPVGIEIDI" FT misc_feature complement(233732..234481) FT /note="HMMPfam hit to FT PF03372,Endonuclease/Exonuclease/phosphatase fa, score FT 5.2e-47" FT /inference="protein motif:Pfam:PF03372" FT CDS 234599..236137 FT /transl_table=11 FT /locus_tag="Cj0256" FT /product="putative sulfatase family protein" FT /note="Original (2000) note: Cj0256, probable integral FT membrane protein, len: 512 aa; similar to hypothetical FT proteins e.g. YJDB_ECOLI (547 aa), fasta scores; opt: 646 FT z-score: 1169.8 E(): 0, 38.9% identity in 530 aa overlap. FT 34.1% identity to HP0022" FT /note="Updated (2006) note: Pfam domain PF00884 Sulfatase FT identified within CDS. Also, five probable transmembrane FT helices predicted by TMHMM2.0. Product modified to more FT specific family member based on motif match. No specific FT characterisation has been carried out yet, so putative kept FT within product function. Literature search identified paper FT giving further clues to product function. Functional FT classification - Misc" FT /note="PMID:11895937" FT /db_xref="GOA:Q0PBP9" FT /db_xref="InterPro:IPR000917" FT /db_xref="InterPro:IPR012549" FT /db_xref="InterPro:IPR017849" FT /db_xref="InterPro:IPR017850" FT /db_xref="UniProtKB/TrEMBL:Q0PBP9" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00884" FT /protein_id="CAL34410.1" FT /translation="MLRLTWFQFTFFNSLMIVLLNFNLFYFVYEKNTQNWLITFVFIVA FT YFALVHVICSLLFIKFFTKFFSILFIISSFLSVYFISFYGVLIDSDMMQNVVQTDIKEV FT KDLLNLKLILFVVLALLLVFYVVKVKIDYYGSFKSHIKIKIINIISGLIVVCAVLIPLS FT KTFLPFFRNYNEIRMYNTPFYQIYAVYRYYVRFVKAKPEFKTIANDAYRENNHTKKLLV FT LVVGETARAANYSLGGYTKNDTNFYTKKDNVVFFDNFSSCGTATAVSLPCMFSISKREN FT YSSSEFQENAMDVLYKTGVDAVWFDNNSGGCKGVCDRLAYKQKLSSDLDENLLAPFKEK FT LNHLSDQNIIVLHLQGSHGPTYYKRYPSEFKKFTPTCDTNELSKCDSEALINTYDNTLL FT YTDYLLSEIIKLLKEQKSYESSLFYLSDHGESLGENGIYLHGMPYAIAPSYQTHIPAIF FT WSNDKNLMNLAKEYKGLKLSQDNLFSTLLGYFDVKTSVYEPEYDLLNPKLKANP" FT misc_feature order(234611..234679,234707..234775,234794..234862, FT 234920..234979,235040..235108) FT /note="5 probable transmembrane helices predicted for FT Cj0256 by TMHMM2.0 at aa 5-27, 37-59, 66-88, 108-127 and FT 148-170" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 235247..236128 FT /note="HMMPfam hit to PF00884, Sulfatase, score 1.3e-98" FT /inference="protein motif:Pfam:PF00884" FT CDS 236134..236490 FT /transl_table=11 FT /gene="dgkA" FT /locus_tag="Cj0257" FT /product="diacylglycerol kinase" FT /EC_number="2.7.1.107" FT /note="Original (2000) note: Cj0257, dgkA, probale FT diacylglycerol kinase, len: 118 aa; similar to many e.g. FT KDGL_ECOLI diacylglycerol kinase (EC 2.7.1.107) (121 FT aa),fasta scores; opt: 263 z-score: 425.4 E(): 1.9e-16, FT 41.7% identity in 108 aa overlap. 38.7% identity to HP0700. FT Contains PS01069 Prokaryotic diacylglycerol kinase FT signature and Pfam match to entry PF01219 FT DAGK_prokar,Prokaryotic diacylglycerol kinase, score FT 114.40, E-value 2.2e-30" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Synthesis and modification of macromolecules FT -Phospholipids" FT /note="PMID:2984194, PMID:3015952" FT /db_xref="GOA:Q0PBP8" FT /db_xref="InterPro:IPR000829" FT /db_xref="UniProtKB/TrEMBL:Q0PBP8" FT /inference="protein motif:Pfam:PF01219" FT /inference="protein motif:Prosite:PS01069" FT /protein_id="CAL34411.1" FT /translation="MKPKYHFLNNARYALEGLFALFKNEMAFRIELCIIIPAIVFSFFL FT KISFLEHLLLISVLILILIVEALNSAIEACVDLITNEWHEKAKIAKDCASAAVFFSVLL FT ALFVWGFILYNIYL" FT misc_feature 236134..236478 FT /note="HMMPfam hit to PF01219, Prokaryotic diacylglycerol FT kinase, score 3.3e-32" FT /inference="protein motif:Pfam:PF01219" FT misc_feature order(236209..236268,236287..236355,236413..236481) FT /note="3 probable transmembrane helices predicted for FT Cj0257 by TMHMM2.0 at aa 26-45, 52-74 and 94-116" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 236329..236364 FT /note="PS01069 Prokaryotic diacylglycerol kinase signature" FT /inference="protein motif:Prosite:PS01069" FT CDS 236487..236732 FT /transl_table=11 FT /locus_tag="Cj0258" FT /product="putative bacterial regulatory protein, ArsR FT family" FT /note="Original (2000) note: Cj0258, possible DNA binding FT protein, len: 81 aa; no Hp match. Contains probable FT helix-turn-helix motif at aa 35-56 (Score 1128, +3.03 SD)" FT /note="Updated (2006) note: Pfam domain PF01022 Bacterial FT regulatory protein, arsR family was identified within CDS. FT This was found by carrying out own Pfam search. Product FT modified to more specific family member due to motif match. FT No specific characterisation has been carried out yet, so FT putative kept within product function. Literature search FT identified paper with some additional information. FT Functional classification - Broad regulatory functions" FT /note="PMID:15231810" FT /db_xref="GOA:Q0PBP7" FT /db_xref="InterPro:IPR008813" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:Q0PBP7" FT /inference="protein motif:Pfam:PF01022" FT /protein_id="CAL34412.1" FT /translation="MKFENLIREILGKKRFELLKFLCENADENGFIMIKISDLEEKLHQ FT SKPTIIATFKFLEEKKLFKRLKNGFYQLNIGDKNET" FT CDS 236722..237729 FT /transl_table=11 FT /gene="pyrC" FT /locus_tag="Cj0259" FT /product="dihydroorotase" FT /EC_number="3.5.2.3" FT /note="Original (2000) note: Cj0259, pyrC, probable FT dihydroorotase, len: 335 aa; similar to many e.g. FT PYRC_ECOLI dihydroorotase (EC 3.5.2.3) (347 aa), fasta FT scores; opt: 765 z-score: 983.8 E(): 0, 39.4% identity in FT 345 aa overlap. 39.6% identity to HP0581. Contains PS00482 FT and PS00483 Dihydroorotase signatures 1 and 2" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Pyrimidine ribonucleotide biosynthesis" FT /note="PMID:1671037, PMID:2876892" FT /db_xref="GOA:Q0PBP6" FT /db_xref="InterPro:IPR002195" FT /db_xref="InterPro:IPR004721" FT /db_xref="InterPro:IPR006992" FT /db_xref="PDB:3PNU" FT /db_xref="UniProtKB/TrEMBL:Q0PBP6" FT /inference="protein motif:Prosite:PS00483" FT /inference="protein motif:Prosite:PS00482" FT /protein_id="CAL34413.1" FT /translation="MKLKNPLDMHLHLRDNQMLELIAPLSARDFCAAVIMPNLIPPLCN FT LEDLKAYKMRILKACKDENFTPLMTLFFKNYDEKFLYSAKDEIFGIKLYPAGITTNSNG FT GVSSFDIEYLKPTLEAMSDLNIPLLVHGETNDFVMDRESNFAKIYEKLAKHFPRLKIVM FT EHITTKTLCELLKDYENLYATITLHHLIITLDDVIGGKMNPHLFCKPIAKRYEDKEALC FT ELAFSGYEKVMFGSDSAPHPKDTKECCGCAAGVFSAPVILPVLAELFKQNSSEENLQKF FT LSDNTCKIYDLKFKEDKILTLEEKEWQVPNVYEDKYNQVVPYMAGEILKFQLKH" FT misc_feature 236725..237726 FT /note="HMMPfam hit to PF01979, Amidohydrolase family,score FT 1.7e-60" FT /inference="protein motif:Pfam:PF01979" FT misc_feature 236743..236769 FT /note="PS00482 Dihydroorotase signature 1" FT /inference="protein motif:Prosite:PS00482" FT misc_feature 237424..237459 FT /note="PS00483 Dihydroorotase signature 2" FT /inference="protein motif:Prosite:PS00483" FT CDS complement(237761..237976) FT /transl_table=11 FT /locus_tag="Cj0260c" FT /product="small hydrophobic protein" FT /note="Original (2000) note: Cj0260c, unknown, len: 71 aa; FT no Hp match, very hydrophobic" FT /note="Updated (2006) note: Two probable transmembrane FT helices identified by TMHMM2.0. Functional classification - FT Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBP5" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34414.1" FT /translation="MVKNLIIKFGRLILDAIAVISFVVALLYSLFMMFSIGFLAGLLSL FT IVSFIALFLSFFCNLSCYRYQRCSCK" FT misc_feature complement(join(237875..237943,237797..237865)) FT /note="2 probable transmembrane helices predicted for FT Cj0260c by TMHMM2.0 at aa 12-34 and 38-60" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(238032..238751) FT /transl_table=11 FT /locus_tag="Cj0261c" FT /product="putative SAM-dependent methyltransferase" FT /note="Original (2000) note: Cj0261c, unknown, len: 239 aa; FT some similarity in N-terminus to YC73_HAEIN hypothetical FT protein HI1273 (268 aa), fasta scores; opt: 208 z-score: FT 260.9 E(): 2.8e-07, 29.0% identity in 176 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF08241 and PF08242 FT Methyltransferase domains were identified within CDS. FT ProfileScan also identified PS50193 SAM_BIND domain. FT Members from methyltransferase family are SAM dependent FT methyltransferases. This was found by carrying out own Pfam FT search. Product modified to more specific family member due FT to motif match. No specific characterisation has been FT carried out yet, so putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PBP4" FT /db_xref="UniProtKB/TrEMBL:Q0PBP4" FT /inference="protein motif:Pfam:PF08242" FT /inference="protein motif:Pfam:PF08241" FT /inference="protein motif:Prosite:PS50193" FT /protein_id="CAL34415.1" FT /translation="MNLWDKKAKTYARYQNTLNTIQKQTFEYLQNLKISFQDKSIIDIG FT CGTGVWTLHLAKEAKEILALDSANAMLEILQEDAKKLNLNNIKCKNLSFETWMQNNPNV FT KFDLAFLSMSPALQNEKDYTNFLNLAKIKIYLGWADYRKSDFLDPIFKYFNTEFKGFYK FT KDLENYLLEKNIFFHKIVFDETRKVQRTKEEAIENALWHLSMNKITASKETVSSFVENN FT ITETIESKIKLLIINNL" FT repeat_region complement(238818..239964) FT /note="repeat 1: identical to 147606..148684 and FT 1492913..1493990 (approximate numbers)" FT CDS complement(238832..240829) FT /transl_table=11 FT /locus_tag="Cj0262c" FT /product="putative methyl-accepting chemotaxis signal FT transduction protein" FT /note="Original (2000) note: Cj0262c, probable FT methyl-accepting chemotaxis signal transduction FT protein,len: 665 aa; similar to many e.g. TR:O32443 FT (EMBL:D86947) Pseudomonas aeruginosa chemotactic transducer FT (629 aa),fasta scores; opt: 283 z-score: 635.0 E(): FT 4.1e-28, 25.3% identity in 667 aa overlap, and MCP1_ECOLI FT methyl-accepting chemotaxis protein I (551 aa), fasta FT scores; opt: 280 z-score: 519.1 E(): 1.2e-21. 29.1% FT identity in 302 aa overlap. No Hp ortholog. C-terminus FT contains repeat1, and is identical to the other repeat FT 1-containing genes Cj0262c and Cj1564. Contains N-terminal FT signal sequence and transmembrane anchor around aa 300. FT Also contains Pfam match to entry PF00015 FT MCPsignal,Methyl-accepting chemotaxis protein (MCP) FT signaling domain, score 110.60, E-value 4.1e-30" FT /note="Updated (2006) note: Pfam motifs PF05581 Vibrio FT chemotaxis protein N terminus, PF02743 Cache domain and FT PF00672 HAMP domain were identified within CDS. Further FT support given to product function. Literature search FT identified supporting papers giving further clues to FT product function. No specific characterisation with FT acceptable identity score has been carried out yet. FT Putative kept within product function. Functional FT classification - Chemotaxis and mobility" FT /note="PMID:14985343, PMID:15066034" FT /db_xref="GOA:Q0PBP3" FT /db_xref="InterPro:IPR003660" FT /db_xref="InterPro:IPR004010" FT /db_xref="InterPro:IPR004089" FT /db_xref="UniProtKB/TrEMBL:Q0PBP3" FT /inference="protein motif:Pfam:PF00672" FT /inference="protein motif:Pfam:PF02743" FT /inference="protein motif:Pfam:PF05581" FT /inference="protein motif:Pfam:PF00015" FT /protein_id="CAL34416.1" FT /translation="MQSINSGKSVGISAKLTLWVGILVVLILAITSAISYFDSRNNTYE FT LLKDTQLKTMQDVDAFFKSYAMSKRNGIQILANELTNRPDMSDEELINLIKVIKKVNDY FT DLVYVGFDNTGKNYQSDDQILDLSKGYDTKNRPWYKAAKEAKKLIVTEPYKSAASGEVG FT LTYAAPFYDRNGNFRGVVGGDYDLANFSTNVLTVGKSDNTFTEVLDSEGTILFNDEVAK FT ILTKTELSINIANAIKANPALIDPRNQDTLFTAKDHQGVDYAIMCNSAFNPLFRICTIT FT ENKVYTEAVNSILMKQVIVGIIAIIIALILIRFLISRSLSPLAAIQTGLTSFFDFINYK FT TKNVSTIEVKSNDEFGQISNAINENILATKRGLEQDNQAVKESVQTVSVVEGGNLTARI FT TANPRNPQLIELKNVLNKLLDVLQARVGSDMNAIHKIFEEYKSLDFRNKLENASGSVEL FT TTNALGDEIVKMLKQSSDFANALANESGKLQTAVQSLTTSSNSQAQSLEETAAALEEIT FT SSMQNVSVKTSDVITQSEEIKNVTGIIGDIADQINLLALNAAIEAARAGEHGRGFAVVA FT DEVRKLAERTQKSLSEIEANTNLLVQSINDMAESIKEQTAGITQINDSVAQIDQTTKDN FT VEIANESAIISSTVSDIANNILEDVKKKRF" FT misc_feature complement(238838..239332) FT /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis FT protein (MCP) s, score 6.4e-21" FT /inference="protein motif:Pfam:PF00015" FT misc_feature complement(239717..239941) FT /note="HMMPfam hit to PF00672, HAMP domain, score 0.0012" FT /inference="protein motif:Pfam:PF00672" FT misc_feature complement(join(240719..240787,239879..239938)) FT /note="2 probable transmembrane helices predicted for FT Cj0262c by TMHMM2.0 at aa 15-37 and 298-317" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(240146..240382) FT /note="HMMPfam hit to PF02743, Cache domain, score 0.00011" FT /inference="protein motif:Pfam:PF02743" FT misc_feature complement(240491..240802) FT /note="HMMPfam hit to PF05581, Vibrio chemotaxis protein N FT terminus, score 4.3e-68" FT /inference="protein motif:Pfam:PF05581" FT sig_peptide complement(240731..240829) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000126_238832_240829 by SignalP 2.0 FT HMM (Signal peptide probability 0.942) with cleavage site FT probability 0.410 between residues 33 and 34" FT CDS 241022..241897 FT /transl_table=11 FT /gene="zupT" FT /locus_tag="Cj0263" FT /product="zinc transporter" FT /note="Original (2000) note: Cj0263, probable integral FT membrane protein, len: 291 aa; similar to hypothetical FT proteins e.g. YGIE_ECOLI (257 aa), fasta scores; opt: 498 FT z-score: 952.9 E(): 0, 40.0% identity in 280 aa overlap and FT GUFA_MYXXA (254 aa), fasta scores; opt: 252 z-score: 298.8 FT E(): 2.2e-09, 26.3% identity in 285 aa overlap. No Hp FT match. Contains PS00107 Protein kinases ATP-binding region FT signature" FT /note="Updated (2006) note: Pfam domain PF02535 ZIP Zinc FT transporter was identified within CDS. Eight probable FT transmembrane helices predicted by TMHMM2.0. Product FT modified to more specific family member due to motif match. FT Characterised within Escherichia coli with acceptable FT identity score. Thus, putative not added. Functional FT classification - Transport/binding proteins -Other" FT /note="PMID:11790762, PMID:15716430" FT /db_xref="GOA:Q9PIN2" FT /db_xref="InterPro:IPR003689" FT /db_xref="InterPro:IPR023498" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIN2" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02535" FT /inference="protein motif:Prosite:PS00107" FT /protein_id="CAL34417.1" FT /translation="MQFTFEQIFIAMLLTLFAGFSTAIGSIIAFFSRKDDLRVLSLGLG FT FSAGVMIYISFMEILPTALKDFKNHYDSHWAELLGLACFFGGILISLLIDKLIPEDVNP FT HEPKEDLSELKICPLPQKGQNPPKFHPGEKLHQINTKALKRTGIFTALAIAIHNFPEGF FT ATFISSLDNLTLGIAIAIAVAIHNIPEGLAVSLPIYHATGDKKKAFIYSALSGFAEPLG FT AFVGALILLPFIGDLTLAISFAVIAGIMVFISLDELLPAAKTYDKAHDSLYGLIAGMAI FT MALSLNLLGQ" FT sig_peptide 241022..241117 FT /note="Signal peptide predicted for zupT by SignalP 2.0 HMM FT (Signal peptide probability 0.895) with cleavage site FT probability 0.305 between residues 32 and 33" FT misc_feature 241046..241879 FT /note="HMMPfam hit to PF02535, ZIP Zinc transporter, score FT 5.8e-38" FT /inference="protein motif:Pfam:PF02535" FT misc_feature order(241049..241117,241136..241201,241244..241303, FT 241463..241531,241541..241609,241646..241714, FT 241730..241798,241832..241891) FT /note="8 probable transmembrane helices predicted for FT Cj0263 by TMHMM2.0 at aa 10-32, 39-60, 75-94, FT 148-170,174-196, 209-231, 237-259 and 271-290" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 241145..241216 FT /note="PS00107 Protein kinases ATP-binding region FT signature" FT /inference="protein motif:Prosite:PS00107" FT CDS complement(241921..244437) FT /transl_table=11 FT /locus_tag="Cj0264c" FT /product="molybdopterin containing oxidoreductase" FT /note="Original (2000) note: Cj0264c, probable FT molybdopterin-containing oxidoreductase, len: 838 aa; FT highly similar to many e.g. DMSA_RHOSH dimethyl sulfoxide FT reductase precursor (822 aa), fasta scores; opt: 1343 FT z-score: 2990.1 E(): 0, 46.8% identity in 842 aa FT overlap,and BISC_ECOLI biotin sulfoxide reductase 1 (739 FT aa),fasta scores; opt: 1263 z-score: 2612.9 E(): 0, 46.7% FT identity in 766 aa overlap. 40.9% identity to HP0407. FT Contains PS00017 ATP/GTP-binding site motif A FT (P-loop),PS00932 Prokaryotic molybdopterin oxidoreductases FT signature 3, Pfam match to entry PF00384 FT molybdopterin,Prokaryotic molybdopterin oxidoreductases, FT score 110.50,E-value 9.4e-35 and N-terminal signal FT sequence" FT /note="Updated (2006) note: Characterisation work in more FT than one species with acceptable identity scores. FT Characterisation work within Campylobacter jejuni shows FT that Cj0264c is responsible for both trimethylamine-N-oxide FT (TMAO) and dimethyl sulfoxide (DMSO) reduction. Putative FT not added to product function. Functional classification - FT Misc" FT /note="PMID:12107136, PMID:11004177, PMID:8645727" FT /db_xref="GOA:Q0PBP1" FT /db_xref="InterPro:IPR006311" FT /db_xref="InterPro:IPR006655" FT /db_xref="InterPro:IPR006656" FT /db_xref="InterPro:IPR006657" FT /db_xref="InterPro:IPR006658" FT /db_xref="InterPro:IPR009010" FT /db_xref="UniProtKB/TrEMBL:Q0PBP1" FT /inference="protein motif:Pfam:PF00384" FT /inference="protein motif:Prosite:PS00932" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34418.1" FT /translation="MLDRRKFLKIGASLSALPLIPSLSAGKTVEASKVSLGLVKNGEVI FT TAAHWGILKLTIKDGKIVKSEPWEKVTKMDNPLQHYTADMVYKSRVKYPYVRKSYLENP FT DNPKPELRGKDEFVRVSYDEAIKLIAKELKKTRDSKGASAIFGGSYGWKSSGNMQNSRI FT LLHRFLNVTGGFVGATGDYSTGASQVIMPYVVGSIEVYEQQTSWENILSDSKYVVIWGA FT DPLSTLRIAWTSNEQRGLAYFEKLKDSKIKVICIDPVKTTTAKFLNAKWIAPRPNTDVA FT LMMGMASHLIAKKKVNYEFLDTYTTGFDKFKDYLEGKEDGVKKDTKWASKICGIDEKTI FT KNLAETFYDNSTMIMSGWGMQRAHHGEQPHWMLVTLCAMLGQIGTKGGGFGLSYHYSNG FT GVPTCKGGVIGGMTAGSLGIWKNGKFKGLSKAEASSEGAEWLQNAASYSFPVARIADAL FT LHPGKTIDHNGAKITYPDIDFIYWVGGNPLVHHQNTNTNVKAWRKPRTVVVNEIYWTPT FT AKMADIVMPVTSSYERDDITMTGDYSNMHIAPMKQAVEPVGESKDDYVIFSDICKIYGK FT DVFNAYTENGKKAKDFIKEYYNSALKQTQSFGEAFATPMPSFEEFWAKNEPITFEPTAE FT SLEWTRFSEFIEDPILNALGTDSGLIEIYSETIKNYNYDDCKAHPTWFEPIEWLGNASK FT EAPFHLLTNHPRDRLHSQLCHTSLRDTYAIKDREPILINSKDAKKLGIKNGDVVRVFNK FT RGEVLAGAVVSDEIMQGVVRLCEGAWYDPNENGLCKCGNANVLTMDIPTSKLANGNISH FT TGLVNIEKFKGELPKLTAFSAPKGAN" FT misc_feature complement(241993..242346) FT /note="HMMPfam hit to PF01568, Molydopterin dinucleotide FT binding dom, score 5.6e-41" FT /inference="protein motif:Pfam:PF01568" FT misc_feature complement(242146..242229) FT /note="PS00932 Prokaryotic molybdopterin oxidoreductases FT signature 3" FT /inference="protein motif:Prosite:PS00932" FT misc_feature complement(242719..244170) FT /note="HMMPfam hit to PF00384, Molybdopterin FT oxidoreductase, score 3.2e-120" FT /inference="protein motif:Pfam:PF00384" FT misc_feature complement(243046..243069) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT sig_peptide complement(244345..244437) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000127_241921_244437 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.964 between residues 31 and 32" FT CDS complement(244448..245023) FT /transl_table=11 FT /locus_tag="Cj0265c" FT /product="putative cytochrome C-type haem-binding FT periplasmic protein" FT /note="Original (2000) note: Cj0265c, probable cytochrome FT C-type haem-binding periplasmic protein, len: 191 aa; FT possibly part of electron-transport chain for FT oxidoreductase Cj0264c. Similar to C-terminus of many e.g. FT YECK_ECOLI probable cytochrome C-TYPE protein in bisZ-cutC FT intergenic region (366 aa), fasta scores; opt: 208 z-score: FT 216.4 E(): 8.5e-05, 27.0% identity in 163 aa overlap, and FT TORC_ECOLI cytochrome C-type protein torC (390 aa), fasta FT scores; opt: 264 z-score: 216.0 E(): 8.9e-05, 26.4% FT identity in 178 aa overlap. No Hp match. Contains FT N-terminal signal sequence and PS00190 Cytochrome c family FT heme-binding site signature" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however, identity score was marginal. FT Putative kept within product function. Functional FT classification - Energy metabolism - Electron transport" FT /note="PMID:11562502, PMID:11056172" FT /db_xref="GOA:Q0PBP0" FT /db_xref="InterPro:IPR009056" FT /db_xref="UniProtKB/TrEMBL:Q0PBP0" FT /inference="protein motif:Prosite:PS00190" FT /protein_id="CAL34419.1" FT /translation="MKKIFISFVVLATCLWAKNTAYTDEVVSLYLNKDDTKVIGRLLPT FT NPFEVLKSENNRVLLKIDGYVNPKAPSVIYFNDSQRIIVAAFSKNTKLNFSQRITGKNG FT KWDKVSLEIWADKKEFVKDNKEMLNRAKELFVNNCGICHAIHKEKEFTANAWPAIFRSM FT ADRTGIDKKDRWLVIEYLQKNAKDFKTK" FT misc_feature complement(244592..244609) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT sig_peptide complement(244955..245023) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000128_244448_245023 by SignalP 2.0 FT HMM (Signal peptide probability 0.978) with cleavage site FT probability 0.759 between residues 23 and 24" FT CDS complement(245504..246013) FT /transl_table=11 FT /locus_tag="Cj0266c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0266c, probable integral FT membrane protein, len: 169 aa; no Hp match" FT /note="Updated (2006) note: Two probable transmembrane FT helices identified by TMHMM2.0. Prosite PS00430 FT TONB_DEPENDENT_REC_1, TonB box, N-terminal also identified. FT No specific characterisation has been carried out yet. FT Putative kept within product function. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PBN9" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Prosite:PS00430" FT /protein_id="CAL34420.1" FT /translation="MHFTIFHIIAFIILLICFALICILIFLKVKQKEMALISYTIATIF FT TALLIYSIFLTINQFTTQADLSKLTYTRDLRHESVIVSGKVQNLTKFEIKKCYLILSIL FT NQQQVGGEIFNDKNIRNAKMQNTSVSYTIEIIDTLPGNTYKEFRASVPFPPTFNNPEFY FT HTLKCI" FT misc_feature complement(245759..246013) FT /note="PS00430 TonB-dependent receptor proteins signature FT 1" FT /inference="protein motif:Prosite:PS00430" FT misc_feature complement(join(245933..246001,245846..245914)) FT /note="2 probable transmembrane helices predicted for FT Cj0266c by TMHMM2.0 at aa 5-27 and 34-56" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(245921..246013) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000129_245504_246013 by SignalP 2.0 FT HMM (Signal peptide probability 0.974) with cleavage site FT probability 0.413 between residues 31 and 32" FT CDS complement(246013..246543) FT /transl_table=11 FT /locus_tag="Cj0267c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0267c, probable integral FT membrane protein, len: 176 aa; no Hp match" FT /note="Updated (2006) note: Two probable transmembrane FT helices identified by TMHMM2.0. Functional classification - FT Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PBN8" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34421.1" FT /translation="MEKLREIVLFYTTHLYLVDYMLILLVFFLFTCVLLLCVFLRHRPI FT AALFIIAFDIIICFLVYIYGYKLIDNEVRTRKIAITDQKMIQSSNDLIVDFNITNNSKN FT NFKECKITAKIFADKIPNDNIIEEYKKKFIPFRQKSREIKDLKKNATQVQRIAFENFNY FT ENNYTIRLVSECF" FT misc_feature complement(join(246433..246501,246346..246414)) FT /note="2 probable transmembrane helices predicted for FT Cj0267c by TMHMM2.0 at aa 15-37 and 44-66" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(246555..247643) FT /transl_table=11 FT /locus_tag="Cj0268c" FT /product="putative transmembrane protein" FT /note="Original (2000) note: Cj0268c, probable FT transmembrane protein, len: 362 aa; 55.9% identity to FT HP0248. Contains one transmembrane domain around aa 60" FT /note="Updated (2006) note: Pfam domain PF01145 SPFH domain FT / Band was identified within CDS. FPrintScan PR00679 FT Prohibitin was also identified. The FPrintScan identified FT is a child of the Pfam protein. No specific FT characherisation with acceptable identity scores have been FT carried out yet. Putative kept within product function. FT Functional classification - Membranes, lipoproteins and FT porins" FT /db_xref="GOA:Q0PBN7" FT /db_xref="InterPro:IPR000163" FT /db_xref="InterPro:IPR001107" FT /db_xref="InterPro:IPR001972" FT /db_xref="UniProtKB/TrEMBL:Q0PBN7" FT /inference="protein motif:Pfam:PF01145" FT /protein_id="CAL34422.1" FT /translation="MPADLNDYFNKKNGNSNNNGNNNRQNFNFKAPEFNFKGFGKFSPF FT VYGVIIIILFLIVAKPFMVINSGEMGIKSTTGKYDPNPLEPGLHFFLPFVQKITIIDTR FT VRQINYASIEGSNENLSSGSGVINKNSISVLDSRGLPVSIDVTVQYRLNPLQVPQTIAT FT WSLNWENKIIDPVVRDVVRSVVGKYTAEELPTNRNTIATQIEEGIRKTIEAQPNEPVEL FT RAVQLREIILPSKVKEQIERVQIAKQEAERTKYEVERANQEALKKAALAEGEANATIIS FT AKGKAMAVKIEADAQAYSNKEIANSLNTPLLNLKQIETQKEFNEALKVNQDAKIFLTPG FT GAVPNIWVDTKDAKKQSAANMN" FT misc_feature complement(246852..247460) FT /note="HMMPfam hit to PF01145, SPFH domain / Band, score FT 2.3e-37" FT /inference="protein motif:Pfam:PF01145" FT misc_feature complement(247446..247514) FT /note="1 probable transmembrane helix predicted for Cj0268c FT by TMHMM2.0 at aa 44-66" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(247656..248570) FT /transl_table=11 FT /gene="ilvE" FT /locus_tag="Cj0269c" FT /product="branched-chain amino acid aminotransferase" FT /EC_number="2.6.1.42" FT /note="Original (2000) note: Cj0269c, ilvE, probable FT branched-chain amino acid aminotransferase, len: 304 aa; FT highly similar to many e.g. ILVE_ECOLI branched-chain amino FT acid aminotransferase (EC 2.6.1.42) (308 aa), fasta scores; FT opt: 823 z-score: 1182.1 E(): 0, 46.3% identity in 296 aa FT overlap. 33.2% identity to HP1468. Contains Pfam match to FT entry PF01063 AA_transferase_C4, Aminotransferase class IV, FT score 300.30, E-value 2.4e-86" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Amino acid biosynthesis - Branched chain family" FT /note="PMID:3897211" FT /db_xref="GOA:Q0PBN6" FT /db_xref="InterPro:IPR001544" FT /db_xref="InterPro:IPR005785" FT /db_xref="UniProtKB/TrEMBL:Q0PBN6" FT /inference="protein motif:Pfam:PF01063" FT /protein_id="CAL34423.1" FT /translation="MISADKIWMDGKLVDFKDATLHFLTHSLHYGNAVFEGTRAYKTDK FT GLAIFRLEDHTKRLLESAKITLLNCPFSQKELENAQIELLKANNFKSNVYIRPLIFLGD FT GVMGLYHIKAPVRVGIAAWEWGAYLGEEGLEKGIKVKISSFARNSVKSCMGKAKASANY FT LNSQIAKFEAIEAGYEEALMLDEEGFIAEGTGECFFIVKDGVLITPPNDFSLKSITQDT FT VLKIAHDLGITVLRQRISRDEVYTADEAFFTGTAAEITPINNIDARIIGNGLRGSVTKK FT LQDAYFDVVYGRNEKYASMLTYI" FT misc_feature complement(247710..248543) FT /note="HMMPfam hit to PF01063, Aminotransferase class FT IV,score 6.2e-88" FT /inference="protein motif:Pfam:PF01063" FT CDS 248747..248953 FT /transl_table=11 FT /locus_tag="Cj0270" FT /product="putative tautomerase family protein" FT /EC_number="5.3.2.-" FT /note="Original (2000) note: Cj0270, possible FT isomerase,len: 68 aa; some similarity hypothetical proteins FT and to to e.g. DMPI_PSESP 4-oxalocrotonate tautomerase (EC FT 5.3.2.-) ( (62 aa), fasta scores; opt: 91 z-score: 182.5 FT E(): 0.0066, 28.0% identity in 50 aa overlap, and FT XYLH_PSEPU 4-oxalocrotonate tautomerase (62 aa), fasta FT scores; opt: 86 z-score: 164.7 E(): 0.064, 25.8% identity FT in 62 aa overlap. No Hp ortholog, but 37.3% identity to FT HP0924. Also similar to Cj1255 (37.7% identity in 69 aa FT overlap)" FT /note="Updated (2006) note: Pfam domain PF01361 Tautomerase FT enzyme was identified within CDS. Product modified to more FT specific family member due to motif match. Some FT characterisation has been carried out within Pseudomonas FT species, however, identity scores were marginal. Putative FT kept within product function. Functional classification - FT Misc" FT /db_xref="GOA:Q9PIM5" FT /db_xref="InterPro:IPR004370" FT /db_xref="InterPro:IPR014347" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIM5" FT /inference="protein motif:Pfam:PF01361" FT /protein_id="CAL34424.1" FT /translation="MPLVNIKLAKPSLSKEQKAELIADITELLSTKYNKSKERVVVVLE FT DVENYDIGFGGESVEAIKAKASK" FT misc_feature 248750..248932 FT /note="HMMPfam hit to PF01361, Tautomerase enzyme, score FT 1.4e-21" FT /inference="protein motif:Pfam:PF01361" FT CDS 248950..249405 FT /transl_table=11 FT /locus_tag="Cj0271" FT /product="bacterioferritin comigratory protein homolog" FT /note="Original (2000) note: Cj0271, bacterioferritin FT comigratory protein homolog, len: 151 aa; similar to many FT e.g. BCP_ECOLI bacterioferritin comigratory protein (156 FT aa), fasta scores; opt: 390 z-score: 675.8 E(): FT 2.2e-30,39.6% identity in 149 aa overlap. 57.0% identity to FT HP0136. Contains Pfam match to entry PF00578 FT AhpC-TSA,AhpC/TSA family, score 146.30, E-value 5.4e-40" FT /note="Updated (2006) note: Some characterisation work FT within Escherichia coli shows Cj0271 to be putative FT peroxiredoxin (EC.1.11.1.15), bcp. Literature search also FT identified work within Helicobacter pylori. Product FT function kept the same. Functional classification - Misc" FT /note="PMID:15618175, PMID:12576586, PMID:14506251" FT /db_xref="GOA:Q0PBN4" FT /db_xref="InterPro:IPR000866" FT /db_xref="InterPro:IPR012336" FT /db_xref="InterPro:IPR024706" FT /db_xref="UniProtKB/TrEMBL:Q0PBN4" FT /inference="protein motif:Pfam:PF00578" FT /protein_id="CAL34425.1" FT /translation="MSLNIGDKAPQFELLNQDGVKIALKDFIGKKVILYFYPKDNTPGC FT TTEACDFSANYDKFGGKNAVIIGISPDSVASHEKFISKFDLKHILLSDSEKEVAKAYGA FT LGLKKNYGKEYEGLIRSTFVIDETGKIAQIYSNVRVKDHALKVLESL" FT misc_feature 248962..249387 FT /note="HMMPfam hit to PF00578, AhpC/TSA family, score FT 4e-41" FT /inference="protein motif:Pfam:PF00578" FT CDS 249405..250496 FT /transl_table=11 FT /locus_tag="Cj0272" FT /product="conserved hypothetical protein Cj0272" FT /note="Original (2000) note: Cj0272, unknown, len: 363 aa; FT similar to hypothetical proteins e.g. TR:O66919 (EMBL:) FT Aquifex aeolicus AQ_701 (413 aa), fasta scores; opt: 830 FT z-score: 1296.8 E(): 0, 48.0% identity in 254 aa overlap. FT 37.4% identity to HP0100" FT /note="Updated (2006) note: Pfam PF02677 Uncharacterized FT BCR was present within CDS. Conserved added to product FT function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="InterPro:IPR003828" FT /db_xref="UniProtKB/TrEMBL:Q0PBN3" FT /inference="protein motif:Pfam:PF02677" FT /protein_id="CAL34426.1" FT /translation="MLVHICCSVDSHYFIEELRKTYPDEKIIGYFYDPNIHPLSEYELR FT FLDVKRSCDKLGIKLYKGEYEYEKWLNAVRGYEDEPEKGARCEICFDVRMGSSVKFAAK FT IGEKKLTTTLLTSPKKDLEQLKNALQKECEPYGVEFLAPDFRKNGGTQRQFALAKKEML FT YHQNYCGCIYGLKKQKQDKNFIDELMSSVNKQILPVSIEARIALYKKVVLWEKKGIKFE FT ILREKFLNYRLLSALIKLDKKPVKSHILFYSHFKNAYTRFSLDEENLKQNLKEGFYRST FT KDEIVLVEFWRFNAFFKNKWKNFEDFLKKPLSVQAEIKWRNKLFGTYNLSPIIILENIL FT PSRYEVIAKSEIYHDNQEVLVKI" FT misc_feature 249405..250016 FT /note="HMMPfam hit to PF02677, Uncharacterized BCR,COG1636, FT score 2.6e-97" FT /inference="protein motif:Pfam:PF02677" FT CDS 250590..251030 FT /transl_table=11 FT /gene="fabZ" FT /locus_tag="Cj0273" FT /product="(3R)-hydroxymyristoyl-[acyl carrier protein] FT dehydratase" FT /EC_number="4.2.1.-" FT /note="Original (2000) note: Cj0273, fabZ, probable FT (3R)-hydroxymyristoyl-[acyl carrier protein] FT dehydratase,len: 146 aa; similar to many e.g. FABZ_ECOLI FT (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase FT (EC 4.2.1.-) (151 aa), fasta scores; opt: 450 z-score: FT 717.9 E(): 9.9e-33, 47.1% identity in 138 aa overlap. 56.8% FT identity to HP1376" FT /note="Updated (2006) note: Pfam domain PF03061 FT Thioesterase superfamily identified within CDS. Further FT support given to product function. Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Fatty acid biosynthesis" FT /note="PMID:7806516" FT /db_xref="GOA:Q9PIM2" FT /db_xref="InterPro:IPR010084" FT /db_xref="InterPro:IPR013114" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIM2" FT /inference="protein motif:Pfam:PF03061" FT /protein_id="CAL34427.1" FT /translation="MIDVMQIQEILPHRYPFLLVDKITELKVKEVVLGYKNISISDHVF FT MGHFPGHPIYPGVLILEGMAQTGGVLAFESMEDKVDPKSKVVYFTGIDGAKFRNPVRPG FT DRLDYEMSVVKNRGNMWIFKGQAFVDGNLVAEAELKAMIVDK" FT misc_feature 250725..250997 FT /note="HMMPfam hit to PF03061, Thioesterase FT superfamily,score 2.4e-21" FT /inference="protein motif:Pfam:PF03061" FT CDS 251030..251821 FT /transl_table=11 FT /gene="lpxA" FT /locus_tag="Cj0274" FT /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam FT ine O-acyltransferase" FT /EC_number="2.3.1.129" FT /note="Original (2000) note: Cj0274, lpxA, probable FT acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine FT O-acyltransferase, len: 263 aa; similar to many e.g. FT LPXA_ECOLI FT acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine FT O-acyltransferase (EC 2.3.1.129) (262 aa), fasta scores; FT opt: 632 z-score: 961.5 E(): 0, 37.4% identity in 254 aa FT overlap. 42.6% identity to HP1375. Contains PS00101 FT Hexapeptide-repeat containing-transferases signature and 5x FT Pfam match to entry PF00132 hexapep, Bacterial transferase FT hexapeptide (four repeats)" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Surface polysaccharides, lipopolysaccharides and antigens" FT /note="PMID:3277952" FT /db_xref="GOA:Q9PIM1" FT /db_xref="InterPro:IPR001451" FT /db_xref="InterPro:IPR010137" FT /db_xref="InterPro:IPR011004" FT /db_xref="InterPro:IPR018357" FT /db_xref="PDB:3R0S" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIM1" FT /inference="protein motif:Pfam:PF00132" FT /inference="protein motif:Prosite:PS00101" FT /protein_id="CAL34428.1" FT /translation="MKKIHPSAVIEEGAQLGDDVVIEAYAYVSKDAKIGNNVVIKQGAR FT ILSDTTIGDHSRVFSYAIVGDIPQDISYKEEQKSGVVIGKNATIREFATINSGTAKGDG FT FTRIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQFVKVG FT EGCMIAGASALSQDIVPFCLAEGNRASIRSLNLVGIRRRFDKDEVDRLSRAFKTLFRQG FT DLKENAKNLLENQESENVKKMCHFILETKRGIPVYRGKNNA" FT misc_feature 251048..251101 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 0.78" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 251120..251173 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 0.072" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 251174..251227 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 1.3" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 251267..251320 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 0.075" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 251342..251395 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 0.011" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 251414..251467 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 2.8" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 251423..251509 FT /note="PS00101 Hexapeptide-repeat containing-transferases FT signature" FT /inference="protein motif:Prosite:PS00101" FT misc_feature 251504..251557 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 50" FT /inference="protein motif:Pfam:PF00132" FT CDS 251784..253037 FT /transl_table=11 FT /gene="clpX" FT /locus_tag="Cj0275" FT /product="ATP-dependent Clp protease ATP-binding subunit" FT /note="Original (2000) note: Cj0275, clpX, probable FT ATP-dependent clp protease ATP-binding subunit clpX, len: FT 417 aa; highly similar to many e.g. CLPX_ECOLI FT ATP-dependent clp protease ATP-binding subunit clpX (423 FT aa), fasta scores; opt: 1432 z-score: 1938.7 E(): 0, 55.6% FT identity in 408 aa overlap. 59.0% identity to HP1374. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Degradation of macromolecules - Proteins, peptides and FT glycopeptides" FT /note="PMID:8226770, PMID:7743994" FT /db_xref="GOA:Q9PIM0" FT /db_xref="InterPro:IPR002078" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR004487" FT /db_xref="InterPro:IPR010603" FT /db_xref="InterPro:IPR013093" FT /db_xref="InterPro:IPR019489" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIM0" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34429.1" FT /translation="MEFLSIGVKIMPRKCSFCNEVENPQRRILANENDDAFICEYCVEG FT AYSIIYGEEKEFKEPKQSHNTEFKDITPKELKAYLDRYVIGQDRAKKVFSVGVYNHYKR FT LFKAELQDDDTELFKSNILLVGPTGSGKTLLAQTLAKFLDVPIAICDATSLTEAGYVGE FT DVENILTRLLQAADGDVQRAQKGIVFIDEIDKIARMSENRSITRDVSGEGVQQALLKII FT EGSLVNIPPRGGRKHPNQEFIQIDTSNILFVCGGAFDGLETILKRKLGDKVVGFFDDAK FT EENKALLEKIEPDDLVHFGLIPELIGRLHVIASLNELNEEDMVRILTEPKNAIIKQYQK FT LFAIDGVNLKFEEDALRAIAQLALERKTGARGLRSIIEEMMVDLMFELPEYKDYDIVIT FT KEVVKDNAKALLIKRKIS" FT misc_feature 251826..251942 FT /note="HMMPfam hit to PF06689, ClpX C4-type zinc FT finger,score 3.2e-14" FT /inference="protein motif:Pfam:PF06689" FT misc_feature 252132..252719 FT /note="HMMPfam hit to PF07724, ATPase family associated FT with various cell, score 2.7e-77" FT /inference="protein motif:Pfam:PF07724" FT misc_feature 252144..252767 FT /note="HMMPfam hit to PF00004, ATPase family associated FT with various cell, score 1.1e-26" FT /inference="protein motif:Pfam:PF00004" FT misc_feature 252159..252182 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 252315..252362 FT /note="PS00676 Sigma-54 interaction domain ATP-binding FT region B signature" FT /inference="protein motif:Prosite:PS00676" FT repeat_region 252478..252485 FT /note="G(8)" FT CDS 253049..254089 FT /transl_table=11 FT /gene="mreB" FT /locus_tag="Cj0276" FT /product="homolog of E. coli rod shape-determining protein" FT /note="Original (2000) note: Cj0276, mreB, homolog of E. FT coli rod shape-determining protein, len: 346 aa; highly FT similar to many e.g. MREB_ECOLI rod shape-determining FT protein mreB (347 aa), fasta scores; opt: 1199 z-score: FT 1757.3 E(): 0, 55.8% identity in 339 aa overlap. 71.4% FT identity to HP1373. Contains PS00017 ATP/GTP-binding site FT motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF06723 MreB/Mbl FT protein was identified within CDS. MreB is known to be a FT rod shape-determining protein in bacteria and makes up the FT bacterial cytoskeleton. Further support given to product FT function. Characterised within Escherichia coli with FT acceptable identity score. Product function kept the same. FT Functional classification - Cell division" FT /note="PMID:3049542, PMID:2687239" FT /db_xref="GOA:Q0PBM9" FT /db_xref="InterPro:IPR001023" FT /db_xref="InterPro:IPR004753" FT /db_xref="UniProtKB/TrEMBL:Q0PBM9" FT /inference="protein motif:Pfam:PF06723" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34430.1" FT /translation="MILDQLIGFFSSDMGIDLGTANTLVLVKDKGIVINEPSVVAVERE FT RYDSKAKILAVGKEAKDMVGKTPGNIEAIRPMKDGVIADFDMTEKMIRYFIEKTHRRKS FT FLRPRIIISVPYGLTQVERKAVRESALSAGAREVFLIEEPMAAAIGASLPIQEPKGNLV FT VDIGGGTTEIGVISLGGLVISKSIRTAGDKLDMSIVNYVKEKYNLIIGERTGEEIKITI FT GSAIQLPKELSMVVKGRDQVSGLLSRIELTSEDVREAMREYLKEIADALKMVLEMMPPD FT LASDIVENGVVLTGGGALIRGLDKYLSEIVRLPVYIADEPLLAVAKGTGKALEEISLLQ FT QLTNEE" FT misc_feature 253079..254071 FT /note="HMMPfam hit to PF06723, MreB/Mbl protein, score FT 6.5e-229" FT /inference="protein motif:Pfam:PF06723" FT misc_feature 253226..253249 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 254079..254828 FT /transl_table=11 FT /gene="mreC" FT /locus_tag="Cj0277" FT /product="homolog of E. coli rod shape-determining protein" FT /note="Original (2000) note: Cj0277, probable periplasmic FT protein, len: 249 aa; 30.2% identity to HP1372 annotated as FT rod shape-determining protein (mreC), no apparent match to FT any other mreC genes. Contains N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF04085 rod FT shape-determining protein MreC was identified within CDS. FT MreC (murein formation C) is involved in the rod shape FT determination in E. coli, and more generally in cell shape FT determination of bacteria whether or not they are FT rod-shaped. Product changed due to motif match. Functional FT classification - Cell division" FT /note="PMID:2687239, PMID:12867458, PMID:15612918" FT /db_xref="GOA:Q0PBM8" FT /db_xref="InterPro:IPR007221" FT /db_xref="UniProtKB/TrEMBL:Q0PBM8" FT /inference="protein motif:Pfam:PF04085" FT /protein_id="CAL34431.1" FT /translation="MKNKIFYVLVLAFLVFISFYYGGLIKQNVLRVNDFVIGNFYNIKD FT YLGEKISEHFNQANQIQQLKARNKELEDIAVKVTSFANQLNRILEDQNSTKYLPQVSLT FT RVISYVQLNDYKKLWLDWSKIPVGKNRGLIYQGYTAGIAINKNGRAMALLQGDDQCVFS FT VYIGKSKAPGLIQGEDGRIVVKFIPKWAKINTGDEILTSGLDNIFFSDIPVGIVNRVND FT EDMYQSVEVKPYVKISIPAYLYVVDNL" FT misc_feature 254091..254150 FT /note="1 probable transmembrane helix predicted for Cj0277 FT by TMHMM2.0 at aa 5-24" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 254388..254825 FT /note="HMMPfam hit to PF04085, rod shape-determining FT protein MreC, score 2.4e-43" FT /inference="protein motif:Pfam:PF04085" FT CDS 255089..258358 FT /transl_table=11 FT /gene="carB" FT /locus_tag="Cj0279" FT /product="carbamoyl-phosphate synthase large chain" FT /EC_number="6.3.5.5" FT /note="Original (2000) note: Cj0279, carB, probable FT carbamoyl-phosphate synthase large chain, len: 1089 aa; FT highly similar to many e.g. CARB_ECOLI carbamoyl-phosphate FT synthase large chain (EC 6.3.5.5) (1072 aa), fasta scores; FT opt: 3268 z-score: 4517.4 E(): 0, 55.3% identity in 1098 aa FT overlap. 62.5% identity to HP0919. Contains 2x PS00866 FT Carbamoyl-phosphate synthase subdomain signature 1, 2x FT PS00867 Carbamoyl-phosphate synthase subdomain signature 2, FT and 2x Pfam match to entry PF00289 FT CPSase_L_chain,Carbamoyl-phosphate synthase (CPSase). Also FT contains apparent N-terminal signal sequence with FT appropriately positioned PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Pyrimidine ribonucleotide biosynthesis" FT /note="PMID:6308632" FT /db_xref="GOA:Q9PIL7" FT /db_xref="InterPro:IPR005479" FT /db_xref="InterPro:IPR005480" FT /db_xref="InterPro:IPR005481" FT /db_xref="InterPro:IPR005483" FT /db_xref="InterPro:IPR006275" FT /db_xref="InterPro:IPR011607" FT /db_xref="InterPro:IPR011761" FT /db_xref="InterPro:IPR013815" FT /db_xref="InterPro:IPR013816" FT /db_xref="InterPro:IPR013817" FT /db_xref="InterPro:IPR016185" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIL7" FT /inference="protein motif:Prosite:PS00013" FT /inference="protein motif:Pfam:PF00289" FT /inference="protein motif:Prosite:PS00867" FT /inference="protein motif:Prosite:PS00866" FT /protein_id="CAL34432.1" FT /translation="MPKRTDIKSILLIGSGPIVIGQACEFDYSGTQAAKTLKELGYRVV FT LINSNPATIMTDPEFADATYIEPITKESILSIIKKEKIDAILPTMGGQVALNVAMEVYE FT SGLLGDVKFLGANPEAIKKGEDRQVFKECMKKIGMDLPKSMYAYNYDEALKAVDEIDFP FT LMIRASYTLGGAGSGVVYNMDEFKELTNTALALSPIHEILIEESLLGWKEYEMEVIRDR FT ADNCIIVCSIENIDPMGVHTGDSITIAPALTLTDKEYQVMRNASFAILREIGVDTGGSN FT VQFAINPKNGRMIVIEMNPRVSRSSALASKATGYPIAKVATLLAVGFSLDEIKNDITGT FT PASFEPVIDYIVTKIPRFTFEKFPGANTTLGTAMKSVGEVMAIGRTFKESIQKALCSLE FT RSLSGFDRVKFEDRNDLVFKIRNANEKRLLYVAQAFREGFSVEELYELCKIDPWFLTQI FT KEIVDFEEQIDMDILNNKALLRKAKTMGFSDKMIALLVNLKDNLELSQNDIYYVRMKQK FT IIAEFSEVDTCAGEFEALTPYLYSSINVSELTQSKNDAKDKKEKKVMIIGGGPNRIGQG FT IEFDYACVHASFALKDMGIKTIMYNCNPETVSTDYDTSDILYFEPIDFEHLRAVIEREK FT PDGVIVHFGGQTPLKFAKRLSAFGAKIIGTSARVIDMAEDRKKFAEFITKLGINQPKNS FT TATSVEEAVLKASDIGYPVLVRPSYVLGGRAMRVVNDEAELRLYMQEAVDVSDKSPVLI FT DQFLDNATEIDVDAICDGKDVYVAGIMEHIEEAGIHSGDSACSLPPCNIDEKMQEFIAQ FT KTADIALNLGVVGLLNIQFALHNNELYMIEVNPRASRTIPFVSKATGIPLAKVATRVMW FT QGNLKEALKFYDTFKVVNFDTKILRPKTPKYMSVKEAVFPFAKLSGSDLELGPEMRSTG FT EVMGISKDFANSYAKSQIASFNHLPEQGVVFISLKDKDKKYTKKIAAEYVKLGFKLMAT FT GGTCKEILESGFECELVHKISEGRPNVEDKLKNGEIHLVINTSDSHSFKGDTKKIRENI FT IRFKIPYFTNLRSALAGAKSIKAIQSKSCLDVKSLQEWLKS" FT misc_feature 255104..255460 FT /note="HMMPfam hit to PF00289, Carbamoyl-phosphate synthase FT L chain,, score 1.8e-45" FT /inference="protein motif:Pfam:PF00289" FT misc_feature 255128..255160 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 255464..256168 FT /note="HMMPfam hit to PF02786, Carbamoyl-phosphate synthase FT L chain,, score 2.3e-112" FT /inference="protein motif:Pfam:PF02786" FT misc_feature 255572..255616 FT /note="PS00866 Carbamoyl-phosphate synthase subdomain FT signature 1" FT /inference="protein motif:Prosite:PS00866" FT misc_feature 255971..255994 FT /note="PS00867 Carbamoyl-phosphate synthase subdomain FT signature 2" FT /inference="protein motif:Prosite:PS00867" FT misc_feature 256334..256717 FT /note="HMMPfam hit to PF02787, Carbamoyl-phosphate FT synthetase large c, score 2.8e-46" FT /inference="protein motif:Pfam:PF02787" FT misc_feature 256763..257107 FT /note="HMMPfam hit to PF00289, Carbamoyl-phosphate synthase FT L chain,, score 3.2e-19" FT /inference="protein motif:Pfam:PF00289" FT misc_feature 257111..257764 FT /note="HMMPfam hit to PF02786, Carbamoyl-phosphate synthase FT L chain,, score 8e-25" FT /inference="protein motif:Pfam:PF02786" FT misc_feature 257219..257263 FT /note="PS00866 Carbamoyl-phosphate synthase subdomain FT signature 1" FT /inference="protein motif:Prosite:PS00866" FT misc_feature 257606..257629 FT /note="PS00867 Carbamoyl-phosphate synthase subdomain FT signature 2" FT /inference="protein motif:Prosite:PS00867" FT misc_feature 257999..258259 FT /note="HMMPfam hit to PF02142, MGS-like domain, score FT 2.5e-28" FT /inference="protein motif:Pfam:PF02142" FT CDS 258355..258777 FT /transl_table=11 FT /locus_tag="Cj0280" FT /product="hypothetical protein Cj0280" FT /note="Original (2000) note: Cj0280, unknown, len: 140 aa; FT 52.8% identity to HP0918. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="InterPro:IPR017945" FT /db_xref="UniProtKB/TrEMBL:Q0PBM6" FT /protein_id="CAL34433.1" FT /translation="MIYLAQTDTTVGFLSKNLEEINALKGRDKNQPCLITSAKFCELKS FT LARIPKSFKNLVRRSKKTTFIYPNNQAIRIVKECKHANFLSKNGYFYSSSANKHGKEFD FT EEWARSVADIILDEKFFENIPSKILKLSKNKMIKIR" FT CDS complement(258778..259755) FT /transl_table=11 FT /gene="tal" FT /locus_tag="Cj0281c" FT /product="putative transaldolase" FT /EC_number="2.2.1.2" FT /note="Original (2000) note: Cj0281c, tal, probable FT transaldolase, len: 325 aa; similar to e.g. TAL_NOSS2 FT transaldolase (EC 2.2.1.2) (381 aa), fasta scores; opt: 361 FT z-score: 582.9 E(): 3.3e-25, 28.7% identity in 362 aa FT overlap and TALB_ECOLI transaldolase B (EC 2.2.1.2) (316 FT aa), fasta scores; opt: 193 z-score: 295.4 E(): FT 3.4e-09,28.8% identity in 177 aa overlap. 43.4% identity to FT HP1495. Contains PS01054 Transaldolase signature 1 and Pfam FT match to entry PF00923 Transaldolase, Transaldolase,score FT 112.30, E-value 1.9e-30" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores (covering full sequence). FT Putative kept within product function. Functional FT classification - Energy metabolism - Non-oxidative branch" FT /db_xref="GOA:Q9PIL5" FT /db_xref="InterPro:IPR001585" FT /db_xref="InterPro:IPR004732" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR018225" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIL5" FT /inference="protein motif:Pfam:PF00923" FT /inference="protein motif:Prosite:PS01054" FT /protein_id="CAL34434.1" FT /translation="MKNFSLWCDFIENSFLDNEFLNLLSHGINGATSNPAIFKNAILNS FT PIYKDKILKLKEKKTKDIYEELAISDIQKAADKLAPLFYQKNDGFISIEIDPRLHDNTT FT LSLGEAKRLYSAIGKENIMIKIPATKASYEVMYELMKNGISVNATLIFSLEQSQKCFEA FT LNAGLVEFRKNNIALKEQNTRTPQAVISIFVSRFDRLLNPKAKEQNRIGILNANLAYNN FT IYSKNEPNIRALFASTGVKGDDLPKDYYIKELLFENSVNTAPLDAIEAFKGKMHFKKPL FT MNFEIYTELNQIISQSEREKACNDLLSDGLEQFCIAFEDILKAL" FT misc_feature complement(258781..259719) FT /note="HMMPfam hit to PF00923, Transaldolase, score 7e-34" FT /inference="protein motif:Pfam:PF00923" FT misc_feature complement(259642..259668) FT /note="PS01054 Transaldolase signature 1" FT /inference="protein motif:Prosite:PS01054" FT CDS complement(259755..260378) FT /transl_table=11 FT /gene="serB" FT /locus_tag="Cj0282c" FT /product="putative phosphoserine phosphatase" FT /EC_number="3.1.3.3" FT /note="Original (2000) note: Cj0282c, serB, possible FT phosphoserine phosphatase, len: 207 aa; similar to FT C-terminus of SERB_ECOLI phosphoserine phosphatase (EC FT 3.1.3.3) (322 aa), fasta scores; opt: 361 z-score: 572.4 FT E(): 1.3e-24, 34.3% identity in 204 aa overlap. 48.8% FT identity to HP0652" FT /note="Updated (2006) note: Pfam domain PF00702 haloacid FT dehalogenase-like hydrolase were identified within CDS. FT TIGRFAM motif TIGR00338, serB phosphoserine phosphatase FT identified along with TIGR01488 HAD-SF-IB: HAD-superfamily FT hydrolase within CDS. Further support for product function. FT Characterised within Escherichia coli with acceptable FT identity scores, however, alignment was only partial. FT Putative kept in product function. Functional FT classification - Amino acid biosynthesis - Serine family" FT /note="PMID:2997734" FT /db_xref="GOA:Q0PBM4" FT /db_xref="InterPro:IPR004469" FT /db_xref="InterPro:IPR005834" FT /db_xref="InterPro:IPR006383" FT /db_xref="InterPro:IPR023190" FT /db_xref="InterPro:IPR023214" FT /db_xref="UniProtKB/TrEMBL:Q0PBM4" FT /inference="protein motif:Pfam:PF00702" FT /protein_id="CAL34435.1" FT /translation="MIKLCVFDFDATLMDGETIDILATAHGKGNQTSEITRHAMTGELD FT FFESLQKRVSFLKGMSYKKVLELSSTLPLMRGAHELIQYLKSKNIQIVIFSGGFHEGIN FT PAMQKLGINLGFANYLHHKNDILTGLVGGEMMFSNSKGLMLQRLKSFLNLKTDEVMCVG FT DGANDLAMFNESGLKIAFCAKEILRSQADICIDIKDLKEIIKVI" FT misc_feature complement(259824..260375) FT /note="HMMPfam hit to PF00702, haloacid dehalogenase-like FT hydrolase, score 5.8e-18" FT /inference="protein motif:Pfam:PF00702" FT CDS complement(260378..260899) FT /transl_table=11 FT /gene="cheW" FT /locus_tag="Cj0283c" FT /product="chemotaxis protein" FT /note="Original (2000) note: Cj0283c, cheW, probable FT chemotaxis protein, len: 173 aa; similar to many e.g. FT CHEW_ECOLI purine-binding chemotaxis protein (167 aa),fasta FT scores; opt: 236 z-score: 304.4 E(): 1.1e-09, 32.4% FT identity in 139 aa overlap. 51.4% identity to HP0391" FT /note="Updated (2006) note: Pfam domain PF01584 CheW-like FT domain identified within CDS. Further support given to FT product function. Characterised within Escherichia coli FT with marginal identity score. Putative not added to product FT function. Functional classification - Chemotaxis and FT mobility" FT /note="PMID:2068106, PMID:3510184" FT /db_xref="GOA:Q0PBM3" FT /db_xref="InterPro:IPR002545" FT /db_xref="UniProtKB/TrEMBL:Q0PBM3" FT /inference="protein motif:Pfam:PF01584" FT /protein_id="CAL34436.1" FT /translation="MSNEKLEQILQKQQTQMAGPDVDQREDDIIQLVGFVVGDEEYAIP FT ILNIQEIIKPIEYTRVPSVPDYVLGVFNMRGNVMPLIDLAQRFHLGSSKMTPQTRYIVL FT RGETNGTGVGGNAGFVIDRLTEAIKIHRNRIDPPPETLVKDKGMIYGIGKRDENILTIL FT KVEALLKREF" FT misc_feature complement(260381..260809) FT /note="HMMPfam hit to PF01584, CheW-like domain, score FT 5.9e-30" FT /inference="protein motif:Pfam:PF01584" FT CDS complement(260904..263213) FT /transl_table=11 FT /gene="cheA" FT /locus_tag="Cj0284c" FT /product="chemotaxis histidine kinase" FT /EC_number="2.7.3.-" FT /note="Original (2000) note: Cj0284c, cheA, probable FT chemotaxis histidine kinase, len: 769 aa; similar to many FT e.g. CHEA_ECOLI chemotaxis protein cheA (EC 2.7.3.-) (654 FT aa), fasta scores; opt: 1022 z-score: 1416.0 E(): 0, 35.7% FT identity in 658 aa overlap. 64.6% identity to HP0392. FT Contains Pfam matches to entry PF00072 FT response_reg,Response regulator receiver domain, score FT 103.80, E-value 3.4e-27 and to entry PF00512 signal, Signal FT carboxyl-terminal domain, score -12.30, E-value 0.00013" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity scores. Putative FT not added to product function. Functional classification FT -Chemotaxis and mobility" FT /note="PMID:1938941, PMID:2068106" FT /db_xref="GOA:Q0PBM2" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR002545" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR004105" FT /db_xref="InterPro:IPR004358" FT /db_xref="InterPro:IPR005467" FT /db_xref="InterPro:IPR008207" FT /db_xref="InterPro:IPR009082" FT /db_xref="InterPro:IPR011006" FT /db_xref="UniProtKB/TrEMBL:Q0PBM2" FT /inference="protein motif:Pfam:PF00512" FT /inference="protein motif:Pfam:PF00072" FT /protein_id="CAL34437.1" FT /translation="MEDMQEILEDFLVEAFELVEQIDHDLVELESNPEDLELLNRIFRV FT AHTVKGSSSFLNFDVLTKLTHHMEDVLNKARHGELKITPDIMDVVLESIDRMKTLLNSI FT RDNGNDTAIGMDIEPICARLTAISEGESPVVATDSNEKSIPQAELEAPKQEIATPEPEV FT DVNQLSDSEVEAEIERLLKVRKAEDQARRAQKKQTTNAAPKPTNNTANKPTESGEKKVP FT ASGSNASSMDQTIRVEVKRLDHLMNLIGELVLGKNRLLKIYDDVEERYEGEKFLEELNQ FT VVSQLSIIITDVQLAVMKTRMQPIAKVFNKFPRVVRDLSRELGKQIELEITGEETELDK FT SIVEEIGDPIMHMIRNSCDHGVEDPATRAANGKPEKGIVQLKAYNEGNHIVVEITDDGK FT GLDPNGLKAKAIEKNLITEREADQMTDKEAFALIFKPGFSTAAKVTNVSGRGVGMDVVK FT TNIEKLNGVIEIDSELGKGSSFKLKIPLTLAIIQSLLVGTQEEFYAIPLASVLETVRVP FT IDDIYTIEGKNVLRLRDEVLSLVRLSDVFGVKQVLESGDQTYVVVIGVAESKLGIIVDT FT LVGQEEIVIKSMGDYLQNIQGIAGATIRGDGRVTLIIDVGAMMDMAKEIKVDIKAQLES FT SAKKPKEQPSDYKVLIVDDSKMDRTLMQKALEPLGVSLIEATNGVEALNIIKSGEHDID FT AMLIDIEMPRMDGYTLAGEIRKYSKYRNLPLIAVTSRTSKTDRLRGVEVGMTEYITKPY FT SPEYLENVVRKNLKLG" FT misc_feature complement(260907..261275) FT /note="HMMPfam hit to PF00072, Response regulator receiver FT domain, score 4.4e-25" FT /inference="protein motif:Pfam:PF00072" FT misc_feature complement(260925..261002) FT /note="PS00217 Sugar transport proteins signature 2" FT /inference="protein motif:Prosite:PS00217" FT misc_feature complement(261345..261740) FT /note="HMMPfam hit to PF01584, CheW-like domain, score FT 1.8e-28" FT /inference="protein motif:Pfam:PF01584" FT misc_feature complement(261753..262181) FT /note="HMMPfam hit to PF02518, Histidine kinase-, DNA FT gyrase B-, and HS, score 3.2e-28" FT /inference="protein motif:Pfam:PF02518" FT misc_feature complement(262314..262520) FT /note="HMMPfam hit to PF02895, Signal transducing histidine FT kinase, hom, score 3.7e-24" FT /inference="protein motif:Pfam:PF02895" FT misc_feature complement(262893..263198) FT /note="HMMPfam hit to PF01627, Hpt domain, score 5.4e-17" FT /inference="protein motif:Pfam:PF01627" FT CDS complement(263217..264173) FT /transl_table=11 FT /gene="cheV" FT /locus_tag="Cj0285c" FT /product="chemotaxis protein" FT /EC_number="2.7.3.-" FT /note="Original (2000) note: Cj0285c, cheV, probable FT chemotaxis protein cheV, len: 318 aa; similar to e.g. FT CHEV_BACSU chemotaxis cheV protein (EC 2.7.3.-) (303 FT aa),fasta scores; opt: 414 z-score: 344.9 E(): 5.9e-12, FT 28.2% identity in 309 aa overlap. 50.8% identity to HP0393. FT Contains Pfam match to entry PF00072 response_reg,Response FT regulator receiver domain, score 50.70, E-value 3.1e-11" FT /note="Updated (2006) note: Pfam domain PF01584 CheW-like FT domain identified within CDS. Further support given to FT product function. Characterised within Bacillus subtilis FT with marginal identity score. Putative not added to product FT function. Functional classification - Chemotaxis and FT mobility" FT /note="PMID:8169223, PMID:8169224" FT /db_xref="GOA:Q0PBM1" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR002545" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR024181" FT /db_xref="UniProtKB/TrEMBL:Q0PBM1" FT /inference="protein motif:Pfam:PF01584" FT /inference="protein motif:Pfam:PF00072" FT /protein_id="CAL34438.1" FT /translation="MFDENIVKTGSNEMELVDFRIFKQGHDKVYEGIYGVNVSKVREII FT KIPSLTELPGVPDYIEGIFDLRGVVIPVVNLAKWMQITEPESTMLKPRVIITEFSNILI FT GFIVHEAKRIRRINWKDIEPATFSTGSGALDKGKITGVTRIENDEVLLILDLESVVEDL FT GIYAPKTDIDFGKIEKFTGTALILDDSMTARKRVKEMMQQMGFQVVEAKDGVEGINKLE FT ELSQIYGESLNDTLKIIVSDVEMPQMDGFHFAARIKEDPRFKDIPIVFNSSLSNEFMNE FT KGVQEAGGEGYLVKFNASDFFNEIAKVIKKHQSQEQG" FT misc_feature complement(263235..263630) FT /note="HMMPfam hit to PF00072, Response regulator receiver FT domain, score 4.1e-15" FT /inference="protein motif:Pfam:PF00072" FT misc_feature complement(263682..264083) FT /note="HMMPfam hit to PF01584, CheW-like domain, score FT 1.6e-28" FT /inference="protein motif:Pfam:PF01584" FT CDS complement(264166..264783) FT /transl_table=11 FT /locus_tag="Cj0286c" FT /product="hypothetical protein Cj0286c" FT /note="Original (2000) note: Cj0286c, unknown, len: 205 aa; FT 28.4% identity to HP0394 (252 aa). Functional FT classification - Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PBM0" FT /protein_id="CAL34439.1" FT /translation="MLIGEISATHEFAKPYIELLEELALKIEIIYLEGNHDFNLSCFFK FT RVKIFNLQEQPIKLNLHTSKGNNLVLNSAFIKLAHGDIFLPPLLQFTLKTLRNHYLLVF FT LNFLNIITRNFISNKILQNQNKKNLFYQIKDFENLAKKRYEKYENLGFWVCEGHYHQNH FT QINKENIKYLNLASFAYERSFFVVEYQQEIKFREQKLRGQNV" FT CDS complement(264934..265419) FT /transl_table=11 FT /gene="greA" FT /locus_tag="Cj0287c" FT /product="transcription elongation factor" FT /note="Original (2000) note: Cj0287c, greA, probable FT transcription elongation factor, len: 161 aa; similar to FT many e.g. GREA_ECOLI transcription elongation factor greA FT (158 aa), fasta scores; opt: 448 z-score: 810.6 E(): FT 0,43.9% identity in 157 aa overlap. 57.8% identity to FT HP0866. Contains PS00829 and PS00830 Prokaryotic FT transcription elongation factors signatures 1 and 2, and FT Pfam match to entry PF01272 GreA_GreB, Prokaryotic FT transcription elongation factor, GreA and GreB, score FT 262.10, E-value 7.6e-75" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -RNA synthesis, RNA modification and DNA transcription" FT /note="PMID:2243801, PMID:7854424" FT /db_xref="GOA:Q9PIK9" FT /db_xref="InterPro:IPR001437" FT /db_xref="InterPro:IPR006359" FT /db_xref="InterPro:IPR018151" FT /db_xref="InterPro:IPR022691" FT /db_xref="InterPro:IPR023459" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIK9" FT /inference="protein motif:Pfam:PF01272" FT /inference="protein motif:Prosite:PS00830" FT /inference="protein motif:Prosite:PS00829" FT /protein_id="CAL34440.1" FT /translation="MQKEPMSQFGYDKLAAELKDLKDNQRPAVVIEIDTARSHGDLKEN FT AEYHAAREKQALIESRIAELSDLLARAQVIDPSSYEHDSVKFGSSVVIMDLDTEKESKY FT TLVGICEGNLDKGYISIASPIAKAMLGKKEGDDFKVRLPKGESEFEILSINYEPLKF" FT misc_feature complement(264952..265182) FT /note="HMMPfam hit to PF01272, Prokaryotic transcription FT elongation fact, score 3.2e-27" FT /inference="protein motif:Pfam:PF01272" FT misc_feature complement(265012..265062) FT /note="PS00830 Prokaryotic transcription elongation factors FT signature 2" FT /inference="protein motif:Prosite:PS00830" FT misc_feature complement(265198..265419) FT /note="HMMPfam hit to PF03449, Prokaryotic transcription FT elongation fact, score 1.4e-37" FT /inference="protein motif:Pfam:PF03449" FT misc_feature complement(265276..265401) FT /note="PS00829 Prokaryotic transcription elongation factors FT signature 1" FT /inference="protein motif:Prosite:PS00829" FT CDS complement(265431..266525) FT /transl_table=11 FT /gene="lpxB" FT /locus_tag="Cj0288c" FT /product="lipid-A-disaccharide synthase" FT /EC_number="2.4.1.182" FT /note="Original (2000) note: Cj0288c, lpxB, probable FT lipid-A-disaccharide synthase, len: 364 aa; similar to e.g. FT LPXB_ECOLI lipid-A-disaccharide synthase (EC 2.4.1.182) FT (382 aa), fasta scores; opt: 153 z-score: 432.6 E(): FT 7.7e-17, 27.7% identity in 343 aa overlap. 42.8% identity FT to HP0867" FT /note="Updated (2006) note: Pfam domain PF02684 FT Lipid-A-disaccharide synthetase identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli with marginal identity score. FT Putative not added to product function. Functional FT classification - Surface FT polysaccharides,lipopolysaccharides and antigens" FT /note="PMID:3316192, PMID:3531165" FT /db_xref="GOA:Q9PIK8" FT /db_xref="InterPro:IPR003835" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIK8" FT /inference="protein motif:Pfam:PF02684" FT /protein_id="CAL34441.1" FT /translation="MKTFLVCALEPSANLHLKEVLKAYKKDFGEFELHGIYDESLCKEF FT DLNSKPLYSSHEFSAMGFIEVLPLIFKAKKAIKELANLSFTQKINGILCIDSPAFNIPF FT AKALKKAGSKIPRIYYILPQVWAWKKGRIPIIESHFDILASILPFDNQFFNKSTYIGHP FT LLDEIKEFKNQEDINHTFSKKDDEKTIAFLPGSRRSEIRRLMPIFKELSQKFKGKKILC FT VPSFNLEKLEVYGDISEFKIESNTPKVLKKADFAFICSGTATLEAALVGTPFVLAYKAK FT AIDIFIAKLFVKLKHIGLANIFCDFAGKEALNPEFLQDKVNVLNLYEAYNKYDYKAFFA FT KVDFLKEYLQFGSAKNLAKILNEI" FT misc_feature complement(265452..266516) FT /note="HMMPfam hit to PF02684, Lipid-A-disaccharide FT synthetase, score 4.7e-81" FT /inference="protein motif:Pfam:PF02684" FT CDS complement(266622..267374) FT /transl_table=11 FT /gene="peb3" FT /locus_tag="Cj0289c" FT /product="major antigenic peptide PEB3" FT /note="Original (2000) note: Cj0289c, peb3, major antigenic FT peptide PEB3, len: 250 aa; 94.9% identical to TR:G234575, FT sequenced by direct peptide sequencing; see: Pei at al. J. FT Biol. Chem. 266:16363-16369 (1991). Also similar to FT TR:Q57410 (EMBL:U39068) Vibrio cholerae accessory FT colonization factor acfC (253 aa), fasta scores; opt: 855 FT z-score: 1301.2 E(): 0, 53.6% identity in 239 aa overlap FT and TR:P96759 (EMBL:U82533) anm (E. coli 045 attachment and FT effacement negative mutant) (251 aa), fasta scores; opt: FT 849 z-score: 824.0 E(): 0, 51.8% identity in 251 aa FT overlap. No Hp match. Also similar to Cj0778 (peb2) (32.4% FT identity in 256 aa overlap). Contains N-terminal signal FT sequence" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Paper identified linking protein to FT glycoprotein (PMID:12186869). Functional classification FT -Miscellaneous periplasmic proteins" FT /note="PMID:1885571, PMID:12186869" FT /db_xref="PDB:2HXW" FT /db_xref="PDB:3FIR" FT /db_xref="PDB:3FJ7" FT /db_xref="PDB:3FJG" FT /db_xref="PDB:3FJM" FT /db_xref="UniProtKB/TrEMBL:Q0PBL7" FT /protein_id="CAL34442.1" FT /translation="MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKT FT GVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAII FT LTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNN FT IVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEG FT ASKETQDFIAYLSSKEAKEIFKKYGWRE" FT sig_peptide complement(267315..267374) FT /note="Signal peptide predicted for peb3 by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.789 between residues 20 and 21" FT CDS complement(join(267516..267629,267638..268597, FT 268591..268809)) FT /pseudo FT /transl_table=11 FT /gene="glpT" FT /locus_tag="Cj0292c" FT /product="pseudogene (putative glycerol-3-phosphate FT transporter)" FT /note="Original (2000) note: Cj0290c, probable pseudogene FT representing the C-terminus of Cj0291c (glpT')" FT /note="Original (2000) note: Cj0292c, probable pseudogene FT representing the N-terminus of Cj0291c (glpT')" FT /note="Original (2000) note: Cj0291c, FT glpT',glycerol-3-phosphate transporter, possible FT pseudogene,len: 319 aa; similar to the central region of FT many e.g. GLPT_ECOLI glycerol-3-phosphate transporter (452 FT aa),fasta scores; opt: 473 z-score: 832.3 E(): 0, 35.3% FT identity in 323 aa overlap. No Hp match. Contains PS00942 FT glpT family of transporters signature. Note that the FT N-terminal 100 aa and the C-terminal 50 aa present in other FT glpT proteins are out of frame, and are represented by the FT CDSs Cj0292c and Cj0290c respectively. The sequence has FT been checked, and is believed to be correct" FT /note="Updated (2006) note: Pfam domain PF07690 Major FT Facilitator Superfamily identified within CDS. Also,twelve FT probable transmembrane helices predicted by TMHMM2.0. FT Further support given to product function. Coding sequence FT has been updated to reflect the complete amino acid FT sequence for the encoded protein regardless of its FT expression. This will cause differences from the amino acid FT sequence of the previous annotation. Functional FT classification - Transport/binding proteins -Carbohydrates, FT organic acids and alcohols" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF07690" FT /inference="protein motif:Prosite:PS00942" FT misc_feature complement(join(268717..268785,268621..268689, FT 268535..268597,268591..268597,268457..268525, FT 268328..268396,268232..268285,268010..268078, FT 267908..267967,267821..267889,267740..267808, FT 267659..267727,267540..267608)) FT /note="12 probable transmembrane helices predicted for FT Cj0292c by TMHMM2.0 at aa 9-31, 41-63, 72-94, FT 98-120,141-163, 178-195, 247-269, 284-303, 310-332, FT 337-359,364-386 and 401-423" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(join(268591..268785,267638..268597, FT 267627..267629)) FT /note="HMMPfam hit to PF07690, Major Facilitator FT Superfamily, score 1.8e-34" FT /inference="protein motif:Pfam:PF07690" FT CDS 269064..269840 FT /transl_table=11 FT /gene="surE" FT /locus_tag="Cj0293" FT /product="multifunctional protein SurE homolog" FT /EC_number="3.1.3.5" FT /note="Original (2000) note: Cj0293, surE, SurE protein FT homolog, len: 258 aa; similar to e.g. SURE_ECOLI survival FT protein surE (253 aa), fasta scores; opt: 515 z-score: FT 776.1 E(): 0, 37.4% identity in 254 aa overlap. 46.0% FT identity to HP0930" FT /note="Updated (2006) note: Pfam domain PF01975 Survival FT protein SurE identified within CDS. Further support given FT to product function. Characterisation work carried out FT within Escherichia coli with acceptable identity score. FT Product function modified based on characterisation paper FT (PMID:15489502). Functional classification - Adaptions and FT atypical conditions" FT /note="PMID:15489502" FT /db_xref="GOA:Q9PIK6" FT /db_xref="InterPro:IPR002828" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIK6" FT /inference="protein motif:Pfam:PF01975" FT /protein_id="CAL34444.1" FT /translation="MKEILITNDDGYESEGLKKLIKMLTKEFKAKITIVAPASEKSACS FT HSITLTKPLRFVKVGKRFYKLDDGTPADCVYLALHALYKKRLPDLVISGINKGANVGED FT ITYSGTCAGAMEAVLQGIPAIALSQFYKKSEKELDYKNALQITKKIIQNIFDKGFPLEK FT KEFLNINFPAKSKIKGIKICKAGKRVYNFEAHSNVNPRGVEYYWLAAANLDFEDEKNSD FT IALLKKGYATITPIMLDLTAYERMKKVKKWLKANDE" FT misc_feature 269067..269645 FT /note="HMMPfam hit to PF01975, Survival protein SurE,score FT 3.9e-78" FT /inference="protein motif:Pfam:PF01975" FT CDS 269830..270489 FT /transl_table=11 FT /locus_tag="Cj0294" FT /product="putative MoeB/ThiF family protein" FT /note="Original (2000) note: Cj0294, unknown, len: 219 aa; FT similar to members of the hesA/moeB/thiF family, e.g. FT YGDL_ECOLI (268 aa), fasta scores; opt: 219 z-score: 563.3 FT E(): 4e-24, 33.5% identity in 254 aa overlap. 48.3% FT identity to HP0755 (described as moeB). Contains Pfam match FT to entry PF00899 ThiF_family, ThiF family, score 33.10, FT E-value 2e-07. Also similar to Cj1046c (33.6% identity in FT 146 aa overlap)" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores carried out yet. Putative FT kept within product function. Functional classification FT -Misc" FT /db_xref="GOA:Q0PBL5" FT /db_xref="InterPro:IPR000594" FT /db_xref="InterPro:IPR009036" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:Q0PBL5" FT /inference="protein motif:Pfam:PF00899" FT /protein_id="CAL34445.1" FT /translation="MMNDRFTRIKWLVGEEKFQKISQTKVLVCGLGGVGGICVDALYRS FT GFKNLTLIDADKFEITNQNRQIHSENIGEEKAKVFERIYKVKGIVSKIDENFLKNFDLS FT EFDLIIDAIDDIPAKVALAHLIDFKKQIFISSTGGARKLDPTRIKTTSIFKTHGDALAK FT KFRYELRKSGFKGNFDVVFSDEEAHCKDLGSFMGVTASFGLALASLALRKVLAKKS" FT misc_feature 269893..270273 FT /note="HMMPfam hit to PF00899, ThiF family, score 1.3e-09" FT /inference="protein motif:Pfam:PF00899" FT misc_feature 269905..269958 FT /note="1 probable transmembrane helix predicted for Cj0294 FT by TMHMM2.0 at aa 26-43" FT /inference="protein motif:TMHMM:2.0" FT CDS 270473..270931 FT /transl_table=11 FT /locus_tag="Cj0295" FT /product="putative acetyltransferase" FT /EC_number="2.3.1.-" FT /note="Original (2000) note: Cj0295, possible FT acetyltransferase, len: 152 aa; similar to hypothetical FT proteins e.g. YAFP_ECOLI (150 aa), fasta scores; opt: 246 FT z-score: 340.4 E(): 1.1e-11, 27.8% identity in 144 aa FT overlap. No Hp match. Contains Pfam match to entry PF00583 FT Acetyltransf, Acetyltransferase (GNAT) family, score 20.20, FT E-value 0.011" FT /note="Updated (2006) note: Some characterisation within FT Escherichia coli with marginal identity score. Putative FT kept within product function. Functional classification FT -Misc" FT /db_xref="GOA:Q0PBL4" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:Q0PBL4" FT /inference="protein motif:Pfam:PF00583" FT /protein_id="CAL34446.1" FT /translation="MLRKADIKDLNACLSLFEQSVKTLCAKDYTKDQICAWIKIDRQQW FT EEKFKYDEIFVYEKRGKIASFISVKQEQKLLDLLFTHPDFVRQGLAQNLLDFILKTYLH FT NEIYTFASLSAKDFFLKNGFELIRENKVIKEGQNLKKILMKKDVIYKN" FT misc_feature 270635..270847 FT /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT) FT family, score 1.2e-07" FT /inference="protein motif:Pfam:PF00583" FT stem_loop 270978..271021 FT CDS complement(271041..271421) FT /transl_table=11 FT /gene="panD" FT /locus_tag="Cj0296c" FT /product="aspartate 1-decarboxylase precursor" FT /EC_number="4.1.1.11" FT /note="Original (2000) note: Cj0296c, panD, probable FT aspartate 1-decarboxylase precursor, len: 126 aa; similar FT to many e.g. PAND_ECOLI aspartate 1-decarboxylase precursor FT (EC 4.1.1.11) (126 aa), fasta scores; opt: 317 z-score: FT 486.9 E(): 7.3e-20, 48.2% identity in 110 aa overlap. 52.3% FT identity to HP0034" FT /note="Updated (2006) note: Pfam domain PF02261 Aspartate FT decarboxylase was identified within CDS. Further support FT given to product function. Characterised within Escherichia FT coli with acceptable identity scores. Putative not added to FT product function. Functional classification -Biosynthesis FT of cofactors, prosthetic groups and carriers - FT Pantothenate" FT /note="PMID:14633979, PMID:8837478" FT /db_xref="GOA:Q9PIK3" FT /db_xref="InterPro:IPR003190" FT /db_xref="InterPro:IPR009010" FT /db_xref="PDB:3PLX" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIK3" FT /inference="protein motif:Pfam:PF02261" FT /protein_id="CAL34447.1" FT /translation="MNITLLKSKIHRASVTEARLDYIGSISIDEKLLQASGILEYEKVQ FT VVNVNNGARFETYTIATQEEGVVCLNGAAARLAEVGDKVIIMSYADFNEEEAKTFKPKV FT VFVDENNTATKITNYEKHGAIF" FT misc_feature complement(271077..271421) FT /note="HMMPfam hit to PF02261, Aspartate FT decarboxylase,score 1.5e-61" FT /inference="protein motif:Pfam:PF02261" FT CDS complement(271418..272266) FT /transl_table=11 FT /gene="panC" FT /locus_tag="Cj0297c" FT /product="pantoate--beta-alanine ligase" FT /EC_number="6.3.2.1" FT /note="Original (2000) note: Cj0297c, panC, probable FT pantoate--beta-alanine ligase, len: 282 aa; similar to many FT e.g. PANC_ECOLI pantoate--beta-alanine ligase (EC 6.3.2.1) FT (283 aa), fasta scores; opt: 688 z-score: 1023.1 E(): 0, FT 41.0% identity in 283 aa overlap. 42.9% identity to HP0006" FT /note="Updated (2006) note: Pfam domain PF02569 FT Pantoate-beta-alanine ligase was identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli with acceptable identity score. FT Putative not added to product function. Functional FT classification - Biosynthesis of cofactors, prosthetic FT groups and carriers - Pantothenate" FT /note="PMID:11377204, PMID:8837478" FT /db_xref="GOA:Q9PIK2" FT /db_xref="InterPro:IPR003721" FT /db_xref="InterPro:IPR014729" FT /db_xref="PDB:3MXT" FT /db_xref="PDB:3UY4" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIK2" FT /inference="protein motif:Pfam:PF02569" FT /protein_id="CAL34448.1" FT /translation="MQVITSVKEAKQIVKDWKSHQLSIGYVPTMGFLHDGHLSLVKHAK FT TQDKVIVSIFVNPMQFGPNEDFSSYPRDLERDIKMCQDNGVDMVFIPDATQMYLKNFST FT YVDMNTITDKLCGAKRPGHFRGVCTVLTKFFNILNPDIVYMGQKDAQQCVVVRHMVDDL FT NFDLKIQICPIIREEDGLAKSSRNVYLSKEERKASLAISQSIFLAEKLVREGEKNTSKI FT IQAMKDILEKEKLIKIDYIELVDFNTMENIENITDNVLGAVAAFVGKTRLIDNFLVQGL FT K" FT misc_feature complement(271433..272266) FT /note="HMMPfam hit to PF02569, Pantoate-beta-alanine FT ligase, score 4.1e-137" FT /inference="protein motif:Pfam:PF02569" FT CDS complement(272277..273101) FT /transl_table=11 FT /gene="panB" FT /locus_tag="Cj0298c" FT /product="3-methyl-2-oxobutanoate hydroxymethyltransferase" FT /EC_number="2.1.2.11" FT /note="Original (2000) note: Cj0298c, panB, probable FT 3-methyl-2-oxobutanoate hydroxymethyltransferase, len: 274 FT aa; similar to many e.g. PANB_ECOLI 3-methyl-2-oxobutanoate FT hydroxymethyltransferase (EC 2.1.2.11) (264 aa), fasta FT scores; opt: 752 z-score: 1038.6 E(): 0, 43.0% identity in FT 265 aa overlap. 43.9% identity to HP1058" FT /note="Updated (2006) note: Pfam domain PF02548 FT Ketopantoate hydroxymethyltransferase was identified within FT CDS. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Putative not added to product function. FT Functional classification - Biosynthesis of FT cofactors,prosthetic groups and carriers - Pantothenate" FT /note="PMID:8096212, PMID:8837478" FT /db_xref="GOA:Q9PIK1" FT /db_xref="InterPro:IPR003700" FT /db_xref="InterPro:IPR015813" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIK1" FT /inference="protein motif:Pfam:PF02548" FT /protein_id="CAL34449.1" FT /translation="MRKSMISFLEKKAKNEKITMVSAYDYHSARILDNSDIDIILVGDS FT LAMTVLGMQDTLSVTMDEMLIFTKAVSRGAKKSFVLADMPFMSYQSSDRDAILNASRFI FT KESHANGVKVEGGIEIASKIKLISQSGIPVVAHLGLTPQAVNMLGGYRVQGKDLQSAQK FT IIDDAKAVQDAGACMLVLECVPVKLAQKISSILEIPTIGIGSGKYCDGQVLVYHDLLGL FT NKDFKAKFVKHFDKIDPQVGVEKYRDEVKSGIFPSQEHSFDYLDDELLDKLY" FT misc_feature complement(272325..273098) FT /note="HMMPfam hit to PF02548, Ketopantoate FT hydroxymethyltransferase, score 8.3e-137" FT /inference="protein motif:Pfam:PF02548" FT CDS 273321..274094 FT /transl_table=11 FT /locus_tag="Cj0299" FT /product="putative periplasmic beta-lactamase" FT /EC_number="3.5.2.6" FT /note="Original (2000) note: Cj0299, possible periplasmic FT beta-lactamase, len: 257 aa; similar to members of the FT class-D beta-lactamase family e.g. BLL1_PSEAE FT BETA-LACTAMASE LCR-1 PRECURSOR (EC 3.5.2.6) (Pseudomonas FT aeruginosa plasmid PMG76) (260 aa), fasta scores; opt: 423 FT z-score: 305.2 E(): 9.6e-10, 33.7% identity in 255 aa FT overlap. No Hp match. Contains N-terminal signal sequence" FT /note="Updated (2006) note: Some characterisation work FT within Pseudomonas aeruginosa and Escherichia coli with FT marginal identity scores. Putative kept within product FT function. Functional classification - Antibiotic FT resistance" FT /note="PMID:11188693, PMID:7574536" FT /db_xref="GOA:Q0PBL0" FT /db_xref="InterPro:IPR001460" FT /db_xref="InterPro:IPR012338" FT /db_xref="UniProtKB/TrEMBL:Q0PBL0" FT /protein_id="CAL34450.1" FT /translation="MKKITLFLLFLNLVFGQDKILNNWFKEYNTSGTFVFYDGKTWASN FT DFSRAMETFSPASTFKIFNALIALDSGVIKTKKEIFYHYRGEKVFLSSWAQDMNLSSAI FT KYSNVLAFKEVARRIGIKTMQEYLNKLHYGNAKISKIDTFWLDNSLKISAKEQAILLFR FT LSQNSLPFSQEAMNSVKEMIYLKNMENLELFGKTGFNDEQKIAWIVGFVYLKDENKYKA FT FALNLDIDKFEDLYKREKILEKYLDELVKKVKNDG" FT misc_feature 273414..274061 FT /note="HMMPfam hit to PF00905, Penicillin binding protein FT transpeptid, score 1.3e-33" FT /inference="protein motif:Pfam:PF00905" FT CDS complement(274179..275063) FT /transl_table=11 FT /gene="modC" FT /locus_tag="Cj0300c" FT /product="putative molybdenum transport ATP-binding FT protein" FT /note="Original (2000) note: Cj0300c, modC, probable FT molybdenum transport ATP-binding protein, len: 294 aa; FT similar to many ABC-transporter ATP binding proteins, and FT to MODC_ECOLI molybdenum transport ATP-binding protein (352 FT aa), fasta scores; opt: 487 z-score: 700.9 E(): 8.7e-32, FT 34.8% identity in 270 aa overlap. Identification as modC is FT based on presence of probable molybdenum-specific permease FT and periplasmic binding proteins upstream. 46.8% identity FT to HP0475. Contains PS00017 ATP/GTP-binding site motif A FT (P-loop), PS00211 ABC transporters family signature and FT Pfam match to entry PF00005 ABC_tran, ABC transporters, FT score 214.40, E-value 1.7e-60" FT /note="Updated (2006) note: Characterised more than once FT within Escherichia coli with marginal identity scores. FT Putative kept within product function. Functional FT classification - Transport/binding proteins - Anions" FT /note="PMID:2188958, PMID:7665461, PMID:7665460" FT /db_xref="GOA:Q0PBK9" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/TrEMBL:Q0PBK9" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34451.1" FT /translation="MIRIDINHPMNTAKGRLDLNFKKDIESGKITALFGESGAGKTTLL FT KIIAGLIKPKLGRIEVDNELWFDSSKNFSLALQKRKIGFVFQDYALFPNMNIKENIAYA FT ASSKAKVSELLALMKLENLAKIYPKHLSGGQAQRVALARALAREPKILLLDEPLSALDF FT KMRANLQDELTKILEYFKISTLLVSHDLAEIYKLSHRILELKNGKIIKDFPKNEFFTHS FT NISAKLRLSATLLEIKKSDILVVLTLLLNQDIIKITLSEEEFLKAYQDVKIGDTLLLSI FT KAFNPIIVGKLDK" FT misc_feature complement(274443..274982) FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 6e-62" FT /inference="protein motif:Pfam:PF00005" FT misc_feature complement(274629..274673) FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature complement(274938..274961) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(275060..275734) FT /transl_table=11 FT /gene="modB" FT /locus_tag="Cj0301c" FT /product="putative molybdenum transport system permease FT protein" FT /note="Original (2000) note: Cj0301c, modB, probable FT molybdenum transport system permease protein, len: 224 aa; FT similar to e.g. MODC_AZOVI molybdenum transport system FT permease protein (226 aa), fasta scores; opt: 562 z-score: FT 889.7 E(): 0, 43.3% identity in 210 aa overlap and FT MODB_ECOLI (229 aa), fasta scores; opt: 390 z-score: 537.4 FT E(): 1.1e-22, 32.8% identity in 183 aa overlap. 55.2% FT identity to HP0474. Contains PS00017 ATP/GTP-binding site FT motif A (P-loop) and Pfam match to entry PF00528 FT BPD_transp, Binding-protein-dependent transport systems FT inner membrane component, score 43.10, E-value 6.1e-09" FT /note="Updated (2006) note: Characterised in many e.g. FT Rhodobacter capsulatus and Azotobacter vinelandii with FT acceptable identity scores. Putative kept within product FT function. Functional classification - Transport/binding FT proteins - Anions" FT /note="PMID:8384683, PMID:8491722" FT /db_xref="GOA:Q0PBK8" FT /db_xref="InterPro:IPR000515" FT /db_xref="InterPro:IPR011867" FT /db_xref="UniProtKB/TrEMBL:Q0PBK8" FT /inference="protein motif:Pfam:PF00528" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34452.1" FT /translation="MLDPAFLQTLYLTFKLAFITTFILFFIGVFLAYLLSFVRFPFKTI FT LQSFISLPLILPPSVLGFYLLVTFSANSFLGQVLKEYFNLSLVFSFEGLVFASLIFSLP FT FMVNPLQSAFSSINPNLLDASYSLGKSKIYTLFRVILPNSKAGIFSACAMSFAHTVGEF FT GVVMMIGGHKQGETLVASIAIYDELEILNYSLAHQYAFILFIFSFLVLFSLYFINKKMS FT FQ" FT misc_feature complement(275066..275719) FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 8.6e-19" FT /inference="protein motif:Pfam:PF00528" FT misc_feature complement(join(275624..275692,275522..275590, FT 275411..275479,275228..275296,275084..275152)) FT /note="5 probable transmembrane helices predicted for FT Cj0301c by TMHMM2.0 at aa 15-37, 49-71, 86-108, 147-169 and FT 195-217" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(275342..275365) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(275727..276128) FT /transl_table=11 FT /locus_tag="Cj0302c" FT /product="putative molybdenum-pterin binding protein" FT /note="Original (2000) note: Cj0302c, unknonw, len: 133 aa; FT no Hp match" FT /note="Updated (2006) note: Pfam domain PF03459 TOBE domain FT identified within CDS. TOBE (Transport-associated OB) has FT had work carried out within Esherichia coli where it has FT been shown to be involved in the recognition of small FT ligands such as molybdenum. TOBE has been found in ABC FT transporters immediately after the ATPase domain. A child FT process of this family is Molybdenum-pterin binding FT protein. Product modified to more specific family member FT based on motif match. Some characterisation work within FT Clostridium pasteurianum, however, identity scores were FT marginal and full length sequence alignment was not FT achieved. Functional classification - Miscellaneous FT periplasmic proteins" FT /note="PMID:3540853, PMID:2820842" FT /db_xref="GOA:Q0PBK7" FT /db_xref="InterPro:IPR008995" FT /db_xref="UniProtKB/TrEMBL:Q0PBK7" FT /inference="protein motif:Pfam:PF03459" FT /protein_id="CAL34453.1" FT /translation="MNLIKGQICELLNQEDIVIVKILSKEVIFSVLMLELKSLENLKIG FT VSVELLFKEHELCFSASKTLLSVENSFLAKITKIKKGKLLYQVFFDFKGNELSSIITKE FT KALELEICENQEWLCFVKANDIVLRSHSA" FT misc_feature complement(275745..275933) FT /note="HMMPfam hit to PF03459, TOBE domain, score 4.6e-06" FT /inference="protein motif:Pfam:PF03459" FT CDS complement(276125..276874) FT /transl_table=11 FT /gene="modA" FT /locus_tag="Cj0303c" FT /product="putative molybdate-binding lipoprotein" FT /note="Original (2000) note: Cj0303c, modA, probable FT molybdate-binding lipoprotein, len: 249 aa; similar to e.g. FT MODA_RHOCA molybdate-binding periplasmic protein precursor FT (252 aa), fasta scores; opt: 354 z-score: 449.0 E(): FT 9.4e-18, 30.8% identity in 224 aa overlap, and MODA_ECOLI FT (257 aa), fasta scores; opt: 220 z-score: 245.4 E(): FT 2.1e-06, 25.0% identity in 232 aa overlap. 42.3% identity FT to HP0473. Contains probable N-terminal signal sequence FT with appropriately positioned PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site" FT /note="Updated (2006) note: Pfam domain PF01547 Bacterial FT extracellular solute-binding protein was identified within FT CDS. Further support given to product function. FT Characterised in more than one genus e.g. Rhodobacter FT capsulatus, Azotobacter vinelandii and Escherichia coli. FT Identity scores were marginal and sequence alignment was FT not full length. Putative kept within product function. FT Functional classification - Transport/binding proteins FT -Anions" FT /note="PMID:8491722, PMID:8384683, PMID:8564363" FT /db_xref="GOA:Q0PBK6" FT /db_xref="InterPro:IPR005950" FT /db_xref="InterPro:IPR006059" FT /db_xref="UniProtKB/TrEMBL:Q0PBK6" FT /inference="protein motif:Pfam:PF01547" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34454.1" FT /translation="MKKFVVFFGILLFVSCLNAQNLSIFVASSASKAMSEVKDEFLKTH FT PEDKIELVFGASGKYYELLKQGREFDLFFSADTKYAKAIYDDKNALIKPKVYVLGVLAL FT YSLDENLLQGGVENLKEKANKITHLSIANPKVAPYGVAAKEVLENLGLNELLKDKIVLG FT ENISVPVLHVDSKNSDIAIVAYSLVSSINHPKGKAVIIDAKYFSPLEQSYVITKYAKDK FT KLAFEFNEFIGSSKAKEIFKKYGFSTP" FT misc_feature complement(276158..276865) FT /note="HMMPfam hit to PF01547, Bacterial extracellular FT solute-binding prot, score 4.2e-13" FT /inference="protein motif:Pfam:PF01547" FT sig_peptide complement(276776..276874) FT /note="Signal peptide predicted for modA by SignalP 2.0 HMM FT (Signal peptide probability 1.000) with cleavage site FT probability 0.426 between residues 33 and 34" FT misc_feature complement(276794..276862) FT /note="1 probable transmembrane helix predicted for Cj0303c FT by TMHMM2.0 at aa 5-27" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(276827..276859) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(276925..277611) FT /transl_table=11 FT /gene="bioC" FT /locus_tag="Cj0304c" FT /product="putative biotin synthesis protein" FT /note="Original (2000) note: Cj0304c, bioC, possible biotin FT synthesis protein, len: 228 aa; similar to BIOC_HAEIN FT putative biotin synthesis protein bioC (260 aa), fasta FT scores; opt: 342 z-score: 595.7 E(): 6.4e-26,34.0% identity FT in 238 aa overlap. Also some similarity to BIOC_ECOLI (251 FT aa), wublastp scores; E= 0.00028, 24% identity in 193 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Some characterisation within FT Bacillus subtilis and Escherichia coli, however, identity FT scores were unnacceptable. Putative kept within product FT function. Functional classification - Biosynthesis of FT cofactors, prosthetic groups and carriers - Biotin" FT /note="PMID:3058702, PMID:8763940" FT /db_xref="GOA:Q0PBK5" FT /db_xref="InterPro:IPR011814" FT /db_xref="InterPro:IPR013216" FT /db_xref="UniProtKB/TrEMBL:Q0PBK5" FT /protein_id="CAL34455.1" FT /translation="MNFLKAKDYEKHAKVQDFMGLKLCEILKNLRISHFEKVFEFGCGR FT GELSKKLQNFITFDEYLKNDILDFKENSSILIFDMNEIAKQDLSKEKFDLIVSNATLQW FT LDLKRIIPSLRDMLNQNGILLLSTFAEQNLKEIKQSTGFGLNYFSLNELEQIFKVYFNE FT VKITQELIKLSFDNALDVFRHLKLSGVNSLGFYPLNKGFLKEFEEKFQNKLTYHPVFIL FT CKNDIK" FT CDS complement(277608..278219) FT /transl_table=11 FT /locus_tag="Cj0305c" FT /product="conserved hypothetical protein Cj0305c" FT /note="Original (2000) note: Cj0305c, unknown, len: 203 aa; FT similar to a hypothetical protein from H. infuenzae FT YF52_HAEIN HI1552 (215 aa), fasta scores; opt: 297 z-score: FT 372.7 E(): 1.7e-13, 29.8% identity in 215 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam PF04301, Protein of FT unknown function (DUF452) was present within CDS. Conserved FT added to product function. Functional classification - FT Conserved hypothetical proteins" FT /db_xref="InterPro:IPR007398" FT /db_xref="UniProtKB/TrEMBL:Q0PBK4" FT /inference="protein motif:Pfam:PF04301" FT /protein_id="CAL34456.1" FT /translation="MKYEFLCKNPDSKKLIVVFGGFASHSSHFSHLKSDKNVILFYDYE FT NFDLNFDFKAFDELFLIAFSMGVCVANRLLKELNFKQKIAINGTNLGIDKSKGIHPAIF FT RKTLQNFKLENFKEALFKERKNLTKDFIFKDEKALKIELEKLFDFALVKQEENLLWDKV FT YSSKKDEIFPPNALKNAFSKLIFLNEPHFAFFHFKTWDEL" FT misc_feature complement(277611..278219) FT /note="HMMPfam hit to PF04301, Protein of unknown function FT (DUF452), score 2.5e-153" FT /inference="protein motif:Pfam:PF04301" FT CDS complement(278216..279358) FT /transl_table=11 FT /gene="bioF" FT /locus_tag="Cj0306c" FT /product="8-amino-7-oxononanoate synthase" FT /EC_number="2.3.1.47" FT /note="Original (2000) note: Cj0306c, bioF, probable FT 8-amino-7-oxononanoate synthase, len: 380 aa; similar to FT many e.g. BIOF_ECOLI 8-amino-7-oxononanoate synthase (EC FT 2.3.1.47) (384 aa), fasta scores; opt: 525 z-score: 550.3 FT E(): 2.1e-23, 28.9% identity in 387 aa overlap. 29.0% FT identity to HP0598. Contains PS00599 Aminotransferases FT class-II pyridoxal-phosphate attachment site and Pfam match FT to entry PF00222 aminotran_2, Aminotransferases class-II, FT score 196.30, E-value 4.7e-55" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity scores. Putative FT not added to product function. Functional classification FT -Biosynthesis of cofactors, prosthetic groups and carriers FT - Biotin" FT /note="PMID:9813126, PMID:1575677, FT PMID:1575677,PMID:3058702" FT /db_xref="GOA:Q0PBK3" FT /db_xref="InterPro:IPR001917" FT /db_xref="InterPro:IPR004839" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:Q0PBK3" FT /inference="protein motif:Pfam:PF00222" FT /inference="protein motif:Prosite:PS00599" FT /protein_id="CAL34457.1" FT /translation="MKLEKILQDLEQNHNLRTLTPLKHENKFVYKQDHKLLNLVGNDYL FT YLASSKELKAEFLNTLKEQDLFFSSSSSRSLSGNFEIYEKLESFLKTKFKDKEILHFNS FT GYHLNISCIAALSSVSKTLFLTDKFIHASMIDGLRLGRADFFRFHHKDMNHLESLIQKH FT YENYENIIVLSEALFSMDGDFSDFKTLCELKRRYDKIKLYIDEAHSVGCFDEEGLGLVK FT KLALENEVDFLVFTFGKALASMGACIICDEKYKKFFINKARAFIYSTALPPINVAWTQF FT IFKKMPYFKKEREKLELLSTFFKSKLQEKNHIVLGDAYIICLLLGENKKALEISQKLQK FT AGFFAPAIKEPTVPKNTARIRFSLHAGLNTEELERIIELL" FT misc_feature complement(278219..279097) FT /note="HMMPfam hit to PF00155, Aminotransferase class I and FT II, score 2e-07" FT /inference="protein motif:Pfam:PF00155" FT misc_feature complement(278624..278653) FT /note="PS00599 Aminotransferases class-II FT pyridoxal-phosphate attachment site" FT /inference="protein motif:Prosite:PS00599" FT CDS 279426..280709 FT /transl_table=11 FT /gene="bioA" FT /locus_tag="Cj0307" FT /product="adenosylmethionine-8-amino-7-oxononanoate FT aminotransferase" FT /EC_number="2.6.1.62" FT /note="Original (2000) note: Cj0307, bioA, probable FT adenosylmethionine-8-amino-7-oxononanoate aminotransferase, FT len: 427 aa; similar to many e.g. BIOA_ECOLI FT adenosylmethionine-8-amino-7-oxononanoate aminotransferase FT (EC 2.6.1.62) (429 aa), fasta scores; opt: 882 z-score: FT 1095.3 E(): 0, 35.8% identity in 411 aa overlap. 57.8% FT identity to HP0976. Contains PS00600 Aminotransferases FT class-III pyridoxal-phosphate attachment site and Pfam FT match to entry PF00202 aminotran_3,Aminotransferases FT class-III pyridoxal-phosphate, score 383.00, E-value FT 1.1e-132" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Biosynthesis of cofactors, prosthetic groups and carriers FT - Biotin" FT /note="PMID:3058702, PMID:10452893" FT /db_xref="GOA:Q0PBK2" FT /db_xref="InterPro:IPR005814" FT /db_xref="InterPro:IPR005815" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:Q0PBK2" FT /inference="protein motif:Pfam:PF00202" FT /inference="protein motif:Prosite:PS00600" FT /protein_id="CAL34458.1" FT /translation="MQNQILKNLDLKHIWHPCTQMKDHETLPLIPIKKAKGVWLYDFDD FT KAYMDCVSSWWVNLFGHCNEKIANAIKKQVDELEHVILAGFTHEPIIKLSARLCEKVGR FT NFNKCFYADNGSSAIEVALKMSFHYHLNKGVKKSKFLSLSNSYHGETLGALSVGDVALY FT KDTYKALLLECLSTPVPQGKDYTKELEILKDILEKNASEICAFILEPLVQCAGNMHMYE FT ARFIDEAIKLCHKFGVQVIFDEIAVGFGRTGTLFALHQCKQSPDFICLSKGITGGFMPL FT SVVLTRDEIYNAFYDTYESQKAFLHSHSYTGNTLACAAANAVLDIFEDENILVKNQILS FT EFIKKEFSRLEKFDFLGNFRTCGMISAFDILSTKYKRVGLFVFQKALEKGLLLRPLANT FT IYFMPPYIITKEQIVYVLESLEQIFKEF" FT misc_feature 279480..280706 FT /note="HMMPfam hit to PF00202, Aminotransferase FT class-III,score 4.3e-127" FT /inference="protein motif:Pfam:PF00202" FT misc_feature 280143..280256 FT /note="PS00600 Aminotransferases class-III FT pyridoxal-phosphate attachment site" FT /inference="protein motif:Prosite:PS00600" FT CDS complement(280696..281301) FT /transl_table=11 FT /gene="bioD" FT /locus_tag="Cj0308c" FT /product="putative dethiobiotin synthetase" FT /EC_number="6.3.3.3" FT /note="Original (2000) note: Cj0308c, bioD, possible FT dethiobiotin synthetase, len: 201 aa; some similarity to FT many e.g. BIOD_BACSH dethiobiotin synthetase (EC 6.3.3.3) FT (234 aa), fasta scores; opt: 206 z-score: 260.4 E(): 3e-07, FT 29.8% identity in 215 aa overlap. 31.8% identity in 66 aa FT overlap to HP0029" FT /note="Updated (2006) note: Some characterisation within FT Bacillus sphaericus, however, identity score was marginal. FT Putative kept within product function. Functional FT classification - Biosynthesis of cofactors, prosthetic FT groups and carriers - Biotin" FT /note="PMID:2110099, PMID:3058702, PMID:10455485" FT /db_xref="GOA:Q9PIJ1" FT /db_xref="InterPro:IPR004472" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIJ1" FT /protein_id="CAL34459.1" FT /translation="MQIYVSGIHTDVGKTHFSAAFCANFNYDYFKLIQAGTPTDSEFIA FT KFSPKTKIFKEGIFLQTPASPHLGKIKEKLDYKALDIILPKSKNLLIELAGGLFSPMDE FT NYTMIDFVNIFKHPTILVAKYYLGSINHILLSIEALKQRNINLLALVMMGKKDILQDDF FT IKNYAKIPIINLDFFDENSILNKDFKEQMQEILQLKIP" FT CDS complement(281311..281625) FT /transl_table=11 FT /locus_tag="Cj0309c" FT /product="putative efflux protein" FT /note="Original (2000) note: Cj0309c, probable efflux FT protein, len: 104 aa; similar to many membrane protein of FT known and unknown function e.g. TR:O34690 (EMBL:AJ002571) FT Bacillus subtilis YKKD (105 aa), fasta scores; opt: 303 FT z-score: 547.1 E(): 3.2e-23, 44.2% identity in 104 aa FT overlap, and EBR_STAAU ethidium bromide resistance protein FT (multidrug resistance protein) (107 aa), fasta scores; opt: FT 187 z-score: 272.5 E(): 6.4e-08, 27.2% identity in 103 aa FT overlap. No Hp match. Also similar to upstream CDS Cj0310c FT (32.4% identity in 105 aa overlap), and to Cj1174 (28.7% FT identity in 94 aa overlap) and Cj1173 (24.7% identity in 93 FT aa overlap). Contains Pfam match to entry PF00893 DUF7, FT Integral membrane protein, score 109.20,E-value 7.7e-29, FT and four possible transmembrane domains" FT /note="Updated (2006) note: Pfam domain PF00893 Small FT Multidrug Resistance (Smr) protein identified within CDS. FT Previously this was an uncharacterised Pfam domain. Smr FT proteins are a family of efflux proteins that confer FT resistance to a wide range of toxic compounds by removing FT them from the cells. Further support given to product FT function. Putative kept within product function. Functional FT classification - Drug/analogue sensitivity" FT /note="PMID:10735877, PMID:11566977" FT /db_xref="GOA:Q0PBK0" FT /db_xref="InterPro:IPR000390" FT /db_xref="UniProtKB/TrEMBL:Q0PBK0" FT /inference="protein motif:Pfam:PF00893" FT /protein_id="CAL34460.1" FT /translation="MEWFYLFLATACEIFGVVIMKELVSTKNKLYLLALIVCFGFSFTF FT LSLSMQNIAMSVAYAIWTGAGTAGGVMIGVLFYKESKSFLKLFLIAVIITCTAGLKFLS FT " FT misc_feature complement(join(281566..281619,281479..281538, FT 281392..281460,281317..281376)) FT /note="4 probable transmembrane helices predicted for FT Cj0309c by TMHMM2.0 at aa 3-20, 30-49, 56-78 and 84-103" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(281347..281625) FT /note="HMMPfam hit to PF00893, Small Multidrug Resistance FT protein, score 4.2e-30" FT /inference="protein motif:Pfam:PF00893" FT CDS complement(281629..281967) FT /transl_table=11 FT /locus_tag="Cj0310c" FT /product="putative efflux protein" FT /note="Original (2000) note: Cj0310c, possible efflux FT protein, len: 104 aa; similar to many membrane proteins of FT known and unknown function e.g. YKKC_BACSU (112 aa), fasta FT scores; opt: 273 z-score: 458.2 E(): 2.9e-18, 40.8% FT identity in 103 aa overlap, and EBR_STAAU ethidium bromide FT resistance protein (107 aa), fasta scores; opt: 135 FT z-score: 198.9 E(): 0.00088, 27.4% identity in 84 aa FT overlap. No Hp match. Also similar to downstream CDS FT Cj0309c (32.4% identity in 105 aa overlap) and to Cj1173 FT (27.1% identity in 107 aa overlap). Contains Pfam match to FT entry PF00893 DUF7, Integral membrane protein, score 51.40, FT E-value 2e-11, and four possible transmembrane domains" FT /note="Updated (2006) note: Pfam domain PF00893 Small FT Multidrug Resistance (Smr family) protein identified within FT CDS. Previously this was an uncharacterised Pfam domain. FT Smr proteins are a family of efflux proteins that confer FT resistance to a wide range of toxic compounds by removing FT them from the cells. Further support given to product FT function. Putative kept within product function. Functional FT classification - Drug/analogue sensitivity" FT /note="PMID:10735877, PMID:11948170" FT /db_xref="GOA:Q0PBJ9" FT /db_xref="InterPro:IPR000390" FT /db_xref="UniProtKB/TrEMBL:Q0PBJ9" FT /inference="protein motif:Pfam:PF00893" FT /protein_id="CAL34461.1" FT /translation="MNEKFNINIAWFLIILGGIIECFWVSGLKYSTEIWQYILTAIGVC FT ISFTCFLKACERLEVSITYSVFVGIGTIGVVLNEMFIFNEAVSIIKLVLIAILLLSIIA FT LKWVSKEA" FT misc_feature complement(join(281884..281949,281803..281871, FT 281722..281790,281644..281712)) FT /note="4 probable transmembrane helices predicted for FT Cj0310c by TMHMM2.0 at aa 7-28, 33-55, 60-82 and 86-108" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(281674..281943) FT /note="HMMPfam hit to PF00893, Small Multidrug Resistance FT protein, score 1.3e-12" FT /inference="protein motif:Pfam:PF00893" FT CDS 282101..282637 FT /transl_table=11 FT /gene="rplY" FT /locus_tag="Cj0311" FT /product="putative 50S ribosomal protein L25 (general FT stress protein Ctc)" FT /note="Original (2000) note: Cj0311, unknown, len: 178 aa; FT similar to CTC_BACSU general stress protein ctc (203 FT aa),fasta scores; opt: 290 z-score: 417.7 E(): 5.2e-16, FT 33.5% identity in 155 aa overlap. 56.7% identity to HP1496" FT /note="Updated (2006) note: Pfam PF01386 Ribosomal L25p FT family protein identified within CDS. Ctc protein has been FT shown to be a ribosomal protein and also binds to ribosomal FT 5S RNA. Characterised within Bacillus subtilis with FT marginal identity score. Full length alignment was not FT achieved. Putative kept within product function. Product FT modified to more specific family member due to motif match FT and characterisation papers. Functional classification - FT Adaptions and atypical conditions" FT /note="PMID:2836704, PMID:12432960, PMID:15236599" FT /db_xref="GOA:Q9PII8" FT /db_xref="InterPro:IPR001021" FT /db_xref="InterPro:IPR011035" FT /db_xref="InterPro:IPR020055" FT /db_xref="InterPro:IPR020056" FT /db_xref="InterPro:IPR020057" FT /db_xref="UniProtKB/Swiss-Prot:Q9PII8" FT /inference="protein motif:Pfam:PF01386" FT /protein_id="CAL34462.1" FT /translation="MLEGIVRESIGRKAAKALKRDGYLIANIYGKGLENINAAFKVNEF FT IKEVRKKTTLIFDVKVGSQTLSVVVVDYQKDPVTAELKHVDLKVAQKGVISKYMVPVKI FT TGTAIGLKNKGVLIQSKRRLKVKCAAENLPNFFELDVSKLDVGDALLVRDIVVPAGVTM FT IDADRVAVVGVEKAR" FT misc_feature 282104..282361 FT /note="HMMPfam hit to PF01386, Ribosomal L25p family,score FT 1.5e-29" FT /inference="protein motif:Pfam:PF01386" FT CDS 282634..283179 FT /transl_table=11 FT /gene="pth" FT /locus_tag="Cj0312" FT /product="peptidyl-tRNA hydrolase" FT /EC_number="3.1.1.29" FT /note="Original (2000) note: Cj0312, pth, probable FT peptidyl-tRNA hydrolase. len: 181 aa; simlar to many e.g. FT PTH_ECOLI peptidyl-tRNA hydrolase (EC 3.1.1.29) (194 FT aa),fasta scores; opt: 360 z-score: 469.6 E(): 6.7e-19, FT 35.8% identity in 190 aa overlap. 46.7% identity to HP1497. FT Contains PS01195 and PS01196 Peptidyl-tRNA hydrolase FT signatures 1 and 2, and Pfam match to entry PF01195 FT Pept_tRNA_hydro, Peptidyl-tRNA hydrolase, score FT 229.60,E-value 4.5e-65" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Aminoacyl tRNA synthetases and their modification" FT /note="PMID:1833189" FT /db_xref="GOA:Q9PII7" FT /db_xref="InterPro:IPR001328" FT /db_xref="InterPro:IPR018171" FT /db_xref="UniProtKB/Swiss-Prot:Q9PII7" FT /inference="protein motif:Pfam:PF01195" FT /inference="protein motif:Prosite:PS01196" FT /inference="protein motif:Prosite:PS01195" FT /protein_id="CAL34463.1" FT /translation="MILVVGLGNIGVEYENTRHNVGFMLIDLLLKESNFTNLTNSKFKG FT ELFKIGSSLLLLKPSTYMNNSGLSVKAVNDFYKCERMIVIHDDIDINLGALRFKKGGSS FT GGHNGLKSIDTLCGNDYERVRIGVGKGENVISHVLGKFKSEEEITLSKVLEHAKKALLE FT LIENDDLSAISSKYSLKA" FT misc_feature 282640..283167 FT /note="HMMPfam hit to PF01195, Peptidyl-tRNA FT hydrolase,score 4.2e-68" FT /inference="protein motif:Pfam:PF01195" FT misc_feature 282673..282714 FT /note="PS01195 Peptidyl-tRNA hydrolase signature 1" FT /inference="protein motif:Prosite:PS01195" FT misc_feature 282940..282972 FT /note="PS01196 Peptidyl-tRNA hydrolase signature 2" FT /inference="protein motif:Prosite:PS01196" FT CDS 283181..284239 FT /transl_table=11 FT /locus_tag="Cj0313" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0313, probable integral FT membrane protein, len: 352 aa; 35.9% identity to HP1498" FT /note="Updated (2006) note: Pfam domains PF03739 Predicted FT permease YjgP/YjgQ family were identified. Members of this FT family are predicted integral membrane proteins of unknown FT function. They are about 350 amino acids long and contain FT about 6 transmembrane regions. They are predicted to be FT permeases although there is no verification of this. Six FT probable transmembrane helices predicted by TMHMM2.0. FT Further support given to product function. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PBJ6" FT /db_xref="InterPro:IPR005495" FT /db_xref="UniProtKB/TrEMBL:Q0PBJ6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03739" FT /protein_id="CAL34464.1" FT /translation="MWIFFRFISGIYLKNFFIIFFSLLGFYCGIDLLLNFKDLPKAANL FT DLLYVMFLSFSAVPYVLPISLIFALVVSLISMIRANEFVSLYALGLSRNYVILFPFLWA FT LFFCCIYIGLNFTSFAYANDYKRNILKNGTIMNQSGEVFLKFNNNFVYISKINNGQNSA FT QNIKIFNINDLNLSSFASAKNAHFEGESWILRDGNITLLPKNYELANDGLKIQDFSELK FT SLEGFKPKIIEGVASNSDYSISDALESFELFKAQNVNTDTLKINLYKFVFTPFFAPFLM FT LIMYYFFPVIARFFNLAFVTFIAFVVTLMIWGVLFLLTRLSENSVIASEIGIVVPIIIL FT GCLSAYMYYKHR" FT misc_feature 283196..284230 FT /note="HMMPfam hit to PF03739, Predicted permease YjgP/YjgQ FT family, score 5.8e-79" FT /inference="protein motif:Pfam:PF03739" FT misc_feature order(283214..283282,283325..283393,283463..283531, FT 283988..284056,284060..284128,284156..284224) FT /note="6 probable transmembrane helices predicted for FT Cj0313 by TMHMM2.0 at aa 12-34, 49-71, 95-117, FT 270-292,294-316 and 326-348" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 284174..284206 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 284283..285491 FT /transl_table=11 FT /gene="lysA" FT /locus_tag="Cj0314" FT /product="diaminopimelate decarboxylase" FT /EC_number="4.1.1.20" FT /note="Original (2000) note: Cj0314, lysA, probable FT diaminopimelate decarboxylase, len: 402 aa; highly similar FT to mnay e.g. DCDA_PSEAE diaminopimelate decarboxylase (EC FT 4.1.1.20) (415 aa), fasta scores; opt: 1077 z-score: 968.8 FT E(): 0, 44.7% identity in 394 aa overlap. 60.4% identity to FT HP0290. Contains Pfam match to entry PF00278 FT Orn_DAP_Arg_deC, Pyridoxal-dependent decarboxylase, score FT 381.60, E-value 2.3e-113" FT /note="Updated (2006) note: Characterised within FT Pseudomonas aeruginosa with acceptable identity score. FT Putative not added to product function. Functional FT classification - Amino acid biosynthesis - Aspartate FT family" FT /note="PMID:3143046" FT /db_xref="GOA:Q9PII5" FT /db_xref="InterPro:IPR000183" FT /db_xref="InterPro:IPR002986" FT /db_xref="InterPro:IPR009006" FT /db_xref="InterPro:IPR022643" FT /db_xref="InterPro:IPR022644" FT /db_xref="InterPro:IPR022657" FT /db_xref="UniProtKB/Swiss-Prot:Q9PII5" FT /inference="protein motif:Pfam:PF00278" FT /protein_id="CAL34465.1" FT /translation="MDYKQLKQEFNTPFYIYNFDFIKERFLNLKEAFKARKSQIFYAVK FT ANSNLSLLQMLANLDSGFDCVSIGEVKRALKAGAKAYKIIFSGVGKTKEELRQALEYDI FT LYINLESEAEMMLLESVAKELNLKARISIRVNPNVDAKTHPYISTGLNENKFGVEIDIA FT RKMYLYAKNSSFLEPVGVHFHIGSQLLDISPIHEAAAIVAKLVRELKALQIDLKFFDIG FT GGLGVAYEKNECEPDLYDYAQGILAQLHGLDLTIGMEPGRYLVAKSGEFVCSVLYEKQN FT KTKRFVVVDGAMNDLIRPSLYEAYHEIILPYNQGEESLCDVVGGICESGDFFAKARSLP FT STQSDDIMVIKNTGAYGFSMSSNYNTRNKVCELALEEGQVRLIRQRENFEDQIALEEKF FT LKA" FT misc_feature 284334..285083 FT /note="HMMPfam hit to PF02784, Pyridoxal-dependent FT decarboxylase, py, score 2e-76" FT /inference="protein motif:Pfam:PF02784" FT misc_feature 285096..285410 FT /note="HMMPfam hit to PF00278, Pyridoxal-dependent FT decarboxylase, C-, score 5.7e-33" FT /inference="protein motif:Pfam:PF00278" FT CDS 285493..286260 FT /transl_table=11 FT /locus_tag="Cj0315" FT /product="putative HAD-superfamily hydrolase, subfamily FT IIA" FT /note="Original (2000) note: Cj0315, unknown, len: 255 aa; FT similar to the hypothetical proteins TR:O59622 FT (EMBL:AB009530) Pyrococcus horikoshii PHBR011 (263 FT aa),fasta scores; opt: 185 z-score: 375.5 E(): 1.2e-13, FT 28.1% identity in 267 aa overlapNAGD_ECOLI nagD protein FT (250 aa), fasta scores; opt: 259 z-score: 266.1 E(): FT 1.4e-07,26.0% identity in 250 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domains PF00702 haloacid FT dehalogenase-like hydrolase, PF02142 MGS-like domain and FT PF03558 TBSV core protein P21/P22 were identified with FT separate Pfam search. This family is a member of the HAD FT superfamily which includes L-2-haloacid FT dehalogenase,epoxide hydrolases and phosphatases. Previous FT matches to nagD protein are also members of this family. FT Product function modified to more specific family member FT based on motif match. No specific characterisation has been FT carried out yet. Putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PBJ4" FT /db_xref="InterPro:IPR006357" FT /db_xref="InterPro:IPR023214" FT /db_xref="InterPro:IPR023215" FT /db_xref="UniProtKB/TrEMBL:Q0PBJ4" FT /inference="protein motif:Pfam:PF03558" FT /inference="protein motif:Pfam:PF02142" FT /inference="protein motif:Pfam:PF00702" FT /protein_id="CAL34466.1" FT /translation="MFFLDVQGTLISDHDKSLIHGAKELIDFLNAKNLPYLIITNNTKK FT LDFLEKLQQKGLVIKENAYIDPFSVLKHLLRPCKVAAFGADEFVKSLENLGFELDFVNP FT SAVLVASYDDFKFKDFATMIELARREVRFIAMHETSIYKKDGRPYPGVGSIMAMLKNAI FT DFEYEVVGKPSIAFYKEALNLIRRQNSKIDFEDIKIISDDFRGDLLKAKELGMKTLLVL FT SGKISDTKGLDTDLLDGVYPSVFEFLKDLKCQI" FT CDS 286248..287321 FT /transl_table=11 FT /gene="pheA" FT /locus_tag="Cj0316" FT /product="chorismate mutase/prephenate dehydratase" FT /EC_number="4.2.1.51" FT /EC_number="5.4.99.5" FT /note="Original (2000) note: Cj0316, pheA, probable FT chorismate mutase/prephenate dehydratase, len: 357 aa; FT similar to many e.g. PHEA_ECOLI chorismate mutase (EC FT 5.4.99.5)/prephenate dehydratase (EC 4.2.1.51) (386 FT aa),fasta scores; opt: 482 z-score: 733.8 E(): 0, 33.1% FT identity in 366 aa overlap. Similar in N-term to possible FT truncated pheA in Hp; HP0291 hypothetical protein (96 aa) FT 35.8% identity in 81 aa overlap. Contains PS00857 and FT PS00858 Prephenate dehydratase signatures 1 and 2, and Pfam FT match to entry PF00800 PDT, Prephenate dehydratase,score FT 268.20, E-value 1.1e-76" FT /note="Updated (2006) note: Pfam domains PF01817 Chorismate FT mutase type II and PF01842 ACT domainn were identified. FT Further support given to product function. Characterised FT within Escherichia coli with acceptable identity score. FT Putative not added to product function. Functional FT classification - Amino acid biosynthesis -Aromatic amino FT acid family" FT /note="PMID:9497350" FT /db_xref="GOA:Q0PBJ3" FT /db_xref="InterPro:IPR001086" FT /db_xref="InterPro:IPR002701" FT /db_xref="InterPro:IPR008242" FT /db_xref="InterPro:IPR010957" FT /db_xref="InterPro:IPR018528" FT /db_xref="InterPro:IPR020822" FT /db_xref="UniProtKB/TrEMBL:Q0PBJ3" FT /inference="protein motif:Pfam:PF01842" FT /inference="protein motif:Pfam:PF01817" FT /inference="protein motif:Pfam:PF00800" FT /inference="protein motif:Prosite:PS00858" FT /inference="protein motif:Prosite:PS00857" FT /protein_id="CAL34467.1" FT /translation="MPNLEEFRNKIDAVDDKILDLLNERMTYVKSIGELKQSSGGSIYR FT PERERAIINRLKNANLGLLDQNAIEAIYQEIFAVSRNLEMPQTIAYLGPEGTYTHQAAR FT SRFGAMSRYIALANIEDVFKELSNKEAKYGVVPIENNTEGAVGITLDCLGKYNELKIFG FT EIYMDIHHSFVGINENLKEIKRIYSHPQGYNQCRKFLESHELSAIEFVPSKSTANAAYL FT ASQDKYAAAICSRIAAKLYNVPVLFDKIEDNAANKTRFLILSDIKNPKMPNCKTSILAH FT TAHKPGGLSFLLEQFKKENINLTKLESRPVKSKEFLHSFYIDFEGHIDDENVKKALKDI FT QEIVWLGSYLSGEKDEI" FT misc_feature 286251..286508 FT /note="HMMPfam hit to PF01817, Chorismate mutase type FT II,score 1.9e-22" FT /inference="protein motif:Pfam:PF01817" FT misc_feature 286512..287051 FT /note="HMMPfam hit to PF00800, Prephenate dehydratase,score FT 6.3e-56" FT /inference="protein motif:Pfam:PF00800" FT misc_feature 286968..287036 FT /note="PS00857 Prephenate dehydratase signature 1" FT /inference="protein motif:Prosite:PS00857" FT misc_feature 287073..287303 FT /note="HMMPfam hit to PF01842, ACT domain, score 0.00089" FT /inference="protein motif:Pfam:PF01842" FT misc_feature 287154..287177 FT /note="PS00858 Prephenate dehydratase signature 2" FT /inference="protein motif:Prosite:PS00858" FT CDS 287311..288405 FT /transl_table=11 FT /gene="hisC" FT /locus_tag="Cj0317" FT /product="histidinol-phosphate aminotransferase" FT /EC_number="2.6.1.9" FT /note="Original (2000) note: Cj0317, hisC, probable FT histidinol-phosphate aminotransferase, len: 364 aa; similar FT to many e.g. HIS8_BACSU histidinol-phosphate FT aminotransferase (EC 2.6.1.9) (360 aa), fasta scores; opt: FT 762 z-score: 1062.4 E(): 0, 36.2% identity in 367 aa FT overlap. No Hp match. Also similar to Cj1437c (hisC2) FT (30.0% identity in 347 aa overlap). Contains Pfam match to FT entry PF00222 aminotran_2, Aminotransferases class-II,score FT 60.80, E-value 2.9e-14" FT /note="Updated (2006) note: Pfam domains PF00155 FT Aminotransferase class I and II were identified. Further FT support given to product function. Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Amino acid biosynthesis - Histidine" FT /note="PMID:11518529, PMID:2999081, PMID:11294630" FT /db_xref="GOA:Q9PII2" FT /db_xref="InterPro:IPR004839" FT /db_xref="InterPro:IPR005861" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="PDB:3GET" FT /db_xref="UniProtKB/Swiss-Prot:Q9PII2" FT /inference="protein motif:Pfam:PF00155" FT /inference="protein motif:Pfam:PF00222" FT /protein_id="CAL34468.1" FT /translation="MKFNEFLNNLSNYEPGKDIEVIAKEYGVKEVIKLASNENPFGTPP FT KAIECLRQNANKAHLYPDDSMIELKSTLAQKYKVQNENIIIGAGSDQVIEFAIHSKLNS FT KNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITHNLDEFKKLYETHKDEIKLIFLCLPNN FT PLGECLDASEATEFIKGVNEDCLVVIDAAYNEFASFKDSKKHLEPCELIKEFDNVLYLG FT TFSKLYGLGGLRIGYGIANANIISAFYKLRAPFNVSNLALKAAVAAMDDDEFTEKTLEN FT NFSQMELYKEFAKKHNIKIIDSYTNFITYFFDEKNSTDLSEKLLKKGIIIRNLKSYGLN FT AIRITIGTSYENEKFFTEFDKILR" FT misc_feature 287533..288399 FT /note="HMMPfam hit to PF00155, Aminotransferase class I and FT II, score 6.6e-16" FT /inference="protein motif:Pfam:PF00155" FT CDS 288457..290139 FT /transl_table=11 FT /gene="fliF" FT /locus_tag="Cj0318" FT /product="flagellar M-ring protein" FT /note="Original (2000) note: Cj0318, fliF, probable FT flagellar M-ring protein, len: 560 aa; similar to many e.g. FT FLIF_ECOLI flagellar M-ring protein (552 aa), fasta scores; FT opt: 636 z-score: 805.0 E(): 0, 32.0% identity in 560 aa FT overlap. 43.2% identity to HP0351" FT /note="Updated (2006) note: Pfam domains PF01514 Secretory FT protein of YscJ/FliF family were identified. Further FT supoport given to product function. Characterised within FT Escherichia coli with marginal identity score. Putative not FT added to product function. Functional classification FT -Surface structures" FT /note="PMID:1551848" FT /db_xref="GOA:Q0PBJ1" FT /db_xref="InterPro:IPR000067" FT /db_xref="InterPro:IPR006182" FT /db_xref="InterPro:IPR013556" FT /db_xref="UniProtKB/TrEMBL:Q0PBJ1" FT /inference="protein motif:Pfam:PF01514" FT /protein_id="CAL34469.1" FT /translation="MDFKNMLHQIGQLYQNLTRKQRIVIAASIIVVVGFLVFLALFRGS FT GSNANNGYAVLVENVSPSSSAAIVAKLEQNNIPYKLESENKILVPQDQVYRQRMFIASE FT GLIKDSRVGFEAFDTQAFGATNEEQKVKYQRAIEGELARTIETLEPIRSAVVHIAFPKD FT SVFTERQIPPTASVVVNVREGLKLTRKQIDGIKNIVSAAVPKLTKENVKISDQSGVPLD FT EQEAYEDDLVRAQIKFKSDQEKALEDKIIENLAPFAGGMDKVKVSVNIDFDFSKQESQS FT EIYDPNPIVRSEQTLNEERTGRKDPEIQGVPGAVSNIGPVEGLDNKGQIDTYKKNQVTT FT NNELSKTITNTKKQFATVLRTSAAVTIDGKYQDVVDENGDVKSEYVPLTKEELASVESI FT VKNTINFSATRGDSVVVQNLPFHRESIRVESKVKTFYNRFVEPFIPPVKYFIAAILLFI FT FYKKVIAPFTQKMLEDVAAQEEMQQGPNAVLDDAEDALEKFNAARKKVEEQLGFGDNFN FT EDSIQYEVLLEKLRGLVSDKGEEIAALLQNLIQNDSEFGEKDM" FT sig_peptide 288457..288603 FT /note="Signal peptide predicted for fliF by SignalP 2.0 HMM FT (Signal peptide probability 0.991) with cleavage site FT probability 0.791 between residues 49 and 50" FT misc_feature 288505..289146 FT /note="HMMPfam hit to PF01514, Secretory protein of FT YscJ/FliF family, score 3.9e-54" FT /inference="protein motif:Pfam:PF01514" FT misc_feature 288523..288582 FT /note="1 probable transmembrane helix predicted for Cj0318 FT by TMHMM2.0 at aa 23-42" FT /inference="protein motif:TMHMM:2.0" FT CDS 290139..291167 FT /transl_table=11 FT /gene="fliG" FT /locus_tag="Cj0319" FT /product="flagellar motor switch protein" FT /note="Original (2000) note: Cj0319, fliG, probable FT flagellar motor switch protein, len: 342 aa; similar to FT many e.g. FLIG_ECOLI flagellar motor switch protein fliG FT (331 aa), fasta scores; opt: 609 z-score: 927.6 E(): FT 0,30.1% identity in 326 aa overlap. 61.5% identity to FT HP0352" FT /note="Updated (2006) note: Pfam domain PF01706 FliG FT C-terminal domain was identified. Further supoport given to FT product function. Characterised within Escherichia coli FT with marginal identity score. Putative not added to product FT function. Functional classification - Surface structures" FT /note="PMID:1551848, PMID:8308888, PMID:8550421" FT /db_xref="GOA:Q0PBJ0" FT /db_xref="InterPro:IPR000090" FT /db_xref="InterPro:IPR011002" FT /db_xref="InterPro:IPR023087" FT /db_xref="UniProtKB/TrEMBL:Q0PBJ0" FT /inference="protein motif:Pfam:PF01706" FT /protein_id="CAL34470.1" FT /translation="MIKLSEEQKMVYDDLSMPEKVAIFLIQLGEDATTSVFSHMEIDVI FT TEISRYIAMAKNVDRSVATAVLEEFYTLLQSNQYIKSGGLEYAKEILFRTFGPEIANKI FT LEKLTKSMENNQNFAYLAQIKPQQLADFITKEHPQTIALILAHMDSIHAAETLEYFSDE FT LRAEVVIRMANLGDISPSIIKRVSAVLESKLESLTSYKVEVGGPRAVAEVLNRLGQKAS FT KSTITYIEQSDERLAETIKELMFTFDDIQKLSTQAIREILKVADKRDLMIGLKGASEEL FT KQKFLANMSTRASEAFLEEMGFLGAVRVKDVEDAQRKVVEVVQKLAEQGLVQTGDADEM FT IE" FT misc_feature 290814..291143 FT /note="HMMPfam hit to PF01706, FliG C-terminal domain,score FT 7.5e-48" FT /inference="protein motif:Pfam:PF01706" FT CDS 291175..292005 FT /transl_table=11 FT /gene="fliH" FT /locus_tag="Cj0320" FT /product="putative flagellar assembly protein" FT /note="Original (2000) note: Cj0320, fliH, possible FT flagellar assembly protein, len: 364 aa; weakly similar to FT e.g. SW:FLIH_BACSU P23449 probable flagellar assembly FT protein fliH (208 aa), wublastp scores; E= 6.3e-07, 22% FT identity in 190 aa overlap. 34.6% identity to HP0353" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis, however, identity score unnacceptable. Putative FT kept within product function. Functional classification FT -Surface structures" FT /note="PMID:1828465" FT /db_xref="GOA:Q0PBI9" FT /db_xref="InterPro:IPR018035" FT /db_xref="UniProtKB/TrEMBL:Q0PBI9" FT /protein_id="CAL34471.1" FT /translation="MVNRSNVISGGASDQHVVEGYRFKVISEFDNHTGEKKHTQTPDEE FT NTNISLNDEKPVEENQVIASTQAVMETQIPTFQPSFVEDLLKKTDEMSSNIIKLQMQIE FT SQENEFNNRLNSELENAKEKFTKEGYEKAKEEFQKELSDFKDKYLKSIAKLDNACENLE FT NFIEKNEKELADTAIDIAKEVILKELELNSSKIAYALAKDLIGELKGASAIELKVNAED FT YEYLKEQFDQNAHIKISLDDAISKGSVVIISDAGNIESNLNSRLTKIKKMVNNE" FT CDS 291998..293845 FT /transl_table=11 FT /gene="dxs" FT /locus_tag="Cj0321" FT /product="L-deoxy-D-xylulose-5-phosphate synthase" FT /EC_number="2.2.1.7" FT /note="Original (2000) note: Cj0321, dxs, probable FT 1-deoxyxylulose-5-phosphate synthase, len: 615 aa; similar FT to many e.g. DXS_ECOLI 1-deoxyxylulose-5-phosphate synthase FT (619 aa), fasta scores; opt: 1493 z-score: 1697.3 E(): 0, FT 41.0% identity in 608 aa overlap. 57.9% identity to HP0354 FT (called transketolase B). Also similar to C. jejuni FT transketolase, Cj1645 (25.8% identity in 652 aa overlap). FT Contains PS00801 and PS00802 Transketolase signatures 1 and FT 2" FT /note="Updated (2006) note: Pfam domains F02779 FT Transketolase, pyridine binding domain and HMMPfam PF02780 FT Transketolase, C-terminal domain were identified within FT CDS. Characterised within Escherichia coli with acceptable FT identity score. Putative not added to product function. FT Product function modified to more specific naming based on FT new updated EC number. Functional classification - Central FT intermediary metabolism - General" FT /note="PMID:9482846, PMID:10648511" FT /db_xref="GOA:Q9PIH8" FT /db_xref="InterPro:IPR001017" FT /db_xref="InterPro:IPR005474" FT /db_xref="InterPro:IPR005475" FT /db_xref="InterPro:IPR005476" FT /db_xref="InterPro:IPR005477" FT /db_xref="InterPro:IPR009014" FT /db_xref="InterPro:IPR015941" FT /db_xref="InterPro:IPR020826" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIH8" FT /inference="protein motif:Pfam:PF02780" FT /inference="protein motif:Prosite:PS00802" FT /inference="protein motif:Prosite:PS00801" FT /protein_id="CAL34472.1" FT /translation="MSKKFAHTQEELEKLSLKELENLAASMREKIIQVVSKNGGHLSSN FT LGAVELSIAMHLVFDAKKDPFIFDVSHQSYTHKLLSGKEEIFDTLRQINGLSGYTKPSE FT GDYFVAGHSSTSISLAVGACKAIALKGEKRIPVALIGDGALSAGMAYEALNELGDSKFP FT CVILLNDNEMSISKPIGAISKYLSQAMATQFYQSFKKRIAKMLDILPDSATYMAKRFEE FT SFKLITPGLLFEELGLEYIGPIDGHNLGEIISALKQAKAMQKPCVIHAQTIKGKGYALA FT EGKHAKWHGVGAFDIDSGESVKKSDTKKSATEIFSKNLLDLASKYENIVGVTAAMPSGT FT GLDKLIEKYPNRFWDVAIAEQHAVTSMAAMAKEGFKPFIAIYSTFLQRAYDQVIHDCAI FT MNLNVVFAMDRAGIVGEDGETHQGVFDLSFLAPLPNFTLLAPRDEQMMQNIMEYAYLHQ FT GPIALRYPRGSFILDKEFNPCEIKLGKAQWLVKNNSEIAFLGYGQGVAKAWQVLRALQE FT MNNNANLIDLIFAKPLDEELLCELAKKSKIWFIFSENVKIGGIESLINNFLQKYDLHVK FT VVSFEYEDKFIEHGKTSEVEKNLEKDVNSLLTKVLKFYH" FT misc_feature 292079..292138 FT /note="PS00801 Transketolase signature 1" FT /inference="protein motif:Prosite:PS00801" FT misc_feature 292337..292369 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 292922..293416 FT /note="HMMPfam hit to PF02779, Transketolase, pyridine FT binding domai, score 2.1e-48" FT /inference="protein motif:Pfam:PF02779" FT misc_feature 293240..293290 FT /note="PS00802 Transketolase signature 2" FT /inference="protein motif:Prosite:PS00802" FT misc_feature 293447..293815 FT /note="HMMPfam hit to PF02780, Transketolase, C-terminal FT domain, score 6.3e-11" FT /inference="protein motif:Pfam:PF02780" FT CDS 293931..294341 FT /transl_table=11 FT /gene="perR" FT /locus_tag="Cj0322" FT /product="peroxide stress regulator" FT /note="Original (2000) note: Cj0322, perR, regulator of FT peroxide stress regulon, len: 136 aa; similar to many FT members of the furR family e.g. FUR3_BACSU ferric uptake FT regulation protein homolog 3 (145 aa), fasta scores; opt: FT 258 z-score: 379.6 E(): 6.9e-14, 32.6% identity in 135 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF01475 Ferric FT uptake regulator family was identified within CDS. Further FT support given to product function. Marginal identity scores FT were obtained with many. Appropriate motifs present. FT Putative not added to product function. Functional FT classification - Broad regulatory functions" FT /note="PMID:9701813, PMID:12100544" FT /db_xref="GOA:Q0PBI7" FT /db_xref="InterPro:IPR002481" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:Q0PBI7" FT /inference="protein motif:Pfam:PF01475" FT /protein_id="CAL34473.1" FT /translation="MELLQMLKKHELKATPQRLCVLKILKRHEHPNIDELYIEIKKEYP FT SISLATVYKNLNTLQEQGLVVEINVLNQKTCYDIYEEEHIHVVCTKCGGIEDLSFKDAK FT LYEYQEHLEKKIGNLVNHLSVCAYVDNCKKCH" FT misc_feature 293955..294314 FT /note="HMMPfam hit to PF01475, Ferric uptake regulator FT family, score 4.3e-22" FT /inference="protein motif:Pfam:PF01475" FT CDS 294387..295583 FT /transl_table=11 FT /locus_tag="Cj0323" FT /product="hypothetical protein Cj0323" FT /note="Original (2000) note: Cj0323, unknown, len: 398 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="InterPro:IPR023577" FT /db_xref="UniProtKB/TrEMBL:Q0PBI6" FT /protein_id="CAL34474.1" FT /translation="MVYEIQKNFLLSDCTLLENLKKDNIPFRNSKFETFYTQITSNHSV FT KFQSFCNEFYKITKFNNSILEQNQEEKISKKKFEKARKKIIGKSIKKERFEFKFCSLKS FT YIDIYEEPKICILKIFFPTLDSSNEFKIPKDFKIQKELHHDLNSKHIVLYGFEYQNFDI FT EKYFKIIEKNQNFSLDFPNYINAYDGFRIFLFYLFKKLKFYWTLSLERKDKQSLCEFLF FT YSRSLYIVLSSMNTILDKNLSNILALKFKDITKKTQDILASENSNQDLLLFLSDEKIQD FT LFNDFDFFIKENSFYEGDCKDRFFKQLVALELRKKIILFRKNILKNFDLELFENSFFEL FT AIFLEYFYHFLEIKNLNKLYEKYSKDRDKNIFSKIINNKNKFCKLLKKSSKNLKIYKG" FT CDS 295586..296293 FT /transl_table=11 FT /gene="ubiE" FT /locus_tag="Cj0324" FT /product="ubiquinone/menaquinone biosynthesis FT methlytransferase" FT /EC_number="2.1.1.-" FT /note="Original (2000) note: Cj0324, ubiE, probable FT ubiquinone/menaquinone biosynthesis methlytransferase,len: FT 235 aa; similar to many e.g. UBIE_ECOLI FT ubiquinone/menaquinone biosynthesis methlytransferase (EC FT 2.1.1.-) (251 aa), fasta scores; opt: 380 z-score: 597.2 FT E(): 5.2e-26, 30.5% identity in 236 aa overlap. 50.2% FT identity to HP1483 (called gerC2 protein). Contains Pfam FT match to entry PF01209 Ubie_methyltran, ubiE/COQ5 FT methyltransferase family, score 92.40, E-value 8.9e-24" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity score. Putative not FT added to product function. Functional classification FT -Biosynthesis of cofactors, prosthetic groups and carriers FT - Menaquinone and ubiquinine" FT /note="PMID:9045837" FT /db_xref="GOA:Q9PIH5" FT /db_xref="InterPro:IPR004033" FT /db_xref="InterPro:IPR023576" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIH5" FT /inference="protein motif:Pfam:PF01209" FT /protein_id="CAL34475.1" FT /translation="MQKQEKIIEMFNQIAPTYDKANRILSFGADVAWRKKACQRVMSLY FT LKKDLKIADIACGTGDMIEIWQESALKMEKNILNIKGIDPSSGMLNVAKEKFPNVEFIK FT AGAQNLPLESQSLDILSISYGIRNVVERQKALSEFARVLQKDGILVVLEFTKREKGGFI FT AACRDFYLKNILPSIGGIISKNKSAYEYLPNSIEGFLSKKEFILELKNAGFEMLDYKSF FT SFGVSSMFIAKKL" FT misc_feature 295586..296287 FT /note="HMMPfam hit to PF01209, ubiE/COQ5 methyltransferase FT family, score 2.2e-28" FT /inference="protein motif:Pfam:PF01209" FT CDS 296290..297453 FT /transl_table=11 FT /gene="xseA" FT /locus_tag="Cj0325" FT /product="exodeoxyribonuclease VII large subunit" FT /EC_number="3.1.11.6" FT /note="Original (2000) note: Cj0325, xseA, probable FT exodeoxyribonuclease VII large subunit, len: 387 aa; FT similar to many e.g. EX7L_ECOLI exodeoxyribonuclease VII FT large subunit (EC 3.1.11.6) (456 aa), fasta scores; opt: FT 798 z-score: 1133.5 E(): 0, 36.6% identity in 366 aa FT overlap. 34.2% identity to HP0259" FT /note="Updated (2006) note: Pfam domain PF01336 OB-fold FT nucleic acid binding domain and PF02601 Exonuclease FT VII,large subunit was identified. Further support given to FT product function. Characterised within Escherichia coli FT with acceptable identity score. Putative not added to FT product function. Functional classification - Degradation FT of macromolecules - DNA" FT /note="PMID:3021756, PMID:6284744" FT /db_xref="GOA:Q9PIH4" FT /db_xref="InterPro:IPR003753" FT /db_xref="InterPro:IPR004365" FT /db_xref="InterPro:IPR020579" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIH4" FT /inference="protein motif:Pfam:PF02601" FT /inference="protein motif:Pfam:PF01336" FT /protein_id="CAL34476.1" FT /translation="MTPTELNLKAKALLETHFDDIVLSGEISKITLHGSGHWYFDLKDE FT RSSIACAMFKGANLKVGFKPAVGDFLELCGSVSLYPESGRYQFIATSMKKAGFGDLEAQ FT FLALKERLQKEGLFDPRFKKSLPKFPKKVGIITSKTSAALQDMLKLIHQKEYFLAKIYI FT FDALTQGNNAPFSLIQALKKADDMDLDVLIIARGGGSREDLFCFNDENLAREIFKAKTP FT IISAIGHEIDYVISDFVADFRAPTPSAAIDTLFYSKLDIEQSLDLMEEKLMQLWNYKIQ FT NYENLLLNLSKFFKFNSLPKIIDEKIKQSHNIEKQLNHLLANQMRYNELKLDKLQNAYL FT QHENFFNKSKKFICIRKNGKIANLEDLKSDDIVILSSQTSQKEAKIL" FT misc_feature 296350..296577 FT /note="HMMPfam hit to PF01336, OB-fold nucleic acid binding FT domain, score 6.9e-11" FT /inference="protein motif:Pfam:PF01336" FT misc_feature 296854..297333 FT /note="HMMPfam hit to PF02601, Exonuclease VII, large FT subunit, score 1.1e-27" FT /inference="protein motif:Pfam:PF02601" FT CDS 297463..298539 FT /transl_table=11 FT /gene="serC" FT /locus_tag="Cj0326" FT /product="phosphoserine aminotransferase" FT /EC_number="2.6.1.52" FT /note="Original (2000) note: Cj0326, serC, probable FT phosphoserine aminotransferase, len: 358 aa; highly similar FT to many e.g. SERC_ECOLI phosphoserine aminotransferase (EC FT 2.6.1.52) (361 aa), fasta scores; opt: 869 z-score: 1419.8 FT E(): 0, 41.8% identity in 359 aa overlap. No Hp match. FT Conatains Pfam match to entry PF00266 aminotran_5, FT Aminotransferases class-V, score 133.30, E-value 4.6e-36" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Amino acid biosynthesis - Serine family" FT /note="PMID:10024454, PMID:3518706" FT /db_xref="GOA:Q9PIH3" FT /db_xref="InterPro:IPR000192" FT /db_xref="InterPro:IPR003248" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="InterPro:IPR022278" FT /db_xref="PDB:3M5U" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIH3" FT /inference="protein motif:Pfam:PF00266" FT /protein_id="CAL34477.1" FT /translation="MRKINFSAGPSTLPLEILEQAQKELCDYQGRGYSIMEISHRTKVF FT EEVHFGAQEKAKKLYELNDDYEVLFLQGGASLQFAMIPMNLALNGVCEYANTGVWTKKA FT IKEAQILGVNVKTVASSEESNFDHIPRVEFSDNADYAYICSNNTIYGTQYQNYPKTKTP FT LIVDASSDFFSRKVDFSNIALFYGGVQKNAGISGLSCIFIRKDMLERSKNKQIPSMLNY FT LTHAENQSLFNTPPTFAIYMFNLEMDWLLNQGGLDKVHEKNSQKATMLYECIDLSNGFY FT KGHADKKDRSLMNVSFNIAKNKDLEPLFVKEAEEAGMIGLKGHRILGGIRASIYNALNL FT DQVKTLCEFMKEFQGKYA" FT misc_feature 297499..298500 FT /note="HMMPfam hit to PF00266, Aminotransferase FT class-V,score 3.6e-37" FT /inference="protein motif:Pfam:PF00266" FT CDS 298536..298886 FT /transl_table=11 FT /locus_tag="Cj0327" FT /product="putative endoribonuclease L-PSP family protein" FT /note="Original (2000) note: Cj0327, unknown, len: 116 aa; FT similar to hypothetical proteins e.g. YABJ_BACSU (125 FT aa),fasta scores; opt: 211 z-score: 261.9 E(): 2.5e-07, FT 33.0% identity in 109 aa overlap, and to e.g. UK14_HUMAN FT 14.5 kd translational inhibitor protein (137 aa), fasta FT scores; opt: 173 z-score: 249.5 E(): 1.2e-06, 29.2% FT identity in 106 aa overlap. No Hp ortholog. Also similar to FT Cj1388 (33.3% identity in 96 aa overlap). Contains Pfam FT match to entry PF01042 DUF10, Domain of unknown function, FT score 69.30, E-value 8.4e-17" FT /note="Updated (2006) note: Pfam domain PF01042 FT Endoribonuclease L-PSP identified within CDS (previously FT uncharacterised). Product modified to more specific family FT member due to motif match. No specific characterisation has FT been carried out yet. Putative kept within product FT fucntion. Functional classification - Degradation of FT macromolecules - DNA" FT /db_xref="InterPro:IPR006175" FT /db_xref="InterPro:IPR013813" FT /db_xref="UniProtKB/TrEMBL:Q0PBI2" FT /inference="protein motif:Pfam:PF01042" FT /protein_id="CAL34478.1" FT /translation="MIKRFDECDRMSQIIVFDKYFKTAGQVAFEPSGDIKKQTKEALAE FT LDALFEKIGANKGDLIQIQIWLANMQDFDAMNEIYDAWIKNYPKPVRACVGSALAEGYL FT VEIQAFGKLREN" FT misc_feature 298554..298874 FT /note="HMMPfam hit to PF01042, Endoribonuclease L-PSP,score FT 3.8e-16" FT /inference="protein motif:Pfam:PF01042" FT CDS complement(298883..299857) FT /transl_table=11 FT /gene="fabH" FT /locus_tag="Cj0328c" FT /product="3-oxoacyl-[acyl-carrier-protein] synthase" FT /note="Original (2000) note: Cj0328c, fabH, probable FT 3-oxoacyl-[acyl-carrier-protein] synthase, len: 324 aa; FT highly simlar to many e.g.FABH_ECOLI FT 3-oxoacyl-[acyl-carrier-protein] synthase III (317 FT aa),fasta scores; opt: 978 z-score: 1555.6 E(): 0, 48.2% FT identity in 309 aa overlap. 59.8% identity to HP0202. Also FT similar to Cj1303 (31.9% identity in 339 aa overlap)" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Fatty acid biosynthesis" FT /note="PMID:1551888" FT /db_xref="GOA:Q9PIH1" FT /db_xref="InterPro:IPR004655" FT /db_xref="InterPro:IPR013747" FT /db_xref="InterPro:IPR013751" FT /db_xref="InterPro:IPR016038" FT /db_xref="InterPro:IPR016039" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIH1" FT /protein_id="CAL34479.1" FT /translation="MLKASLKSIASYIPEKILSNADLEKMVDTTDEWITRRTGIKERRI FT ASENENTSDLGTKAALKAIERANLKPEDIDAILVATLSPDYFTMPSTACKIASNLGLVN FT ISAFDISAACSGFIYLLEQAKALVESGLKKNVLIIGAEKTSSIMDYNDRSICILFGDGA FT GAGVVSLDNENHILDVHTASNGNYGDLLMTQRSQKSSLCQTLSMQMKGNEVFKIAVNTL FT SNDVVEILAKNNILAQEIDLFIPHQANLRIIKAVQEKLNLSDEKCVITVQKYGNTSAAS FT IPMAMNDAYEEGRLKKGNLILLDAFGGGFTWGSALLKFGGENF" FT CDS complement(299850..300836) FT /transl_table=11 FT /gene="plsX" FT /locus_tag="Cj0329c" FT /product="putative fatty acid/phospholipid synthesis FT protein" FT /note="Original (2000) note: Cj0329c, plsX, probable fatty FT acid/phospholipid synthesis protein plsX homolog, len: 328 FT aa; similar to many e.g. PLSX_ECOLI fatty acid/phospholipid FT synthesis protein plsX homolog (346 aa),fasta scores; opt: FT 711 z-score: 1146.5 E(): 0, 39.6% identity in 326 aa FT overlap. 53.2% identity to HP0201" FT /note="Updated (2006) note: Pfam domain PF02504 fatty acid FT synthesis protein identified within CDS. Further support FT given to product function. Specific characterisation with FT acceptable identity score has not been carried out yet. FT Putative kept within product function. Functional FT classification - Fatty acid biosynthesis" FT /note="PMID:9642179, PMID:8759840" FT /db_xref="GOA:Q9PIH0" FT /db_xref="InterPro:IPR003664" FT /db_xref="InterPro:IPR012281" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIH0" FT /inference="protein motif:Pfam:PF02504" FT /protein_id="CAL34480.1" FT /translation="MINIAIDAMGGDFGEKPIIEGVLKALETKPFNAILVGNSKILKPL FT IPKKLEQYIQYEEASEIFSMNGNATDALKNKETTIYKAINLLKEKKVDAVVSAGHSGAS FT MSLATLKLGRLKGISRPAIATLMPNIVNKTLLLDVGANTDCKAENLFQFAIMGEVYARE FT IMQIQKPRLALLSNGEEECKGNELTKESHQLMKKIPNFIGNAEGRDIFNGEIDVLVCDG FT FDGNVILKACEGVATAIFQLLKNEVKQSFISKIGALLMKPSFKKLKKHTDWQEYGGAPL FT LGVNGCVIISHGKSDSRAIKNAIFQAINFSQSHINKFIENELGKYNA" FT misc_feature complement(299883..300833) FT /note="HMMPfam hit to PF02504, Fatty acid synthesis FT protein, score 1.6e-141" FT /inference="protein motif:Pfam:PF02504" FT CDS complement(300842..300988) FT /transl_table=11 FT /gene="rpmF" FT /locus_tag="Cj0330c" FT /product="50S ribosomal protein L32" FT /note="Original (2000) note: Cj0330c, rpmF, probable 50S FT ribosomal protein L32, len: 48 aa; similar to e.g. FT RL32_BACST 50S ribosomal protein L32 (56 aa), fasta scores; FT opt: 118 z-score: 174.5 E(): 0.018, 41.7% identity in 48 aa FT overlap. 72.9% identity to HP0200" FT /note="Updated (2006) note: Pfam domain PF01783 Ribosomal FT L32p protein family identified within CDS. Further support FT given to product function. Characterised within Escherichia FT coli with acceptable identity score. Putative not added to FT product function. Functional classification -Ribosomal FT protein synthesis and modification" FT /note="PMID:6420194" FT /db_xref="GOA:Q9PIG9" FT /db_xref="InterPro:IPR002677" FT /db_xref="InterPro:IPR011332" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIG9" FT /inference="protein motif:Pfam:PF01783" FT /protein_id="CAL34481.1" FT /translation="MAVPKRRVSKTRAAKRRTHYKVSLPMPIKDKDGSYKMPHRANPTT FT KEY" FT misc_feature complement(300851..300985) FT /note="HMMPfam hit to PF01783, Ribosomal L32p protein FT family, score 1.8e-05" FT /inference="protein motif:Pfam:PF01783" FT CDS complement(301012..301365) FT /transl_table=11 FT /locus_tag="Cj0331c" FT /product="hypothetical protein Cj0331c" FT /note="Original (2000) note: Cj0331c, unknown, len: 117 aa; FT 34.7% identity to HP0199. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PBH8" FT /protein_id="CAL34482.1" FT /translation="MKIPFSKINTKEYPFKLNLENIIFEGNLVKINPKLVKINAIMQGF FT IYRPCDSCGTELELEIKENLELFASDGIFKDEANELSNTIEFFDGHIDLIEVAISELEA FT YLSDYFYCINCNN" FT CDS complement(301366..301779) FT /transl_table=11 FT /gene="ndk" FT /locus_tag="Cj0332c" FT /product="nucleoside diphosphate kinase" FT /EC_number="2.7.4.6" FT /note="Original (2000) note: Cj0332c, ndk, probable FT nucleoside diphosphate kinase, len: 137 aa; highly similar FT to many e.g. NDK_ECOLI nucleoside diphosphate kinase (EC FT 2.7.4.6) (142 aa), fasta scores; opt: 532 z-score: 964.5 FT E(): 0, 57.7% identity in 137 aa overlap. 73.3% identity to FT HP0198. Contains PS00469 Nucleoside diphosphate kinases FT active site and Pfam match to entry PF00334 NDK,Nucleoside FT diphosphate kinases, score 280.30, E-value 2.4e-80" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Literature search identified FT paper linking protein to glycoprotein. Functional FT classification - Purine ribonucleotide biosynthesis" FT /note="PMID:1657712, PMID:7730286" FT /db_xref="GOA:Q9PIG7" FT /db_xref="InterPro:IPR001564" FT /db_xref="InterPro:IPR023005" FT /db_xref="PDB:3PJ9" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIG7" FT /inference="protein motif:Pfam:PF00334" FT /inference="protein motif:Prosite:PS00469" FT /protein_id="CAL34483.1" FT /translation="MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQA FT ENFYAVHKERPFFKDLVEFMISGPVVVSILEGEGAVLKNRDLMGATNPKEAKAGTIRAD FT FAESIDANAVHGSDSLENAKIEIEFFFKPNEIC" FT misc_feature complement(301369..301776) FT /note="HMMPfam hit to PF00334, Nucleoside diphosphate FT kinase, score 6e-80" FT /inference="protein motif:Pfam:PF00334" FT misc_feature complement(301420..301446) FT /note="PS00469 Nucleoside diphosphate kinases active site" FT /inference="protein motif:Prosite:PS00469" FT CDS complement(301892..302176) FT /transl_table=11 FT /gene="fdxA" FT /locus_tag="Cj0333c" FT /product="ferredoxin" FT /note="Original (2000) note: Cj0333c, fdxA, probable FT ferredoxin, len: 94 aa; similar to many e.g. FER_CLOTM FT ferredoxin (55 aa), fasta scores; opt: 142 z-score: 311.2 FT E(): 4.5e-10, 45.8% identity in 59 aa overlap. No Hp FT ortholog. Also similar to Cj0354c (38.8% identity in 67 aa FT overlap). Contains PS00198 4Fe-4S ferredoxins, iron-sulfur FT binding region signature and Pfam match to entry PF00037 FT fer4, 4Fe-4S ferredoxins and related iron-sulfur cluster FT binding domains., score 51.80, E-value 8.8e-14" FT /note="Updated (2006) note: Similar to many e.g. FT Clostridium sp. with acceptable identity scores. Putative FT not added to product function. Functional classification FT -Energy metabolism - Electron transport" FT /note="PMID:4433520" FT /db_xref="GOA:Q0PBH6" FT /db_xref="InterPro:IPR001450" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR017900" FT /db_xref="UniProtKB/TrEMBL:Q0PBH6" FT /inference="protein motif:Pfam:PF00037" FT /inference="protein motif:Prosite:PS00198" FT /protein_id="CAL34484.1" FT /translation="MAVKITDICIACGSCIDECPVNAIVDDTNNPEGEDRYYVYANKCV FT ECVGHNDQPACASACPTDGCIVWSAVESGQPSRDNIGADMRSGDTPVFA" FT misc_feature complement(302102..302173) FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 2.9e-06" FT /inference="protein motif:Pfam:PF00037" FT misc_feature complement(302117..302152) FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT CDS 302383..302979 FT /transl_table=11 FT /gene="ahpC" FT /locus_tag="Cj0334" FT /product="alkyl hydroperoxide reductase" FT /EC_number="3.4.-.-" FT /note="Original (2000) note: Cj0334, ahpC, probable alkyl FT hydroperoxide reductase, len: 198 aa; highly simlar to e.g. FT TDX1_HUMAN thioredoxin peroxidase 1 (198 aa), fasta scores; FT opt: 615 z-score: 915.3 E(): 0, 46.1% identity in 193 aa FT overlap, and to e.g. AHPC_ECOLI P26427 alkyl hydroperoxide FT reductase C22 protein (EC 1.6.4.-) (186 aa),wublastp scores FT E= 8.9e-23, 34% identity in 149 aa overlap. 67.7% identity FT to HP1563 (Hp 26 kD antigen). Contains Pfam match to entry FT PF00578 AhpC-TSA, AhpC/TSA family, score 208.20, E-value FT 1.2e-58" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Putative not added to product FT function. Literature search identified paper linking FT protein to glycoprotein (PMID:12186869). Functional FT classification - Detoxification" FT /note="PMID:10438747, PMID:10515927, PMID:12186869" FT /db_xref="GOA:Q9ZI13" FT /db_xref="HSSP:1QQ2" FT /db_xref="InterPro:IPR000866" FT /db_xref="InterPro:IPR012336" FT /db_xref="InterPro:IPR019479" FT /db_xref="InterPro:IPR024706" FT /db_xref="UniProtKB/TrEMBL:Q9ZI13" FT /inference="protein motif:Pfam:PF00578" FT /protein_id="CAL34485.1" FT /translation="MIVTKKALDFTAPAVLGNNEIVQDFNLYKNIGPKGAVVFFYPKDF FT TFVCPSEIIAFDKRYQEFKNRGIEVIGISGDNEFSHFAWKNTPVNQGGIGQVKFPLVAD FT LTKQIARNFDVLYAEAVALRGSFLLDADGTVRHAVVNDLPLGRNIDEMLRMVDTMLFTN FT EHGEVCPAGWNKGDEGMKANPKGVAEYLGKNEAKL" FT misc_feature 302389..302844 FT /note="HMMPfam hit to PF00578, AhpC/TSA family, score FT 8.6e-60" FT /inference="protein motif:Pfam:PF00578" FT CDS 303098..304186 FT /transl_table=11 FT /gene="flhB" FT /locus_tag="Cj0335" FT /product="flagellar biosynthetic protein" FT /note="Original (2000) note: Cj0335, flhB, probable FT flagellar biosynthetic protein, len: 362 aa; similar to FT many e.g. FLHB_ECOLI flagellar biosynthetic protein flhB FT (382 aa), fasta scores; opt: 856 z-score: 1174.4 E(): FT 0,37.6% identity in 362 aa overlap. 39.8% identity to FT HP0770. Also similar in C-term to Cj0848 (93 aa) (40.7% FT identity in 81 aa overlap). Contains Pfam match to entry FT PF01312 Bac_export_2, FlhB HrpN YscU SpaS Family, score FT 405.40, E-value 5.2e-118" FT /note="Updated (2006) note: Four probable transmembrace FT helices identified by TMHMM2.0. Further support given to FT product function. Characterised within Escherichia coli FT with acceptable identity score. Putative not added to FT product function. Functional classification - Surface FT structures" FT /note="PMID:8299954, PMID:15919996" FT /db_xref="GOA:Q0PBH4" FT /db_xref="InterPro:IPR006135" FT /db_xref="InterPro:IPR006136" FT /db_xref="UniProtKB/TrEMBL:Q0PBH4" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01312" FT /protein_id="CAL34486.1" FT /translation="MAGEDQEKTEEPTSKKIEDARKEGNVPKSQDAAAIVTLIIGVTIT FT LFMMSFMGERIVNLYRYYQSFIGVEFDLRIIQAIMIKSIFEVLIILAPIVLSIMIAGVL FT GNIMQFGFIFTTKPIMPNLGKINPLKGLKNLFSLKKIVESIKIILKVGIVFTIAFIVLL FT KFMQELPRVELYTMVAQLTWLRDRAIVLAAIVIVAFLIIAVLDVFLVRFQYFKGLRMSK FT QEIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVAIRYDTGK FT EQAPRVVAKGVDFLALRIKQVAYENNVVVYENPPLARELYKACDVNDLIPREMFKAVAE FT VLGFVYNTNNKSRLAGQVKKGN" FT misc_feature 303110..304135 FT /note="HMMPfam hit to PF01312, FlhB HrpN YscU SpaS FT Family,score 2.4e-119" FT /inference="protein motif:Pfam:PF01312" FT misc_feature order(303191..303259,303344..303412,303518..303586, FT 303659..303727) FT /note="4 probable transmembrane helices predicted for FT Cj0335 by TMHMM2.0 at aa 32-54, 83-105, 141-163 and FT 188-210" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(304192..304935) FT /transl_table=11 FT /gene="motB" FT /locus_tag="Cj0336c" FT /product="putative flagellar motor protein" FT /note="Original (2000) note: Cj0336c, motB, possible FT flagellar motor protein, len: 247 aa; similar to MOTB_BACSU FT chemotaxis motB protein (motility protein B) (261 aa), FT fasta scores; opt: 195 z-score: 275.7 E(): 4.2e-08, 30.7% FT identity in 261 aa overlap. 43.3% identity to HP0816. FT Contains Pfam match to entry PF00691 OmpA, OmpA family, FT score 28.50, E-value 5.6e-07" FT /note="Updated (2006) note: One probable transmembrace FT helices identified by TMHMM2.0 within CDS. Some FT characterisation within Bacillus subtilis with marginal FT identity score. Putative kept within product function. FT Functional classification - Surface structures" FT /note="PMID:1624413" FT /db_xref="GOA:Q0PBH3" FT /db_xref="InterPro:IPR006665" FT /db_xref="UniProtKB/TrEMBL:Q0PBH3" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00691" FT /protein_id="CAL34487.1" FT /translation="MAKKHKCPECPAGEKWAVPYADFLSLLLALFIALWAISKTNPAKV FT EALKTEFVKIFDYTSTQTVKEESKTQEKYKGAAKEESDELKSLKQMTMTQQETIKRLQA FT ALDQSDNQVALNLPSKVEFERGSAQIVSADIQDYLKRMAELTTYLPPQAKIEIRGYTDN FT SDSIIRSYELAYQRAENVLKYFIEGGANLKNISIKSYGLNNPINGNPQTLENNRVEIYF FT KVDTADTSTQKSVLELINKIGTKAP" FT misc_feature complement(304285..304572) FT /note="HMMPfam hit to PF00691, OmpA family, score 9.1e-07" FT /inference="protein motif:Pfam:PF00691" FT misc_feature complement(304822..304890) FT /note="1 probable transmembrane helix predicted for Cj0336c FT by TMHMM2.0 at aa 16-38" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(304938..305714) FT /transl_table=11 FT /gene="motA" FT /locus_tag="Cj0337c" FT /product="putative flagellar motor proton channel" FT /note="Original (2000) note: Cj0337c, motA, probable FT flagellar motor proton channel, len: 258 aa; similar to FT e.g. MOTA_BACSU chemotaxis motA protein (motility protein FT A) (270 aa), fasta scores; opt: 493 z-score: 784.5 E(): FT 0,34.0% identity in 259 aa overlap. 58.6% identity to FT HP0815. Contains PS01307 Flagellar motor protein motA FT family signature" FT /note="Updated (2006) note: Three probable transmembrace FT helices identified by TMHMM2.0 within CDS. Pfam domain FT PF01618 MotA/TolQ/ExbB proton channel family protein FT identified within CDS. Further support given to product FT function. Some characterisation work carried out within FT Bacillus subtilis with marginal identity score. Putative FT kept within product function. Functional classification FT -Surface structures" FT /note="PMID:1624413" FT /db_xref="GOA:Q0PBH2" FT /db_xref="InterPro:IPR000540" FT /db_xref="InterPro:IPR002898" FT /db_xref="UniProtKB/TrEMBL:Q0PBH2" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01618" FT /inference="protein motif:Prosite:PS01307" FT /protein_id="CAL34488.1" FT /translation="MDLSTILGMVLAVTSISVGDILEGGNPLHVVHLSSFLIVMPTAAF FT CAMTSTHKKIVKAAYKELKVVFKGSGVNLPERIAQLIEFAIIARRDGLLALESRTSEIE FT NEFLKNAMMMLVDGKSFEEIHESMEIQTEQLEEHYKECAEYWIVFGETCPTMGLVGAVF FT GLILALKLLDNPQAMAAGISGAFTATVTGIFGAYALFAPWGKKLKANGMDLVKEQIVIT FT EAIKGIAEGANPRDLEAKLFNFLSHDDPRISQFDKG" FT misc_feature complement(305034..305447) FT /note="HMMPfam hit to PF01618, MotA/TolQ/ExbB proton FT channel family, score 5.5e-09" FT /inference="protein motif:Pfam:PF01618" FT misc_feature complement(305109..305162) FT /note="PS01307 Flagellar motor protein motA family FT signature" FT /inference="protein motif:Prosite:PS01307" FT misc_feature complement(join(305565..305633,305208..305276, FT 305112..305180)) FT /note="3 probable transmembrane helices predicted for FT Cj0337c by TMHMM2.0 at aa 28-50, 147-169 and 179-201" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(305730..308369) FT /transl_table=11 FT /gene="polA" FT /locus_tag="Cj0338c" FT /product="DNA polymerase I" FT /EC_number="2.7.7.7" FT /note="Original (2000) note: Cj0338c, polA, probable DNA FT polymerase I, len: 879 aa; similar to many e.g. DPO1_ECOLI FT DNA POLYMERASE I (EC 2.7.7.7) (928 aa), fasta scores; opt: FT 1262 z-score: 1530.0 E(): 0, 36.1% identity in 920 aa FT overlap. 40.0% identity to HP1470. Contains PS00017 FT ATP/GTP-binding site motif A (P-loop), PS00447 DNA FT polymerase family A signature, Pfam match to entry PF00929 FT Exonuclease, Exonuclease, score -10.70, E-value 0.0024,and FT Pfam match to entry PF00476 DNA_pol_A, DNA polymerase FT family A, score 210.40, E-value 2.8e-59" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -DNA replication, restriction/modification, recombination FT and repair" FT /note="PMID:7035456" FT /db_xref="GOA:Q0PBH1" FT /db_xref="InterPro:IPR001098" FT /db_xref="InterPro:IPR002298" FT /db_xref="InterPro:IPR002421" FT /db_xref="InterPro:IPR002562" FT /db_xref="InterPro:IPR008918" FT /db_xref="InterPro:IPR012337" FT /db_xref="InterPro:IPR018320" FT /db_xref="InterPro:IPR019760" FT /db_xref="InterPro:IPR020045" FT /db_xref="InterPro:IPR020046" FT /db_xref="UniProtKB/TrEMBL:Q0PBH1" FT /inference="protein motif:Pfam:PF00476" FT /inference="protein motif:Pfam:PF00929" FT /inference="protein motif:Prosite:PS00447" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34489.1" FT /translation="MKTLTIVDTFGFFFRLYYALKGFKNSQGQASGMISGFANFIYSLK FT NEYKSDYIVFALDSKGKTFRSEIDPNYKQNRTPPPPELLEQIPICIKMIEKMGFISVSQ FT EGYEADDIIASFVKTCENRDIFVRIITQDKDLYQLIKDGKTSIYSPISKNDYDEAACLE FT KYGVKPNQIRDFLALCGDSSDNIPGVKGIGAKGAKTLLDEFGSIEGIYENLTLVRNERS FT RNLLLEGKENAFLSKKLASLYDNLEVQNLIEKATYPDEEPLLKILEILEHYELNTLLKK FT LRQNPDNKDKNLGFKATLVQDENKLFEILNTLDKESIIAFDTETTGLDTKEAKIVGFSF FT CMNENEAFYVPLTHNYLGVGEQISLQSAKKAIEVIFNHFVIGHNLKYDFKIIQNNFDLN FT LPQKYADTMILAWLKNPSLRVNMDDLALRLFNYETLHFESLVKKGENFASVELEKACKY FT AAEDAYITLRFYLYFLKNLETPLLELAKNCEFDFIKIIMMMEENGIKLDTNALEILMKK FT FENEIKNLSEEIYTLCEDRFNLNSPKQMGDILFEKLKLPSGKKGKTGYSTDEKVLNILL FT DKHPVIAKILDYRELAKLYSTYCEPLLKLALKDKNSRIYSSFLQTGTATGRLSSKDPNL FT QNIPAHGQYAKDYKSCFVAKDGFSFISLDYSQIELRILAHFSEDEKLLNAFANDEDIHA FT RTAIMIFGESNYETRSVAKSINFGLIYGMGYKTLSQNLKIEANLAKSYIEKYFENFTSI FT KKYFEKVKNEAKQNGFIVTLSGRKRYFDFENAKPMQIAMYERESINSILQGSAADVIKL FT AMLEINKELNEDKKLILQIHDELIFEVKDDLCENFVKKTRDIMENIVKLKVKLKTSSSI FT AKNWGDLK" FT misc_feature complement(305736..306854) FT /note="HMMPfam hit to PF00476, DNA polymerase family FT A,score 3.2e-110" FT /inference="protein motif:Pfam:PF00476" FT misc_feature complement(306186..306245) FT /note="PS00447 DNA polymerase family A signature" FT /inference="protein motif:Prosite:PS00447" FT misc_feature complement(306936..307481) FT /note="HMMPfam hit to PF01612, 3'-5' exonuclease, score FT 3e-25" FT /inference="protein motif:Pfam:PF01612" FT misc_feature complement(307575..307871) FT /note="HMMPfam hit to PF01367, 5'-3' exonuclease,C-terminal FT SAM fold, score 4.4e-42" FT /inference="protein motif:Pfam:PF01367" FT misc_feature complement(307875..308366) FT /note="HMMPfam hit to PF02739, 5'-3' exonuclease,N-terminal FT resolvase-, score 5.4e-48" FT /inference="protein motif:Pfam:PF02739" FT misc_feature complement(308181..308204) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 308533..309894 FT /transl_table=11 FT /locus_tag="Cj0339" FT /product="putative MFS (Major Facilitator Superfamily) FT transport protein" FT /note="Original (2000) note: Cj0339, probable transmembrane FT transport protein, len: 453 aa; similar to e.g. YDFJ_ECOLI FT hypothetical metabolite transport protein (427 aa), fasta FT scores; opt: 1214 z-score: 1428.6 E(): 0,42.5% identity in FT 416 aa overlap, and SHIA_ECOLI shikimate transporter (438 FT aa), fasta scores; opt: 876 z-score: 1104.0 E(): 0, 32.3% FT identity in 421 aa overlap. No Hp ortholog. Contains Pfam FT match to entry PF00083 sugar_tr,Sugar (and other) FT transporters, score 123.20, E-value 4.9e-33" FT /note="Updated (2006) note: Ten probable transmembrace FT helices identified by TMHMM2.0 within CDS. Pfam domain FT PF07690 Major Facilitator Superfamily protein identified FT within CDS. Prosite PS50850 MFS, Major facilitator FT superfamily also identifed within CDS. Product modified to FT new family member based on motif match. No specific FT characterisation has been carried out yet. Putative kept FT within product function. Functional classification FT -Transport/binding proteins - Other" FT /note="PMID:15919996" FT /db_xref="GOA:Q0PBH0" FT /db_xref="InterPro:IPR005828" FT /db_xref="InterPro:IPR016196" FT /db_xref="InterPro:IPR020846" FT /db_xref="UniProtKB/TrEMBL:Q0PBH0" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF07690" FT /inference="protein motif:Pfam:PF00083" FT /inference="protein motif:Prosite:PS50850" FT /protein_id="CAL34490.1" FT /translation="MTNQQIDGIADKNFNTPEGRKVFKKAVFSCWLGTAMEYADFALYG FT LAAATIFSEVFFPEQTPVIALLLSFVTYGIGFIARPIGALFFGHLGDKHGRKNVMMATI FT ALMGISTTLIGFIPSYAVIGVWAPICLVALRFMQGFGAGAELSGGTVMLAEYAPSKRRG FT LVSSVIALGSNSGTLLASFVWLLMVQMDEASFKEWGWRVPFMGSILIALFAVYIRFHVK FT ETPVFEKQKNEMMKLRLNNEKHMKKDERSFWQRSRAFWTMVGLRIGENGPSYLAQGFIV FT GYVTKILLLDKSVATTAVMIASLVGFLVIPLAGYLSDKFGRCITYRMFCLLLMIYAFPA FT FMLLDSKNEIIVILTIIVGMSLASLGIFGVQAAWGVELFGVKNRYTKMAFAKELGSILS FT GGTAPMVASALLAYYGSWWPIATYFVLTAGIGFVTTFFAPETRGRDLNKIEDAI" FT misc_feature 308605..309891 FT /note="HMMPfam hit to PF00083, Sugar (and other) FT transporter, score 1.3e-35" FT /inference="protein motif:Pfam:PF00083" FT misc_feature 308620..309768 FT /note="HMMPfam hit to PF07690, Major Facilitator FT Superfamily, score 2.5e-24" FT /inference="protein motif:Pfam:PF07690" FT misc_feature order(308620..308688,308716..308784,308845..308913, FT 309022..309090,309124..309192,309412..309480, FT 309499..309558,309586..309654,309712..309771, FT 309781..309849) FT /note="10 probable transmembrane helices predicted for FT Cj0339 by TMHMM2.0 at aa 30-52, 62-84, 105-127, FT 164-186,198-220, 294-316, 323-342, 352-374, 394-413 and FT 417-439" FT /inference="protein motif:TMHMM:2.0" FT CDS 309891..310898 FT /transl_table=11 FT /locus_tag="Cj0340" FT /product="putative nucleoside hydrolase" FT /note="Original (2000) note: Cj0340, possible nucleoside FT hydrolase, len: 335 aa; similar to hypothetical proteins FT e.g. YAAF_ECOLI (304 aa), fasta scores; opt: 252 z-score: FT 377.2 E(): 9.4e-14, 25.9% identity in 309 aa overlap, and FT to the eukaryotic IUNH_CRIFA inosine-uridine preferring FT nucleoside hydrolase (314 aa), fasta scores; opt: 261 FT z-score: 363.4 E(): 5.5e-13, 25.3% identity in 296 aa FT overlap. No Hp match. Contains Pfam match to entry PF01156 FT IU_nuc_hydro, Inosine-uridine preferring nucleoside FT hydrolase, score -11.20, E-value 4.8e-12" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity score has been carried out yet. FT Putative kept within product function. Functional FT classification - Salvage of nucleosides and nucleotides" FT /note="PMID:10409664" FT /db_xref="GOA:Q0PBG9" FT /db_xref="InterPro:IPR001910" FT /db_xref="InterPro:IPR023186" FT /db_xref="UniProtKB/TrEMBL:Q0PBG9" FT /inference="protein motif:Pfam:PF01156" FT /protein_id="CAL34491.1" FT /translation="MRLILDTDIGNAIAGANTDDGLALALILSSKEIKLEMLSTVCGNV FT PSLVAYSVAKDLFQRLNLNIPVYLGANEALKEPSKAWRQRLDESVKNFKLEYLWENIKS FT PEILENINPDAIFKMGELVSKNPKEISICAIGPLTNIAMTMKIFKDFDINLKELFIMGG FT SFDMPYYTKDTNFGFDPEAASIVLNSRAKITLIPYNATMQTLLTHEDLKELQGKNILCD FT FIVETLGVWIDYASKTRGTKGTWIHDALTIACALDSSIADFDECYADVICDSSLARGMS FT WRCFREPKMSMGVDLSTKNCVKILKNVDNARLLKLIKERLLKGVCYENYESITT" FT misc_feature 309891..310808 FT /note="HMMPfam hit to PF01156, Inosine-uridine preferring FT nucleoside hy, score 5.1e-18" FT /inference="protein motif:Pfam:PF01156" FT CDS complement(310854..311297) FT /transl_table=11 FT /locus_tag="Cj0341c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0341c, possible integral FT membrane protein, len: 147 aa; similar to hypothetical FT membrane proteins e.g. Y489_HAEIN HI0489 (157 aa), fasta FT scores; opt: 252 z-score: 350.5 E(): 2.9e-12, 34.0% FT identity in 159 aa overlap. No Hp match" FT /note="Updated (2006) note: Four probable transmembrace FT helices identified by TMHMM2.0 within CDS. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="InterPro:IPR015414" FT /db_xref="UniProtKB/TrEMBL:Q0PBG8" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34492.1" FT /translation="MFDFLYNDISYLGLFMVCFLSSTLLPLASEAFVLGFIKLDFNPNL FT VLIVATLGNTLGSLSTYALAYFGKEKILEKYFSKSLKKLENFNANFAKFGSIFAFFTFL FT PLVGDLFALGLGFAKYSFLKTIFFILLGKLSRYTFIIFIANSF" FT misc_feature complement(join(311187..311255,311100..311168, FT 310944..311012,310866..310925)) FT /note="4 probable transmembrane helices predicted for FT Cj0341c by TMHMM2.0 at aa 15-37, 44-66, 96-118 and 125-144" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(311205..311297) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000151_310854_311297 by SignalP 2.0 FT HMM (Signal peptide probability 0.782) with cleavage site FT probability 0.728 between residues 31 and 32" FT CDS complement(311302..314127) FT /transl_table=11 FT /gene="uvrA" FT /locus_tag="Cj0342c" FT /product="excinuclease ABC subunit A" FT /note="Original (2000) note: Cj0342c, uvrA, probable FT excinuclease ABC subunit A, len: 941 aa; highly similar to FT many e.g. UVRA_ECOLI excinuclease ABC subunit A (940 FT aa),fasta scores; opt: 1914 z-score: 3636.7 E(): 0, 51.4% FT identity in 935 aa overlap. 68.6% identity to HP0705. FT Contains 2x PS00017 ATP/GTP-binding site motif A FT (P-loop),2x PS00211 ABC transporters family signature and FT Pfam match to entry PF00005 ABC_tran, ABC transporters, FT score 71.80, E-value 1.4e-17" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -DNA replication, restriction/modification, recombination FT and repair" FT /note="PMID:1826851" FT /db_xref="GOA:Q0PBG7" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR004602" FT /db_xref="InterPro:IPR013815" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/TrEMBL:Q0PBG7" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34493.1" FT /translation="MNDTIKIIGARENNLKNIHLEIPKNKLIVFTGLSGSGKSTLAFGT FT LYAEGQRRYIESLSAYARQFLDKVGKPDVDKIEGLTPAIAIDQKTTSKNPRSTVGTITE FT IYDYLRLLYARVGIQHCHRCGQKISSMSVSDIVSEILKFPKGAKIIIYSPLIREKKGTY FT ADLLENLRNKGYVRAQIDGVLVRLDEEIELAKTKKHTIKLVIDRLEIQEDLLSRLASDI FT EKGLQESFGEIEIEVLNHEEINLNKHYHFSEHSACFDCKISFVPLEPLSFSFNSPKGAC FT EACDGLGIRYTLDMKKIIDENLSLENGAVKIMYGFNKSYYYKFLIAFCEQNEIPIKIPF FT MQLNEVQKRLVLYGNAKTIEFLWKRNRLKRTFEGVVKMAYEMLKDEKDLAEYMSEKICK FT DCGGHRLKPESLAVKVAKKSLGEILDMSIEDSTAFFADEKNFSYLSEQQKLISKPILKE FT INERLFFLYDVGLGYLSLGRDARTISGGEAQRIRIASQIGSGLSGVMYVLDEPSIGLHE FT RDTAKLIKTLRNLQQKGNTLIVVEHDKMTIEEADFIVDIGPKAGKFGGEVVFSGTYKEL FT LKSKSETALYMNGKKQISQLQNRTQKEWLELKNVNINNIQDLSVKFPLQNLVAITGVSG FT SGKSSLILQTLLPFAQEELNRAKKVKKLGGVQIEGLEKLDKVIYLDQSPIGRTPRSNPA FT TYTGAMDEIRNLFAATKEAKMRGYKAGRFSFNVKGGRCEKCSGDGEIKIEMHFLPDVMV FT VCDTCGGKRYNDATLEIKYKGKNISEILNMSVLEASEFFTAVPKIKQKLDTLVKVGLDY FT LTLGQNATTLSGGEAQRIKLAKELSRSDTGKTLYILDEPTTGLHFEDVNKLILVLQHLV FT DLKNSVFVIEHNLDVIKNADYIIDMGPEGGVKGGKVISTGSVEKVAKEHKKTRSYTGYY FT LDLELKNTQKS" FT misc_feature complement(311437..312255) FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 9.1e-19" FT /inference="protein motif:Pfam:PF00005" FT misc_feature complement(311620..311664) FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature complement(312211..312234) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature complement(312637..312681) FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature complement(314011..314034) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(314200..314985) FT /transl_table=11 FT /locus_tag="Cj0343c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0343c, probable integral FT membrane protein, len: 261 aa; similar to many hypothetical FT membrane proteins e.g. Y441_METJA MJ0441 (267 aa), fasta FT scores; opt: 152 z-score: 301.8 E(): 1.5e-09,30.7% identity FT in 257 aa overlap. 45.1% identity to HP0677 and 44.0% FT identity to HP0226" FT /note="Updated (2006) note: Nine probable transmembrace FT helices identified by TMHMM2.0 within CDS. Pfam PF01925 FT Domain of unknown function (DUF81) protein identified FT within CDS. Further support given to product function. FT Functional classification - Membranes, lipoproteins and FT porins" FT /db_xref="GOA:Q0PBG6" FT /db_xref="InterPro:IPR002781" FT /db_xref="UniProtKB/TrEMBL:Q0PBG6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01925" FT /protein_id="CAL34494.1" FT /translation="MEITDLPYLIIGIISGIASGLFGIGGGMIIVPSMFALGASAHHAI FT GISVLQMIFAAVFGSYINYKKKNLNLKDGIMIGFGGLIGASFSGMLLKALSDVALTSVF FT LAVSCIFFIKYAFGIKENIVQNQRSVWVKNVILFIAGAFTGIFAISLGIGGGLLIAPIL FT AYFLGYDSKKVVSLSLFFVIFASVSGIISFSNSGVIDSEVIHKGILVGIASMVGVFIGI FT KIIEKMHISAHRKILLCVYALSILGTTHSLLNKLNFINF" FT misc_feature complement(join(314893..314961,314797..314865, FT 314710..314763,314629..314697,314542..314595, FT 314479..314532,314407..314466,314311..314379, FT 314209..314277)) FT /note="9 probable transmembrane helices predicted for FT Cj0343c by TMHMM2.0 at aa 9-31, 41-63, 75-92, FT 97-119,131-148, 152-169, 174-193, 203-225 and 237-259" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(314239..314970) FT /note="HMMPfam hit to PF01925, Domain of unknown function FT DUF81, score 2.6e-34" FT /inference="protein motif:Pfam:PF01925" FT misc_feature complement(314659..314691) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 315108..315233 FT /transl_table=11 FT /locus_tag="Cj0344" FT /product="hypothetical protein Cj0344" FT /note="Original (2000) note: Cj0344, unknown, len: 41 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBG5" FT /protein_id="CAL34495.1" FT /translation="MFQNIIKYKDFIIFILNLKQNLYLLIKINLDFKNFHKSLNF" FT CDS 315398..316648 FT /transl_table=11 FT /gene="trpE" FT /locus_tag="Cj0345" FT /product="putative anthranilate synthase component I" FT /EC_number="4.1.3.27" FT /note="Original (2000) note: Cj0345, trpE, possible FT anthranilate synthase component I, len: 416 aa; similar in FT C-terminal half to many e.g. TRPE_CLOTM anthranilate FT synthase component I (EC 4.1.3.27) (494 aa), fasta scores; FT opt: 784 z-score: 1209.9 E(): 0, 47.0% identity in 281 aa FT overlap. 35.6% identity in 365 aa overlap to HP1282. FT Contains Pfam match to entry PF00425 FT chorismate_bind,chorismate binding enzyme, score 309.50, FT E-value 3.9e-89" FT /note="Updated (2006) note: Characterised within FT Clostridium thermocellum with acceptable identity FT score,however, sequence alignment was only partial. FT Thus,putative kept within product function. Functional FT classification - Amino acid biosynthesis - Aromatic amino FT acid family" FT /note="PMID:2732211, PMID:789357" FT /db_xref="GOA:Q0PBG4" FT /db_xref="InterPro:IPR005801" FT /db_xref="InterPro:IPR015890" FT /db_xref="InterPro:IPR019999" FT /db_xref="UniProtKB/TrEMBL:Q0PBG4" FT /inference="protein motif:Pfam:PF00425" FT /protein_id="CAL34496.1" FT /translation="MFVKNVNFYYRQILEKFENSYFAEDLTKVIIGIDCDYLDANELSF FT SEFKAKYYEALSKNKICDFAGFFGVFSANFVSLFEKIPLSSKKNYDFPLFLFANAKAYL FT IYEKNSKMFFKFGASKYFEYLKDDIEPMKKKQKNDFEILNSLEDEKNDFLKMCEKAKEY FT LLSGDIFQVVLSKQLCIKHQVNAFDYYESLSALNPSAYMFYFPSKYGVVLGSSPEFLLK FT IKKREIYLAPIAGTRNLENNCDLLALEKDLLSDEKELSEHKMLVDLARNDASKFGTQTR FT VENLFSIIKNKFVMHIVSEVYANMKEDASIFDVIEAVFPAGTLSGAPKIRALEITSELE FT DCDRGIYGGAVGFLNFNEDITLAILIRCAFFTQDKAYLASGAGIVLQSESQKEYAEICA FT KRKALLVAFENLKKENQ" FT misc_feature 315842..316621 FT /note="HMMPfam hit to PF00425, chorismate binding FT enzyme,score 1.1e-90" FT /inference="protein motif:Pfam:PF00425" FT CDS 316645..318246 FT /transl_table=11 FT /gene="trpD (trpGD)" FT /locus_tag="Cj0346" FT /product="anthranilate synthase component II" FT /EC_number="4.1.3.27" FT /note="Original (2000) note: Cj0346, trpD (trpGD),probable FT anthranilate synthase component II, len: 533 aa; (contains FT glutamine amidotransferase and anthranilate FT phosphoribosyltransferase) similar to many e.g. TRPG_ECOLI FT anthranilate synthase component II (EC 4.1.3.27) (530 FT aa),fasta scores; opt: 866 z-score: 781.3 E(): 0, 32.6% FT identity in 528 aa overlap. N-terminus has 34.6% identity FT to HP1281, C-terminus is 33.2% identity to HP1280. Contains FT PS00442 Glutamine amidotransferases class-I active site and FT Pfam matches to entry PF00117 GATase,Glutamine FT amidotransferases class-I, score 252.00, E-value 8.4e-72 FT and to entry PF00591 Glycos_transf_3, glycosyl transferase FT family, score 138.60, E-value 1.1e-37" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Amino acid biosynthesis - Aromatic amino acid family" FT /note="PMID:6283099, PMID:4594441, PMID:789357" FT /db_xref="GOA:Q0PBG3" FT /db_xref="InterPro:IPR000312" FT /db_xref="InterPro:IPR005940" FT /db_xref="InterPro:IPR006221" FT /db_xref="InterPro:IPR017926" FT /db_xref="InterPro:IPR020072" FT /db_xref="UniProtKB/TrEMBL:Q0PBG3" FT /inference="protein motif:Pfam:PF00591" FT /inference="protein motif:Pfam:PF00117" FT /inference="protein motif:Prosite:PS00442" FT /protein_id="CAL34497.1" FT /translation="MILLIDNYDSFVFNVKSMLEQLSNDEILVRRNDAISLSEIKNLNP FT THIILSPGPKHPSQSGICLEIFKARLNIPVLGICLGHQALALAFDSLVVKMQEPMHAKN FT SLIKQCRENELFSNLPSNFSVMRYHSLEVKQLSDELEILALDEKGVIMALGHKNLPYYG FT VQFHPESYFSEYGLQLFSNFLKQDIKKPQKQENPLSFYLQKMSENHFLQSDDFEQICKI FT IMSKDYEILQVVALLILITEKSLNEKSLSAFVRQILRYSQTFSDESEMIDICGTGGDGF FT KSINVSTTSAFILAALGVKVAKHGNRAISSSSGSTDVLEALNITTPNTLESVLKQLNNQ FT GLSFLHAPFFHPLVGELKEIRSRLGVRTVFNVLGPLLHPNLKLKYQLMGNYHAPVHRLL FT IEVLKNLGRKKALVVRGNDGMDELSICDESKIYELCEGEILEYSICPEQFGFKRAFHSE FT IIGSSAYDNAKDLKDILSGRMQGAKFDLVVLNAMFALYTANKASSPLVAKDMILEAIYS FT GKVIEYFKEYQAYAKA" FT misc_feature 316651..317205 FT /note="HMMPfam hit to PF00117, Glutamine amidotransferase FT class-I, score 5.4e-61" FT /inference="protein motif:Pfam:PF00117" FT misc_feature 316864..316899 FT /note="PS00442 Glutamine amidotransferases class-I active FT site" FT /inference="protein motif:Prosite:PS00442" FT misc_feature 317443..318207 FT /note="HMMPfam hit to PF00591, Glycosyl transferase family, FT a/b doma, score 2.5e-78" FT /inference="protein motif:Pfam:PF00591" FT CDS 318233..318832 FT /transl_table=11 FT /gene="trpF" FT /locus_tag="Cj0347" FT /product="N-(5'-phosphoribosyl)anthranilate isomerase" FT /EC_number="5.3.1.24" FT /note="Original (2000) note: Cj0347, trpF, probable FT N-(5'-phosphoribosyl)anthranilate isomerase, len: 199 aa; FT similar to many trpF e.g. TRPF_LACCA FT N-(5'-phosphoribosyl)anthranilate isomerase (199 aa) (EC FT 5.3.1.24), fasta scores; opt: 271 z-score: 352.4 E(): FT 2.3e-12, 31.0% identity in 200 aa overlap, and to the trpF FT domain of many trpC proteins e.g. TRPC_SALTY FT indole-3-glycerol phosphate synthase, fasta scores; opt: FT 307 z-score: 394.5 E(): 1e-14, 30.8% identity in 201 aa FT overlap. 38.2% identity to C-terminus of HP1279 (trpC) FT Conatains Pfam match to entry PF00697 FT PRAI,N-(5'phosphoribosyl)antranilate (PRA) isomerase, score FT 102.30, E-value 9.5e-27" FT /note="Updated (2006) note: Search results match to more FT than one isomerase with marginal identity scores. Putative FT not added to product function. Functional classification FT -Amino acid biosynthesis - Aromatic amino acid family" FT /note="PMID:2299982, PMID:2184433, PMID:789357" FT /db_xref="GOA:Q9PIF3" FT /db_xref="InterPro:IPR001240" FT /db_xref="InterPro:IPR011060" FT /db_xref="InterPro:IPR013785" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIF3" FT /inference="protein motif:Pfam:PF00697" FT /protein_id="CAL34498.1" FT /translation="MLKLKICGIKDEKNAKDLAFLNIDFFGLIFAKSPRRVSLEQARNL FT SAIFHEKDKKVVGVFVDENLEQILRCIKEAKLDGIQIYRTITKEEFEILKVQNVFVWQV FT ISVENSLDLKSEIFANLVLFDAKGILKGGNGISFDWTLLGSYTKDFILAGGIGLDNVHK FT AVKTGAKILDLNSKLEDEKGLKDINKIKQILKELKK" FT misc_feature 318242..318820 FT /note="HMMPfam hit to FT PF00697,N-(5'phosphoribosyl)anthranilate (PRA) isome, score FT 4.5e-31" FT /inference="protein motif:Pfam:PF00697" FT CDS 318829..320007 FT /transl_table=11 FT /gene="trpB" FT /locus_tag="Cj0348" FT /product="tryptophan synthase beta chain" FT /EC_number="4.2.1.20" FT /note="Original (2000) note: Cj0348, trpB, probable FT tryptophan synthase beta chain, len: 392 aa; highly similar FT to many e.g. TRPB_THEMA tryptophan synthase beta chain (EC FT 4.2.1.20) (389 aa), fasta scores; opt: 1476 z-score: 2082.2 FT E(): 0, 59.9% identity in 384 aa overlap. 56.4% identity to FT HP1278. Conatains PS00168 Tryptophan synthase beta chain FT pyridoxal-phosphate attachment site,PS00017 ATP/GTP-binding FT site motif A (P-loop), and Pfam match to entry PF00247 FT trp_syntB, Tryptophan synthases,beta chain, score 806.40, FT E-value 1e-238" FT /note="Updated (2006) note: Pfam domain PF00291 FT Pyridoxal-phosphate dependent enzyme protein identified FT within CDS. Further support given to product function. FT Characterised within Thermotoga maritima with acceptable FT identity score. Putative not added to product function. FT Functional classification - Amino acid biosynthesis FT -Aromatic amino acid family" FT /note="PMID:7556082, PMID:789357" FT /db_xref="GOA:Q9PIF2" FT /db_xref="InterPro:IPR001926" FT /db_xref="InterPro:IPR006653" FT /db_xref="InterPro:IPR006654" FT /db_xref="InterPro:IPR023026" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIF2" FT /inference="protein motif:Pfam:PF00291" FT /inference="protein motif:Pfam:PF00247" FT /inference="protein motif:Prosite:PS00017" FT /inference="protein motif:Prosite:PS00168" FT /protein_id="CAL34499.1" FT /translation="MKKAYYGDFGGQFLPESAMFALNELEGAFLKFSKDKLFKKELNEL FT LKTYVGRPTPLYFARNLSKKYQHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKII FT AETGAGQHGLATATAAALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLKTL FT KEATTAAIQAWVGDIKNIFYVVGSAVGPYPYPKMVMHFQSIIGKECKMQLQKLNKKVDY FT IIAAVGGGSNAAGIFYDFIKDENVKLIGIEAGGLGIDTPYHAATLNKGKTGIIHGMKTK FT VLQDDLGNILPVHSVSAGLDYPGIGPLHAFLFESKRAQYHAISDEECMQALKLLCKEEG FT IIAAIESSHALAFLEKLCPTLKKKSVIVVNLSGRGDKDMQMIRDYKKGVIYG" FT misc_feature 318967..319950 FT /note="HMMPfam hit to PF00291, Pyridoxal-phosphate FT dependent enzyme, score 1.8e-108" FT /inference="protein motif:Pfam:PF00291" FT misc_feature 319057..319086 FT /note="PS00168 Tryptophan synthase beta chain FT pyridoxal-phosphate attachment site" FT /inference="protein motif:Prosite:PS00168" FT misc_feature 319621..319644 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 320000..320749 FT /transl_table=11 FT /gene="trpA" FT /locus_tag="Cj0349" FT /product="tryptophan synthase alpha chain" FT /EC_number="4.2.1.20" FT /note="Original (2000) note: Cj0349, trpA, probable FT tryptophan synthase alpha chain, len: 249 aa; similar to FT many e.g. TRPA_LACLA tryptophan synthase alpha chain (EC FT 4.2.1.20) (253 aa), fasta scores; opt: 525 z-score: 854.2 FT E(): 0, 38.5% identity in 239 aa overlap. 30.3% identity to FT HP1277. Contains PS00167 Tryptophan synthase alpha chain FT signature and Pfam match to entry PF00290 FT trp_syntA,Tryptophan synthase alpha chain, score 260.90, FT E-value 1.8e-74" FT /note="Updated (2006) note: Characterised within FT Lactococcus lactis with acceptable identity scores. FT Putative not added to product function. Functional FT classification - Amino acid biosynthesis - Aromatic amino FT acid family" FT /note="PMID:1400208, PMID:789357" FT /db_xref="GOA:Q9PIF1" FT /db_xref="InterPro:IPR002028" FT /db_xref="InterPro:IPR011060" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR018204" FT /db_xref="PDB:3THA" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIF1" FT /inference="protein motif:Pfam:PF00290" FT /inference="protein motif:Prosite:PS00167" FT /protein_id="CAL34500.1" FT /translation="MVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELG FT VAYSDPIADGEIIADAAKIALDQGVDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEK FT FVKKAKSLGICALIVPELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKG FT FIYLLASIGITGTKSVEEAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVI FT VGTSIVKCFKQGNLDIIMKDIEEIFKK" FT misc_feature 320009..320746 FT /note="HMMPfam hit to PF00290, Tryptophan synthase alpha FT chain, score 2.2e-73" FT /inference="protein motif:Pfam:PF00290" FT misc_feature 320123..320164 FT /note="PS00167 Tryptophan synthase alpha chain signature" FT /inference="protein motif:Prosite:PS00167" FT CDS 320820..321242 FT /transl_table=11 FT /locus_tag="Cj0350" FT /product="hypothetical protein Cj0350" FT /note="Original (2000) note: Cj0350, unknown, len: 140 aa; FT no Hp match. . Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBF9" FT /protein_id="CAL34501.1" FT /translation="MLKILEYSITHFCEHILRLRIEAAQDISGELYGASIPIMGKSEGE FT CNFYLFFPKEFLKKIAEILINDEKFKEDDWCDLTKECANQIIGYAKNLLNDAKGDDEYK FT LGIPEYLGKVDFSEIVLDEALTYKFENCYFRIGYCK" FT CDS 321242..321550 FT /transl_table=11 FT /gene="fliN" FT /locus_tag="Cj0351" FT /product="flagellar motor switch protein" FT /note="Original (2000) note: Cj0351, fliN, flagellar motor FT switch protein, len: 102 aa; identical to TR:O32370 FT (EMBL:AJ000400), and similar to many e.g. FLIN_ECOLI FT flagellar motor switch protein FLIN (137 aa), fasta scores; FT opt: 196 z-score: 359.1 E(): 9.5e-13, 36.0% identity in 89 FT aa overlap. 53.4% identity to HP0584" FT /note="Updated (2006) note: Pfam PF01052 Surface FT presentation of antigens (SPOA) protein identified within FT CDS. Further support given to product function. FT Characterisation paper identified within Campylobacter FT jejuni and also Escherichia coli. Putative not added to FT product function. Functional classification - Surface FT structures" FT /note="PMID:9894591, PMID:2651416" FT /db_xref="GOA:O32370" FT /db_xref="InterPro:IPR001172" FT /db_xref="InterPro:IPR001543" FT /db_xref="UniProtKB/TrEMBL:O32370" FT /inference="protein motif:Pfam:PF01052" FT /protein_id="CAL34502.1" FT /translation="MSDDIEFNIHHGLLQSYEDILDITVDFVSELGTTNMSVAELLKLE FT VGSVIDLEKPAGESVELYINKRIFGKGEVMVYEKNLAIRINEILDSKTVLQYFKKEI" FT misc_feature 321287..321517 FT /note="HMMPfam hit to PF01052, Surface presentation of FT antigens (SPOA) prot, score 9e-34" FT /inference="protein motif:Pfam:PF01052" FT CDS 321551..322348 FT /transl_table=11 FT /locus_tag="Cj0352" FT /product="putative transmembrane protein" FT /note="Original (2000) note: Cj0352, probable transmembrane FT protein, len: 265 aa; 99.6% identity to TR:O32371 FT (EMBL:AJ000400). No Hp match. Contains probable N-terminal FT signal sequence and transmembrane domain around aa 160" FT /note="Updated (2006) note: Two probable transmembrane FT helices identified by TMHMM2.0 within CDS. Literature FT search identified paper linking CDS with potential new FT functional assignment as FliO flagellar protein. Functional FT classification - Membranes, lipoproteins and porins" FT /note="PMID:15817382, PMID:9894591" FT /db_xref="GOA:Q0PBF7" FT /db_xref="UniProtKB/TrEMBL:Q0PBF7" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34503.1" FT /translation="MRLLVLFFLILPLYSVELISYNIYDRNDRVDLMLSFDNAYNGKIS FT QKKEKNLTLLTFSDLTYSKDELKELNSQLVDKISISSKNNNTYIMLQNKQNINLELSSI FT NDKFGVRIRAIEQGKANIESAPTTTANNSQELMPKPKSTSLEGYDYTNYILVMLILVIL FT LIVLWWFKKTMVYKNNNVSRDFTMIFQRFLDKNNQLVVFDHANKRYTMIIGNSNVLLES FT IEIPEEQTIKHTEKTEKNFDSFFEENKKRIQNLIEQRQKGKKS" FT misc_feature order(321563..321622,322007..322060) FT /note="2 probable transmembrane helices predicted for FT Cj0352 by TMHMM2.0 at aa 5-24 and 153-170" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(322345..323805) FT /transl_table=11 FT /locus_tag="Cj0353c" FT /product="phosphatase" FT /EC_number="3.6.1.11" FT /EC_number="3.6.1.40" FT /note="Original (2000) note: Cj0353c, probable phosphatase, FT len: 486 aa; similar to e.g. GPPA_ECOLI FT guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase FT (EC 3.6.1.40) (494 aa), fasta scores; opt: 368 z-score: FT 272.7 E(): 6.2e-08, 25.8% identity in 480 aa overlap, and FT to PPX_ECOLI EXOPOLYPHOSPHATASE (EC 3.6.1.11) (512 FT aa),fasta scores; opt: 340 z-score: 350.9 E(): 2.7e-12, FT 23.8% identity in 441 aa overlap. 41.0% identity to HP0278" FT /note="Updated (2006) note: Pfam domain PF02541 Ppx/GppA FT phosphatase family identified within CDS. Further support FT given to product function. Similar to many different FT annotated phosphatases. Putative not added to product FT function. Functional classification - Misc" FT /note="PMID:8394006" FT /db_xref="GOA:Q0PBF6" FT /db_xref="InterPro:IPR003695" FT /db_xref="UniProtKB/TrEMBL:Q0PBF6" FT /inference="protein motif:Pfam:PF02541" FT /protein_id="CAL34504.1" FT /translation="MAKKTAVVDLGSNSIRMVIFEKTSRYGFYTTCEYKRKVRLGENAY FT NNGKILQEEAMQRAEDALAFFKQCALKHKCKKIFIVGTSALRDAPNSKNFIKRIKDNLS FT LNIRCIDGKSESYLGGLAALNLLSPFKDGTTLDIGGGSSELCLIKNNRIISCISLDIGT FT VRLKELFYDTGKMDSLEEFIKPILEQIPKEFCNQNLIAIGGSLRAISNSIMQKNSYPLK FT NLHDFRYMLDEEKGHILKIFNSNLDSLINFGIKKDRFDTIKEGIFIFLKIAEKIKAKQV FT ITSGVGIREGVYLQDLLRPKITFPPNFNPSLKCLQDKFLQSKQKNKTPHFALQIFTTLK FT NLHKLNDNYKHTLLNAAKLCHIGEYLNFYFANEHSAHFVLGGLNYGFSHKEKALIASII FT KLNGKKVNPYNLEPYKQLLPNIHTISWLNFILCLAKTLSANEDKIDFAFANNTLYIYQE FT NKILNLPKDELKKIAKPATIALAINQKI" FT misc_feature complement(322906..323754) FT /note="HMMPfam hit to PF02541, Ppx/GppA phosphatase family, FT score 1.5e-46" FT /inference="protein motif:Pfam:PF02541" FT CDS complement(323805..324050) FT /transl_table=11 FT /gene="fdxB" FT /locus_tag="Cj0354c" FT /product="ferredoxin" FT /note="Original (2000) note: Cj0354c, fdxB, probable FT ferredoxin, len: 81 aa; similar to many e.g. FER_CHRVI FT ferredoxin (82 aa), fasta scores; opt: 282 z-score: 445.5 FT E(): 1.5e-17, 45.3% identity in 75 aa overlap. 58.4% FT identity to HP0277. Also similar to Cj0333c (fdx); 38.8% FT identity in 67 aa overlap. Contains PS00198 4Fe-4S FT ferredoxins, iron-sulfur binding region signature and Pfam FT match to entry PF00037 fer4, 4Fe-4S ferredoxins and related FT iron-sulfur cluster binding domains., score 39.00,E-value FT 4.8e-10" FT /note="Updated (2006) note: Characterised within Chromatium FT vinosum with acceptable identity scores. Appropriate motifs FT also present. Putative not added to product function. FT Functional classification - Energy metabolism - Electron FT transport" FT /note="PMID:8765743" FT /db_xref="GOA:Q0PBF5" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR017900" FT /db_xref="UniProtKB/TrEMBL:Q0PBF5" FT /inference="protein motif:Pfam:PF00037" FT /inference="protein motif:Prosite:PS00198" FT /protein_id="CAL34505.1" FT /translation="MSLLITKDCVCCDACREECPDEAIYENSPIYVIDPDLCSECVNDF FT SEPACIVACPYECIIPDPDNVETIEELKLKHRDREF" FT misc_feature complement(323976..324047) FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 0.0069" FT /inference="protein motif:Pfam:PF00037" FT misc_feature complement(323991..324026) FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT CDS complement(324163..324834) FT /transl_table=11 FT /locus_tag="Cj0355c" FT /product="two-component regulator" FT /note="Original (2000) note: Cj0355c, probable FT two-component regulator, len: 223 aa; similar to many e.g. FT CZCR_ALCEU transcriptional activator protein CZCR (225 aa), FT fasta scores; opt: 375 z-score: 570.8 E(): 1.5e-24,31.7% FT identity in 218 aa overlap. 59.9% identity to HP1043. FT Contains Pfam match to entry PF00072 response_reg,Response FT regulator receiver domain, score 70.70, E-value 3.1e-17 and FT Pfam match to entry PF00486 trans_reg_C,Transcriptional FT regulatory protein, C terminal, score 56.60, E-value FT 1.5e-15" FT /note="Updated (2006) note: Characterisation work within FT many e.g. Ralstonia metallidurans and Escherichia coli with FT marginal identity scores. Appropriate motifs also present. FT Putative not added to product function. Literature search FT identified paper giving further clues to product function FT (PMID:15901688). Functional classification - Signal FT transduction" FT /note="PMID:9044283, PMID:15901688" FT /db_xref="GOA:Q0PBF4" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR001867" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:Q0PBF4" FT /inference="protein motif:Pfam:PF00486" FT /inference="protein motif:Pfam:PF00072" FT /protein_id="CAL34506.1" FT /translation="MRILVIEDEISLNKTIIDNLNEFGYQTDSSENFKDGEYFIGIRHY FT DLVLANWTLPDGDGAELVNTIKHKSPRTSVMIMSSKTDKETEIKALKAGADDFVKKPLD FT FDILLARIEARLRLGGTNVIKIEDLVIDPDEEKITYKGQDIELKGKPFEVLTHLARHSD FT QIVSKEQLLDAIWEEPELVTPNVIEVAINQIRQKMDKPLNISTIETVRRRGYRFCFPKK FT S" FT misc_feature complement(324184..324411) FT /note="HMMPfam hit to PF00486, Transcriptional regulatory FT protein, C te, score 4.2e-20" FT /inference="protein motif:Pfam:PF00486" FT misc_feature complement(324475..324834) FT /note="HMMPfam hit to PF00072, Response regulator receiver FT domain, score 4e-19" FT /inference="protein motif:Pfam:PF00072" FT CDS complement(324913..325230) FT /transl_table=11 FT /gene="folB" FT /locus_tag="Cj0356c" FT /product="putative dihydroneopterin aldolase" FT /EC_number="4.1.2.25" FT /note="Original (2000) note: Cj0356c, unknown, len: 105 aa; FT 31.0% identity to HP1510" FT /note="Updated (2006) note: Pfam domain PF02152 FolB FT Dihydroneopterin aldolase was identified within CDS. This FT enzyme catalyses the conversion of 7,8-dihydroneopterin to FT 6-hydroxymethyl-7,8-dihydropterin in the biosynthetic FT pathway of tetrahydrofolate. This was found by carrying out FT own Pfam search. Product modified to new family member due FT to motif match. No specific characterisation has been FT carried out yet. Putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PBF3" FT /db_xref="InterPro:IPR006157" FT /db_xref="UniProtKB/TrEMBL:Q0PBF3" FT /inference="protein motif:Pfam:PF02152" FT /protein_id="CAL34507.1" FT /translation="MQSHIKIKFHFKCIIGILDFERRKKQKIIIKLKAKANEFLNYAEV FT ITKIKTWYKKEEFYTLEESLDFVSLNLKKDFPNLTNLNIKIFKPHIIKNATVGVKLKKK FT Y" FT CDS complement(325215..325823) FT /transl_table=11 FT /locus_tag="Cj0357c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0357c, probable integral FT membrane protein, len: 202 aa; similar to many hypothetical FT integral membrane proteins e.g. YGIH_ECOLI (205 aa), fasta FT scores; opt: 254 z-score: 373.5 E(): 1.5e-13, 29.2% FT identity in 192 aa overlap. 40.7% identity to HP1509" FT /note="Updated (2006) note: Five probable transmembrace FT helices identified by TMHMM2.0 within CDS. Pfam PPF02660 FT Domain of unknown function DUF family identified within FT CDS. Further support given to product product. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="GOA:Q9PIE4" FT /db_xref="InterPro:IPR003811" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIE4" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02660" FT /protein_id="CAL34508.1" FT /translation="MENLIIYAFIYLLGSIPFGLILAKFFAKTDIKKEGSKSIGATNVL FT RVVKEKNPKLAKKLAIATIILDFAKAAIPLLTLKFLHYDQALLWSVAVLAILGHCFSIY FT LLFEGGKGIATGAGAMIVLLPLEVLTAFIVWVVIGKIFKISSLASLAALLAFVVSSFIF FT NYDLEIHTHAPVFIIAFIIVYKHLPNIKRLIFKEECKVI" FT misc_feature complement(325218..325229) FT /note="PS00294 Prenyl group binding site (CAAX box)" FT /inference="protein motif:Prosite:PS00294" FT misc_feature complement(325236..325805) FT /note="HMMPfam hit to PF02660, Domain of unknown function FT DUF, score 1.3e-44" FT /inference="protein motif:Pfam:PF02660" FT misc_feature complement(join(325743..325811,325503..325571, FT 325407..325475,325335..325394,325239..325307)) FT /note="5 probable transmembrane helices predicted for FT Cj0357c by TMHMM2.0 at aa 5-27, 85-107, 117-139, 144-163 FT and 173-195" FT /inference="protein motif:TMHMM:2.0" FT CDS 326024..327049 FT /transl_table=11 FT /locus_tag="Cj0358" FT /product="putative cytochrome C551 peroxidase" FT /EC_number="1.11.1.5" FT /note="Original (2000) note: Cj0358, probable cytochrome FT C551 peroxidase, len: 341 aa; similar to e.g. CCPR_PSEAE FT cytochrome C551 peroxidase precursor (EC 1.11.1.5) (346 FT aa), fasta scores; opt: 281 z-score: 1028.0 E(): 0, 48.9% FT identity in 313 aa overlap. 58.5% identity to HP1461. Also FT similar to Cj0020c (45.4% identity in 273 aa overlap). FT Contains 2x PS00190 Cytochrome c family heme-binding site FT signature and probable N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF03150 Di-haem FT cytochrome c peroxidase identified within CDS. Further FT support given to product function. Characterised within FT Pseudomonas aeruginosa with acceptable identity FT score,however, only partial sequence alignment was FT achieved. Putative kept within product function. Functional FT classification - Detoxification" FT /note="PMID:7781769, PMID:8591033" FT /db_xref="GOA:Q0PBF1" FT /db_xref="InterPro:IPR003088" FT /db_xref="InterPro:IPR004852" FT /db_xref="InterPro:IPR009056" FT /db_xref="UniProtKB/TrEMBL:Q0PBF1" FT /inference="protein motif:Pfam:PF03150" FT /inference="protein motif:Prosite:PS00190" FT /protein_id="CAL34509.1" FT /translation="MKVKSLLIASLVAFSSLNAASLIDEAKNSGLVALPKDQKGVDEIL FT KQNGVKASEFTLEKAELGKKLYFEPRLSKSGIISCNTCHNVGLGGTDGISTAIGHKWTA FT NPHHLNSPTVYNAVLNNTQFWDGRAGTLADQAKGPIQADPEMATPAKLAVEKISSLPEY FT VSEFKKIYGKSGVNFDNIADAIANFERTLITPSRFDKFLEGDEKALTKEEQKGLKLFID FT KGCVACHNGVNLGGNMQAFEVAGKYKFANLGDFKGDANGMVKTPTLRNVAETAPYFHNG FT AIWNLKDAIKEMGSVQLGIKISDKEAKSIETFLKSLTGTKPAIVYPQLPISTEKTPKPE FT L" FT sig_peptide 326024..326101 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000159_326024_327049 by SignalP 2.0 FT HMM (Signal peptide probability 0.998) with cleavage site FT probability 0.505 between residues 26 and 27" FT misc_feature 326123..326650 FT /note="HMMPfam hit to PF03150, Di-haem cytochrome c FT peroxidase, score 1.4e-78" FT /inference="protein motif:Pfam:PF03150" FT misc_feature 326261..326278 FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT misc_feature 326696..326713 FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT CDS 327143..328480 FT /transl_table=11 FT /gene="glmM" FT /locus_tag="Cj0360" FT /product="phosphoglucosamine mutase" FT /EC_number="5.4.2.10" FT /note="Original (2000) note: Cj0360, probable phospho-sugar FT mutase, len: 445 aa; similar to phosphomannomutases and FT phosphoglucomutases and to e.g. UREC_HELPY putative urease FT operon UREC protein (HP0075) (445 aa), fasta scores; opt: FT 1834 z-score: 1863.3 E(): 0,63.7% identity in 444 aa FT overlap, and MRSA_ECOLI MRSA protein (445 aa), fasta FT scores; opt: 1107 z-score: 1449.7 E(): 0, 42.7% identity in FT 429 aa overlap. Contains PS00710 Phosphoglucomutase and FT phosphomannomutase phosphoserine signature and Pfam match FT to entry PF00408 PGM_PMM,Phosphoglucomutase and FT phosphomannomutase, score 499.10,E-value 3.5e-146" FT /note="Updated (2006) note: Pfam domains PF02878, PF02879 FT and PF02880 Phosphoglucomutase/phosphomannomutase were FT identied within CDS. Further support given to product FT function. Characterised in more than one speicies e.g. FT Helicobacter pylori and Escherichia coli, with acceptable FT identity score. Based on characterisation papers, product FT function modified to more specific family member. Putative FT removed from product function. Functional classification FT -Misc" FT /note="PMID:8550580, PMID:10913078, PMID:9171391" FT /db_xref="GOA:Q9PIE2" FT /db_xref="InterPro:IPR005841" FT /db_xref="InterPro:IPR005843" FT /db_xref="InterPro:IPR005844" FT /db_xref="InterPro:IPR005845" FT /db_xref="InterPro:IPR005846" FT /db_xref="InterPro:IPR006352" FT /db_xref="InterPro:IPR016055" FT /db_xref="InterPro:IPR016066" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIE2" FT /inference="protein motif:Pfam:PF02880" FT /inference="protein motif:Pfam:PF02879" FT /inference="protein motif:Pfam:PF02878" FT /inference="protein motif:Pfam:PF00408" FT /inference="protein motif:Prosite:PS00710" FT /protein_id="CAL34510.1" FT /translation="MKLFGTDGVRGKAGEFLDSFLAMRLAMAAGIYFKDKSITNNILVG FT KDTRRSGYMIENAIVSGLTSIGYNVIQIGPMPTPAIAFLTEDMRCDAGIMISASHNPYY FT DNGIKFFDAHGNKLSEDIEKKIEEIYFDDKLIQASKVDMEKIGQAKRIDDVIGRYIVSI FT KNSFPKDLTLKSLRVVLDVAHGAAYKVAPTVFKELGAEVIVMSDKPNGLNINENCGALH FT PANLAAEVKRLRADVGFAFDGDADRLVVVDEKGEVANGDSLLGVLALYLKEQGKLQSSV FT VATIMSNGALKEFLNKHGIELDTCNVGDKYVLEKLKANGGNFGGEQSGHIIFSDYAKTG FT DGLIAALQFSALMLSKKKSASSILGQVKPYPQLLTNLKIAEKKDLDKIKGLKELKKDLE FT NKNINTLFRYSGTENLIRLLLEARDIKLLEKEMKNVVEFFKKALNG" FT misc_feature 327143..327553 FT /note="HMMPfam hit to FT PF02878,Phosphoglucomutase/phosphomannomutase, al, score FT 2.8e-60" FT /inference="protein motif:Pfam:PF02878" FT misc_feature 327419..327463 FT /note="PS00710 Phosphoglucomutase and phosphomannomutase FT phosphoserine signature" FT /inference="protein motif:Prosite:PS00710" FT misc_feature 327611..327913 FT /note="HMMPfam hit to FT PF02879,Phosphoglucomutase/phosphomannomutase, al, score FT 2.6e-37" FT /inference="protein motif:Pfam:PF02879" FT misc_feature 327917..328261 FT /note="HMMPfam hit to FT PF02880,Phosphoglucomutase/phosphomannomutase, al, score FT 2.5e-31" FT /inference="protein motif:Pfam:PF02880" FT misc_feature 328262..328465 FT /note="HMMPfam hit to FT PF00408,Phosphoglucomutase/phosphomannomutase, C-, score FT 5.8e-06" FT /inference="protein motif:Pfam:PF00408" FT CDS 328473..328943 FT /transl_table=11 FT /gene="lspA" FT /locus_tag="Cj0361" FT /product="lipoprotein signal peptidase" FT /EC_number="3.4.23.36" FT /note="Original (2000) note: Cj0361, lspA, probable FT lipoprotein signal peptidase, len: 156 aa; similar to e.g. FT LSPA_ECOLI lipoprotein signal peptidase (EC 3.4.23.36) (164 FT aa), fasta scores; opt: 216 z-score: 326.7 E(): 6.1e-11, FT 32.0% identity in 153 aa overlap. 52.0% identity to HP0074. FT Contains PS00855 Signal peptidases II signature and Pfam FT match to entry PF01252 SPASE_II, Signal peptidase (SPase) FT II, score 144.90, E-value 1.4e-39" FT /note="Updated (2006) note: Four probable transmembrace FT helices identified by TMHMM2.0 within CDS. Pfam domain FT PF01252 Signal peptidase (SPase) II identified within CDS. FT Further support given to product function. Characterised FT within Eschreichia coli with marginal identity score. FT Putative not added to product function. Functional FT classification - Protein and peptide secretion" FT /note="PMID:6378662, PMID:15919996" FT /db_xref="GOA:Q0PBE9" FT /db_xref="InterPro:IPR001872" FT /db_xref="UniProtKB/Swiss-Prot:Q0PBE9" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01252" FT /inference="protein motif:Prosite:PS00855" FT /protein_id="CAL34511.1" FT /translation="MAKTFKFIFYFWGAFVLVFALDQWVKSLTLAGFRWQSEYLDLTYA FT LNTGVAFSMLSFLEHNLKYLHLALIGVLFIYLFWQRTLLKTHSIAFGMMLGAGVSNLLD FT RFIHGGVVDMFFWHKWFNFAIFNVADVMINISVALILIQEIFKKRKKDDRMD" FT misc_feature order(328491..328544,328587..328646,328665..328724, FT 328830..328898) FT /note="4 probable transmembrane helices predicted for FT Cj0361 by TMHMM2.0 at aa 7-24, 39-58, 65-84 and 120-142" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 328497..328931 FT /note="HMMPfam hit to PF01252, Signal peptidase (SPase) II, FT score 9.9e-41" FT /inference="protein motif:Pfam:PF01252" FT misc_feature 328758..328790 FT /note="PS00855 Signal peptidases II signature" FT /inference="protein motif:Prosite:PS00855" FT CDS 328927..329379 FT /transl_table=11 FT /locus_tag="Cj0362" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0362, probable integral FT membrane protein, len: 150 aa; similar to hypothetical FT proteins e.g. TR:Q53231 (EMBL:L76097) from Rhodobacter FT sphaeroides (154 aa), fasta scores; opt: 301 z-score: 419.6 FT E(): 4.1e-16, 34.2% identity in 149 aa overlap. 47.6% FT identity to HP1484" FT /note="Updated (2006) note: Four probable transmembrace FT helices identified by TMHMM2.0 within CDS. Pfam domain FT PF03653 Uncharacterised protein family (UPF0093) identified FT within CDS. Further support given to product function. FT Functional classification - Membranes,lipoproteins and FT porins" FT /db_xref="InterPro:IPR005265" FT /db_xref="InterPro:IPR014351" FT /db_xref="UniProtKB/TrEMBL:Q0PBE8" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03653" FT /protein_id="CAL34512.1" FT /translation="MTEWINDYYFWIKWVHYLAFVSWMAGLFYLPRLFVYHAEHKDNKG FT FVEVVKIQERKLYYYIQTPAMIVTLITGSLMLHAHKEVLMVGAGFMHVKLTCVTLLIIF FT HIHNYYCLKALANDTSTKSGKYFRIYNEFPTIMFIIIALMMVVRPF" FT misc_feature 328939..329376 FT /note="HMMPfam hit to PF03653, Uncharacterised protein FT family (UPF0093), score 9e-53" FT /inference="protein motif:Pfam:PF03653" FT misc_feature order(328969..329034,329095..329163,329173..329241, FT 329302..329370) FT /note="4 probable transmembrane helices predicted for FT Cj0362 by TMHMM2.0 at aa 15-36, 57-79, 83-105 and 126-148" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(329376..330722) FT /transl_table=11 FT /gene="hemN" FT /locus_tag="Cj0363c" FT /product="putative oxygen-independent coproporphyrinogen FT III oxidase" FT /EC_number="1.3.99.22" FT /note="Original (2000) note: Cj0363c, probable FT oxidoreductase, len: 448 aa; some similarity to e.g. FT HEMN_BACSU probable oxygen-independent coproporphyrinogen FT III oxidase (366 aa), fasta scores; opt: 354 z-score: 228.9 FT E(): 1.7e-05, 26.6% identity in 368 aa overlap. No Hp FT ortholog" FT /note="Updated (2006) note: Pfam domains PF06969 HemN FT C-terminal region and PF04055 Radical SAM superfamily were FT identified within CDS. Further support given to product FT function. Characterised within Bacillus subtilis and many FT others with marginal identity score. Putative kept within FT product function. Product function modified to more FT specific family member based on recent characterisation FT papers. Functional classification - Misc" FT /note="PMID:7768836, PMID:12114526, PMID:10498703" FT /db_xref="GOA:Q0PBE7" FT /db_xref="InterPro:IPR006638" FT /db_xref="InterPro:IPR007197" FT /db_xref="InterPro:IPR010723" FT /db_xref="InterPro:IPR023404" FT /db_xref="UniProtKB/TrEMBL:Q0PBE7" FT /inference="protein motif:Pfam:PF04055" FT /inference="protein motif:Pfam:PF06969" FT /protein_id="CAL34513.1" FT /translation="MNLFQNLALKYSHTMMEKSLQKGFNVELLKQPEEKIPKQDKSYML FT YAHVPFCHTFCPYCSFHKYYYDENLAKVYFQNLREEIKIMKNKGFDFTSMYVGGGTTLI FT DEEELLKTLELCKKLFNIKEISCESDPNHIDPNKLSMFKGIIDRLSCGIQSFDDETLKK FT VARYNKFGSSKELQEKISKALGILPIFSIDLIFNLPGQNEKQLLNDLEIAKNLAPQQIT FT TYPLMKSNLTKDNIAKSLGVSIKDNEFTYYQIIREFFKDYTQNNGWSFSLEKNKLNDEY FT VSSHHEYLGVGSGAFSFLDGELLINAFNLNDYAKFIQEKQNANIAKACFDKKEIIKYVF FT LTGIFSGKIEIDKFNKTLNCNLEKELFIELLGLKTSGAIIKDQNALIATEFGQYLFVVL FT MKDFYTGMDLVRAVFRDDKRLKNKDYIDIMKENIDPLNSASMEFKAETN" FT misc_feature complement(329541..329870) FT /note="HMMPfam hit to PF06969, HemN C-terminal region,score FT 0.0012" FT /inference="protein motif:Pfam:PF06969" FT misc_feature complement(330084..330587) FT /note="HMMPfam hit to PF04055, Radical SAM FT superfamily,score 3.4e-21" FT /inference="protein motif:Pfam:PF04055" FT CDS 330851..331102 FT /transl_table=11 FT /locus_tag="Cj0364" FT /product="hypothetical protein Cj0364" FT /note="Original (2000) note: Cj0364, unknown, len: 83 aa; FT no Hp match" FT /note="Updated (2006) note: Literature search identified FT paper giving further clues to product function. Functional FT classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBE6" FT /protein_id="CAL34514.1" FT /translation="MDKAKIVQNLNALFKQRAEFYSYFDENIAKINNTEVFDFKNAKNL FT NPEEVYKQFYHFDYAIRKLLPAIYKAYEITDADLDKDF" FT CDS complement(331125..332603) FT /transl_table=11 FT /gene="cmeC" FT /locus_tag="Cj0365c" FT /product="outer membrane channel protein CmeC (multidrug FT efflux system CmeABC)" FT /note="Original (2000) note: Cj0365c, possible outer FT membrane channel protein, len: 492 aa; similar to members FT of the nodT/fusA family e.g. TR:O31101 (EMBL:AF029405) FT Pseudomonas putida outer membrane channel protein SRPC (470 FT aa), fasta scores; opt: 645 z-score: 834.4 E(): 0,29.2% FT identity in 465 aa overlap. and TR:Q51006 (EMBL:X95635) FT Neisseria gonorrhoeae mtrE gene (467 aa,fasta scores; opt: FT 663 z-score: 829.8 E(): 0, 31.1% identity in 476 aa FT overlap. No Hp match. Also some similarity to Cj0608 (28.6% FT identity in 455 aa overlap). Contains N-terminal signal FT sequence and PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /note="Updated (2006) note: Pfam domains x2 PF02321 Outer FT membrane efflux proteins were identified within CDS. FT Further support given to product function. Characterised FT within Campylobacter jejuni. Part of the CmeABC multidrug FT efflux system. Functional classification - Antibiotic FT resistance" FT /note="PMID:12069964, PMID:15728904, PMID:16359189" FT /db_xref="GOA:Q0PBE5" FT /db_xref="InterPro:IPR003423" FT /db_xref="InterPro:IPR010131" FT /db_xref="UniProtKB/TrEMBL:Q0PBE5" FT /inference="protein motif:Pfam:PF02321" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34515.1" FT /translation="MNKIISISAIASFTLLISACSLSPNLNIPEANYSIDNKLGALSWE FT KENNSSITKNWWKDFDDENLNKVVDLALKNNNDLKLAFIHMEQAAAQLGIDFSSLLPKF FT DGSASGSRAKTAINAPSNRTGEVSYGNDFKMGLNLSYEIDLWGKYRDTYRASKSGFKAS FT EYDYEAARLSVISNTVQTYFNLVNAYENENALKEAYKSAKEIYRINDEKFQVGAVGEYE FT LAQARANLESMALQYNEAKLNKENYLKALKILTSNDLNDILYKNQSYQVFNLKEFDIPT FT GISSTILLQRPDIGSSLEKLTQQNYLVGVARTAFLPSLSLTGLLGFESGDLDTLVKGGS FT KTWNIGGNFTLPIFHWGEIYQNVNLAKLNKDEAFVNYQNTLITAFGEIRYALVARKTIR FT LQYDNAQASEQSYKRIYEIAKERYDIGEMSLQDYLEARQNWLNAAVAFNNIKYSYANSI FT VDVIKAFGGGFEQSEDTSKNIKEESKNLDMSFRE" FT misc_feature complement(331206..331766) FT /note="HMMPfam hit to PF02321, Outer membrane efflux FT protein, score 1.6e-27" FT /inference="protein motif:Pfam:PF02321" FT misc_feature complement(331836..332411) FT /note="HMMPfam hit to PF02321, Outer membrane efflux FT protein, score 3.2e-33" FT /inference="protein motif:Pfam:PF02321" FT sig_peptide complement(332505..332603) FT /note="Signal peptide predicted for cmeC by SignalP 2.0 HMM FT (Signal peptide probability 0.998) with cleavage site FT probability 0.370 between residues 33 and 34" FT misc_feature complement(332544..332576) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(332596..335718) FT /transl_table=11 FT /gene="cmeB" FT /locus_tag="Cj0366c" FT /product="inner membrane efflux transporter CmeB (multidrug FT efflux system CmeABC)" FT /note="Original (2000) note: Cj0366c, probable FT transmembrane efflux protein, len: 1040 aa; similar to e.g. FT TR:P95422 (EMBL:X99514) Pseudomonas aeruginosa mexF FT (antibiotic efflux system protein) (1062 aa), fasta scores; FT opt: 1584 z-score: 3208.4 E(): 0, 41.2% identity in 1056 aa FT overlap, and ACRB_ECOLI acriflavin resistance protein B FT (1049 aa), fasta scores; opt: 2739 z-score: 3055.6 E(): 0, FT 41.7% identity in 1031 aa overlap. No Hp ortholog. Contains FT Pfam match to entry PF00873 ACR_tran,AcrB/AcrD/AcrF family, FT score 1415.10, E-value 0" FT /note="Updated (2006) note: Thirteen probable transmembrace FT helices identified by TMHMM2.0 within CDS. Prosite domain FT PS50156 SSD, Sterol-sensing 5TM box also identified within FT CDS. Further support given to product function. FT Characterised within Campylobacter jejuni. Part of the FT CmeABC multidrug efflux system. Functional classification - FT Antibiotic resistance" FT /note="PMID:12069964, PMID:11814661, FT PMID:15728904,PMID:16359189, PMID:15201231" FT /db_xref="GOA:Q0PBE4" FT /db_xref="InterPro:IPR000731" FT /db_xref="InterPro:IPR001036" FT /db_xref="InterPro:IPR004764" FT /db_xref="UniProtKB/TrEMBL:Q0PBE4" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00873" FT /inference="protein motif:Prosite:PS50156" FT /protein_id="CAL34516.1" FT /translation="MFSKFFIERPVFASVVAIIISLAGAIGLTNLPIEQYPSLTPPTVK FT VSATYTGADAQTIASTVASPIEDAINGADNMIYMDSTSSSSGTMSLTVYFDIGTDPDQA FT TIDVNNRISAATAKMPDAVKKLGVTVRKTSSTTLAAISMYSSDGSMSAVDVYNYITLNV FT LDELKRVPGVGDANAIGNRNYSLRIWLKPDLLNKFGITATDVISAVNDQNAQYATGKIG FT EEPVTQKSPYVYSITMQGRLQNPSEFENIILRTNNDGSFLRLKDVADVEIGSQQYSSQG FT RLNGNDAVPIMINLQSGANALHTAELVQAKMQELSKNFPKGLTYKIPYDTTKFVIESIK FT EVVKTFVEALILVIIVMYMFLKNFRATLIPMIAVPVSLLGTFAGLYVLGFSINLLTLFA FT LILAIGIVVDDAIIVVENIDRILHENEQISVKDAAIQAMQEVSSPVISIVLVLCAVFVP FT VSFISGFVGEIQRQFALTLAISVTISGFVALTLTPSLCALFLRRNEGEPFKFVKKFNDF FT FDWSTSVFSAGVAYILKRTIRFVLIFCIMLGAIFYLYKAVPSSLVPEEDQGLMIGIINL FT PSASALHRTISEVDHISQEVLKTNGVKDAMAMIGFDLFTSSLKENAAAMFIGLKDWKDR FT NVSADEIAMELNKKFAFDRNASSIFIGLPPIPGLSITGGFEMYVQNKSGKSYDEIQKDV FT NKLVAVANQRKELSRVRTTLDTTFPQYKLIIDRDKLKHYNLNMQDVFNTMNATIGTYYV FT NDFSMLGKNFQVNIRAKGDFRNTQDALKNIFVRSNDGKMIPLDSFLTLQRSSGPDDVKR FT FNLFPAAQVQGQPAPGYTSGQAIEAIAQVAKETLGDDYSIAWSGSAYQEVSSKGTASYA FT FALGMIFVFLILAAQYERWLIPLAVVTAVPFAVFGSFLLVYLRGFSNDIYFQTGLLLLI FT GLSAKNAILIVEFAMEERFKKGKGVFEAAVAAAKLRFRPIIMTSLAFTFGVLPMIFATG FT AGSASRHSLGTGLIGGMIAASTLAIFFVPLFFYLLENFNEWLDKKRGKVHE" FT misc_feature complement(332644..335715) FT /note="HMMPfam hit to PF00873, AcrB/AcrD/AcrF family,score FT 0" FT /inference="protein motif:Pfam:PF00873" FT misc_feature complement(join(335623..335691,334636..334695, FT 334555..334623,334474..334542,334318..334386, FT 334216..334284,334120..334173,334033..334101, FT 333070..333123,332983..333051,332887..332955, FT 332758..332826,332647..332715)) FT /note="13 probable transmembrane helices predicted for FT Cj0366c by TMHMM2.0 at aa 10-32, 342-361, 366-388,393-415, FT 445-467, 479-501, 516-533, 540-562, 866-883,890-912, FT 922-944, 965-987 and 1002-1024" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(335575..335718) FT /note="Signal peptide predicted for cmeB by SignalP 2.0 HMM FT (Signal peptide probability 1.000) with cleavage site FT probability 0.670 between residues 48 and 49" FT CDS complement(335718..336821) FT /transl_table=11 FT /gene="cmeA" FT /locus_tag="Cj0367c" FT /product="periplasmic fusion protein CmeA (multidrug efflux FT system CmeABC)" FT /note="Original (2000) note: Cj0367c, possible membrane FT fusion component of efflux system, len: 367 aa; similar to FT e.g. MTRC_NEIGO membrane fusion protein MTRC precursor (412 FT aa), fasta scores; opt: 592 z-score: 692.4 E(): 2.6e-31, FT 29.9% identity in 358 aa overlap, and TR:P95421 FT (EMBL:X99514) Pseudomonas aeruginosa mexE (antibiotic FT efflux system protein) (414 aa), fasta scores; opt: 460 FT z-score: 570.0 E(): 1.7e-24, 26.9% identity in 357 aa FT overlap. No Hp ortholog. Contains N-terminal signal FT sequence and PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /note="Updated (2006) note: Pfam domain PF00529 HlyD family FT secretion protein identified within CDS. Further support FT given to product function. Part of the CmeABC multidrug FT efflux system. Functional classification -Antibiotic FT resistance" FT /note="PMID:12069964, PMID:15728904, PMID:16359189" FT /db_xref="GOA:Q0PBE3" FT /db_xref="InterPro:IPR006143" FT /db_xref="UniProtKB/TrEMBL:Q0PBE3" FT /inference="protein motif:Pfam:PF00529" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34517.1" FT /translation="MKLFQKNTILALGVVLLLTACSKEEAPKIQMPPQPVTTMSAKSED FT LPLSFTYPAKLVSDYDVIIKPQVSGVIENKLFKAGDKVKKGQTLFIIEQDKFKASVDSA FT YGQALMAKATFENASKDFNRSKALFSKSAISQKEYDSSLATFNNSKASLASARAQLANA FT RIDLDHTEIKAPFDGTIGDALVNIGDYVSASTTELVRVTNLNPIYADFFISDTDKLNLV FT RNTQNGKWDLDSIHANLNLNGETVQGKLYFIDSVIDANSGTVKAKAIFDNNNSTLLPGA FT FATITSEGFIQKNGFKVPQIAVKQNQNDVYVLLVKNGKVEKSSVHISYQNNEYAIIDKG FT LQNGDKIILDNFKKIQVGSEVKEIGAQ" FT misc_feature complement(335775..336644) FT /note="HMMPfam hit to PF00529, HlyD family secretion FT protein, score 2.9e-21" FT /inference="protein motif:Pfam:PF00529" FT sig_peptide complement(336693..336821) FT /note="Signal peptide predicted for cmeA by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.422 between residues 43 and 44" FT misc_feature complement(336759..336791) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(336916..337548) FT /transl_table=11 FT /gene="cmeR" FT /locus_tag="Cj0368c" FT /product="transcriptional regulator CmeR" FT /note="Original (2000) note: Cj0368c, probable FT transcriptional regulatory protein, len: 210 aa; similar to FT members of the tetR family e.g. TR:G3327947 (EMBL:AF053772) FT Staphylococcus aureus transcriptional regulator qacR FT (regulator of multidrug efflux protein QacB) (188 aa), FT fasta scores; opt: 162 z-score: 285.0 E(): 1.3e-08, 29.3% FT identity in 198 aa overlap, and MTRR_NEIGO regulatory FT protein MTRR (210 aa), fasta scores; opt: 137 z-score: FT 210.6 E(): 0.00018, 31.3% identity in 83 aa overlap. No Hp FT match. Contains Pfam match to entry PF00440 tetR, Bacterial FT regulatory proteins, tetR family, score 24.00, E-value FT 6.4e-05" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Product function modified to more FT speicific family member. Characterisation paper shows that FT CmeR is a transcriptional repressor for the downstream FT CmeABC operon. Functional classification - Broad regulatory FT functions" FT /note="PMID:15728904" FT /db_xref="GOA:Q6PMN0" FT /db_xref="InterPro:IPR001647" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR012287" FT /db_xref="InterPro:IPR015893" FT /db_xref="UniProtKB/TrEMBL:Q6PMN0" FT /inference="protein motif:Pfam:PF00440" FT /protein_id="CAL34518.1" FT /translation="MNSNRTPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGG FT SYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIENGTLKEILTSFGLAFIEIFN FT QPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAV FT LFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINSSKA" FT misc_feature complement(337357..337497) FT /note="HMMPfam hit to PF00440, Bacterial regulatory FT proteins, tetR family, score 7.1e-10" FT /inference="protein motif:Pfam:PF00440" FT CDS complement(337535..338911) FT /transl_table=11 FT /locus_tag="Cj0369c" FT /product="putative ferredoxin domain-containing integral FT membrane protein" FT /note="Original (2000) note: Cj0369c, ferredoxin FT domain-containing integral membrane protein, len: 458 aa; FT some similarity to e.g. RDXA_RHOSH RDXA protein (469 FT aa),fasta scores; opt: 474 z-score: 657.7 E(): 2.2e-29, FT 24.9% identity in 402 aa overlap, and FIXG_RHIME nitrogen FT fixation protein FIXG (524 aa), fasta scores; opt: 476 FT z-score: 533.8 E(): 1.8e-22, 28.7% identity in 296 aa FT overlap. 45.7% identity to HP1508. Contains PS00198 4Fe-4S FT ferredoxins, iron-sulfur binding region signature and Pfam FT match to entry PF00037 fer4, 4Fe-4S ferredoxins and related FT iron-sulfur cluster binding domains., score 17.10,E-value FT 0.0011" FT /note="Updated (2006) note: Five probable transmembrace FT helices identified by TMHMM2.0 within CDS. Further support FT given to product function. No specific characterisation FT with acceptable identity scores identified yet. Putative FT kept within product function. Functional classification FT -Energy metabolism - Electron transport" FT /db_xref="GOA:Q0PBE1" FT /db_xref="InterPro:IPR001450" FT /db_xref="InterPro:IPR012285" FT /db_xref="InterPro:IPR013783" FT /db_xref="InterPro:IPR014116" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR017900" FT /db_xref="UniProtKB/TrEMBL:Q0PBE1" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00037" FT /inference="protein motif:Prosite:PS00198" FT /protein_id="CAL34519.1" FT /translation="MQGHITNYTKKRYFVYLIASIIIFSLPFIRINENHFFLLSFDHSK FT LNLFFISFSTQEFYLMPFVLIFLFLFIFFITTLGGRIWCAWSCPQTIFRVIYRDIIQTK FT FLKIRKNINNKQKEYERQYFKKFLGVIIFYFISLVAVSNLLWYFIPPEDFFNYIQNPGE FT HLLLLGILFCASLLFTLDITYLQEKFCVYVCPYARIQSVMFDHDTMQVIYDEKRGGLIY FT DGHTKLHKKPPEGECIGCEACVSICPTHIDIRKGMQLECINCLECADACSKVQSKFNRP FT SLINWTSAKAIETRSKVHYLRFRTIAYFIVLLIALLALIIMGSKKESMLLNINRSSELY FT NISNVKGELVISNAYTFLFQNTDSKPHEYYFTANLEGINDGIEIIRPNKPFKLKAGEQV FT KKIVVIRATKNLANNDKKDVIFPLHIKAYAKDNEKISVFRKSIFVYPKSTLIKDKNELK FT " FT misc_feature complement(join(338819..338875,338672..338740, FT 338465..338533,338354..338422,337946..338014)) FT /note="5 probable transmembrane helices predicted for FT Cj0369c by TMHMM2.0 at aa 13-31, 58-80, 127-149, 164-186 FT and 300-322" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(338153..338224) FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 0.0014" FT /inference="protein motif:Pfam:PF00037" FT misc_feature complement(338168..338203) FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT CDS 339071..339283 FT /transl_table=11 FT /gene="rpsU" FT /locus_tag="Cj0370" FT /product="30S ribosomal protein S21" FT /note="Original (2000) note: Cj0370, rpsU, 30S ribosomal FT protein S21, len: 70 aa; similar to many e.g. RS21_ECOLI FT 30S ribosomal protein S21 (70 aa), fasta scores; opt: 169 FT z-score: 341.8 E(): 8.8e-12, 45.7% identity in 70 aa FT overlap. 80.0% identity to HP0562. Contains Pfam match to FT entry PF01165 S21, Ribosomal protein S21, score FT 91.50,E-value 1.6e-23" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:16272117" FT /db_xref="GOA:Q9PID2" FT /db_xref="InterPro:IPR001911" FT /db_xref="UniProtKB/Swiss-Prot:Q9PID2" FT /inference="protein motif:Pfam:PF01165" FT /protein_id="CAL34520.1" FT /translation="MPGIKVHPNESFDEAYRKFKKQVDRNLVVTEVRARRFFEPMTEIR FT KKQKISARKKMLKRLYMLRRYESRL" FT misc_feature 339074..339235 FT /note="HMMPfam hit to PF01165, Ribosomal protein S21,score FT 1.1e-24" FT /inference="protein motif:Pfam:PF01165" FT CDS 339403..340008 FT /transl_table=11 FT /locus_tag="Cj0371" FT /product="putative flagellar motility protein" FT /note="Original (2000) note: Cj0371, probable FT lipoprotein,len: 201 aa; similar to H. pylori gene fragment FT reported to be involved in flagellar motility TR:Q48273 FT (EMBL:Z68311) (122 aa), fasta scores; opt: 322 z-score: FT 449.5 E(): 8.8e-18, 46.1% identity in 115 aa overlap. 46.4% FT identity to HP0232. Contains N-terminal signal sequence and FT PS00013 Prokaryotic membrane lipoprotein lipid attachment FT site" FT /note="Updated (2006) note: One probable transmembrace FT helices identified by TMHMM2.0 within CDS. Some similarity FT to Helicobacter pylori gene fragment. Putative kept within FT product function. Functional classification - Surface FT structures" FT /note="PMID:8733234" FT /db_xref="GOA:Q9PID1" FT /db_xref="InterPro:IPR020913" FT /db_xref="UniProtKB/Swiss-Prot:Q9PID1" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34521.1" FT /translation="MKKIKKIIQIGMIGGLAAVAGGALAGCGSNNDNADTLNQAANAQG FT AFVIIEETAPGQYKIKDQYPSDETRVVLKDLNGTERILSKEEMDALIKEEAAKIDNGTS FT NLTKDNGQISSGGLSLGETLLASAAGAILGSWIGSKLFNNQNFANQQRGAFSNQSAYQR FT SVNSFNKAGTTSSASSAKKSGFFGGGSKATSSSSSFGS" FT sig_peptide 339403..339504 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000163_339403_340008 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.698 between residues 34 and 35" FT misc_feature 339421..339489 FT /note="1 probable transmembrane helix predicted for Cj0371 FT by TMHMM2.0 at aa 7-29" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 339451..339483 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 340018..341187 FT /transl_table=11 FT /locus_tag="Cj0372" FT /product="putative glutathionylspermidine synthase" FT /EC_number="6.3.1.8" FT /note="Original (2000) note: Cj0372, unknown, len: 389 aa; FT similar to hypothetical proteins e.g. YGIC_ECOLI (386 FT aa),fasta scores; opt: 552 z-score: 508.4 E(): 4.6e-21, FT 31.3% identity in 383 aa overlap. Also similar to FT N-terminus of GSP_ECOLI glutathionylspermidine synthase FT (619 aa), fasta scores; opt: 314 z-score: 248.3 E(): FT 1.4e-06, 24.4% identity in 381 aa overlap. 60.5% identity FT to HP0233" FT /note="Updated (2006) note: Pfam domain PF03738 FT Glutathionylspermidine synthase identified within CDS. FT Characterised within Escherichia coli with marginal FT identity score. Amidase component is most likely not FT present due to absence at N-terminal end when aligned to FT Escherichia coli. Product modified to more specific family FT member based on motif match and characterisation. Putative FT kept within product function. Functional classification FT -Misc" FT /note="PMID:7775463, PMID:9398217" FT /db_xref="GOA:Q0PBD8" FT /db_xref="InterPro:IPR005494" FT /db_xref="InterPro:IPR016185" FT /db_xref="UniProtKB/TrEMBL:Q0PBD8" FT /inference="protein motif:Pfam:PF03738" FT /protein_id="CAL34522.1" FT /translation="MQLLQVDKLQKDYLENIGFSWHTDEDGSDYISNKLVCVKESEANA FT YYEAVNELYDMFIAAAQEVINNDRFDELGIPFNLIDAIKMSWENEVHWHLYGRFDLAGG FT LDGKPIKLIEFNADTPTALFESAILQWALLKQNGMDESAQFNSIYESLMDNFKRLITLD FT ESVEGFEEHYQGWKILFSSVAGSKEEEITTKLLAHIANEAGFQTNFSFVDEVEFSEEGI FT FKEGENYEYWFKLIPWEDIAIEEGELAMLLTQIMRNQRAIILNPAYTLLFQSKGILKIL FT WELYPNHPLLLETKDTPLEGKNYVKKPVFGREGANISIIKDGKTLHENVGPYGNNKAIY FT QEYVEFNSCENEYYQAGVFFAYEGCGLGFRKGGLVLDNYSKFVGHIIKD" FT misc_feature 340018..341181 FT /note="HMMPfam hit to PF03738, Glutathionylspermidine FT synthase, score 3.6e-252" FT /inference="protein motif:Pfam:PF03738" FT CDS 341190..342125 FT /transl_table=11 FT /locus_tag="Cj0373" FT /product="putative D-2-hydroxyacid dehydrogenase" FT /note="Original (2000) note: Cj0373, probable FT D-2-hydroxyacid dehydrogenase, len: 311 aa; simlar to e.g. FT DHGY_METEX glycerate dehydrogenase (313 aa), fasta scores; FT opt: 589 z-score: 818.8 E(): 0, 35.3% identity in 312 aa FT overlap, and to N-terminus of e.g. SERA_BACSU FT D-3-phosphoglycerate dehydrogenase (525 aa), opt: 420 FT z-score: 561.2 E(): 5.3e-24, 31.4% identity in 255 aa FT overlap. 45.7% identity to HP0096. Also similar to C. FT jejuni serA, Cj0891c (29.8% identity in 309 aa overlap). FT Contains PS00671 D-isomer specific 2-hydroxyacid FT dehydrogenases signature 3, and Pfam match to entry PF00389 FT 2-Hacid_DH, D-isomer specific 2-hydroxyacid dehydrogenases, FT score 186.20, E-value 6.2e-76" FT /note="Updated (2006) note: Characterisation work in many FT different species. Putative kept within product function. FT Functional classification - Misc" FT /note="PMID:11532010, PMID:7934829, PMID:8144463" FT /db_xref="GOA:Q0PBD7" FT /db_xref="InterPro:IPR006139" FT /db_xref="InterPro:IPR006140" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:Q0PBD7" FT /inference="protein motif:Pfam:PF00389" FT /inference="protein motif:Prosite:PS00671" FT /protein_id="CAL34523.1" FT /translation="MKIVCLDAATLGDYDLSVFEKFGSLQIYTTTNKEQTIERLKDANV FT AMTNKVVIDKDVIDACKNLKLILETATGVNNIDIEYAKEKGIIVKNAAGYSTMSVVQHT FT FAFMFAFLNQVLYYDKWSKEGKWCESPIFTDYSRILNTLSGKKHGIIGLGTIGKEVAKI FT SKAFGAEIYYYSTSGANKNADFVHLELKDLLKTCDIISIHAPLNEKTKNLLAFEELKLL FT KDNAILINVGRGGIVNENDLAKIIDEKNIRVGLDVLEIEPMMKNHPLLSIKNKENLIIT FT PHVAWASKEALNALMDIVYNNLKEWIENGK" FT misc_feature 341196..341471 FT /note="HMMPfam hit to PF00389, D-isomer specific FT 2-hydroxyacid dehydrog, score 3.7e-21" FT /inference="protein motif:Pfam:PF00389" FT misc_feature 341487..342038 FT /note="HMMPfam hit to PF02826, D-isomer specific FT 2-hydroxyacid dehydrog, score 1.4e-41" FT /inference="protein motif:Pfam:PF02826" FT misc_feature 341853..341903 FT /note="PS00671 D-isomer specific 2-hydroxyacid FT dehydrogenases signature 3" FT /inference="protein motif:Prosite:PS00671" FT CDS 342115..342606 FT /transl_table=11 FT /locus_tag="Cj0374" FT /product="conserved hypothetical protein Cj0374" FT /note="Original (2000) note: Cj0374, unknown, len: 163 aa; FT simlar to hypothetical proteins e.g. YAJQ_ECOLI (169 FT aa),fasta scores; opt: 371 z-score: 656.3 E(): 2.7e-29, FT 40.6% identity in 160 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF04461 Protein of FT unknown function (DUF520) identified within CDS. Conserved FT added to product function. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="InterPro:IPR007551" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIC8" FT /inference="protein motif:Pfam:PF04461" FT /protein_id="CAL34524.1" FT /translation="MASEHSFDISAALDKQELKNAFEQAKKELDSRYDLKGIKCEIDLS FT EKESIFKLSSSSEGKLDVLKDIVISKLIKRGINPKAIKELSRESGAMFRLNLKANDAID FT SENAKKINKVIKDSKLKVNSSIRGEEIRVAAKQIDDLQAVMKLVKELDLELNISFKNLK FT " FT misc_feature 342124..342603 FT /note="HMMPfam hit to PF04461, Protein of unknown function FT (DUF520), score 3.7e-100" FT /inference="protein motif:Pfam:PF04461" FT CDS 342615..343091 FT /transl_table=11 FT /locus_tag="Cj0375" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0375, probable FT lipoprotein,len: 158 aa; no Hp match. Contains N-terminal FT signal sequence and PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site. Functional FT classification -Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PBD5" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34525.1" FT /translation="MKHCLALCFVFFLCACSVKNQNFSSQSLMVLIASPMIKINDTAFL FT KKENNALNLEVYKLGQAFFELKIKDKICINAVCYDKQVFNQKFFKNVYYDDILSDILKA FT NPLWQGKNLEKTDCGFEQNLKAKNYEIFYQVCDNKVSFFDKISHTKIILTHIQN" FT sig_peptide 342615..342686 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000167_342615_343091 by SignalP 2.0 FT HMM (Signal peptide probability 0.988) with cleavage site FT probability 0.405 between residues 24 and 25" FT misc_feature 342630..342662 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 343102..343926 FT /transl_table=11 FT /locus_tag="Cj0376" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0376, possible periplasmic FT protein, len: 274 aa; no Hp match. Contains probable FT N-terminal signal sequence" FT /note="Updated (2006) note: Literature search identified FT paper linking protein to glycoprotein. Functional FT classification - Miscellaneous periplasmic proteins" FT /note="PMID:12186869" FT /db_xref="InterPro:IPR021729" FT /db_xref="UniProtKB/TrEMBL:Q0PBD4" FT /protein_id="CAL34526.1" FT /translation="MKFFLLVFCFVNLALAKVYKGELHFYHLQDKEIFAIVYDNAPMTP FT LFDRDKNQTSSSFLIVDDINGNLEIPLVKINDFWQDERKKYKINSSKMLTYDNKNFQGE FT NLGTTTLELVETQDGIRIKRSLDFIGFNDDFKEFHPVHKGVFSFEQIRQKPIFLQDGKI FT SFEEWYYFYEDGMSRAILELNNFVYDINAHAFVKLNDLYNTENQKFQNLLHEKLKNTCD FT ECFEDLQNLQFNNNFLLNNGKLKICYLPFEGHFLDENICVEFNEDELKEFKK" FT CDS 343926..345638 FT /transl_table=11 FT /locus_tag="Cj0377" FT /product="putative AAA family ATPase" FT /note="Original (2000) note: Cj0377, probable ATPase, len: FT 570 aa; weak similarity to many members of the AAA family FT e.g. TR:O28182 (EMBL:O28182) cell division control protein FT 48 (Archaeoglobus fulgidus AF2098) (811 aa), fasta scores; FT opt: 341 z-score: 312.6 E(): 3.7e-10, 26.4% identity in 435 FT aa overlap. No Hp match. Contains PS00017 ATP/GTP-binding FT site motif A (P-loop) and Pfam match to entry PF00004 AAA, FT ATPases associated with various cellular activities (AAA), FT score 106.20, E-value 6.3e-28" FT /note="Updated (2006) note: Probable changed to putative. FT No specific characterisation with acceptable identity FT scores carried out yet. Functional classification - Misc" FT /db_xref="GOA:Q0PBD3" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR003959" FT /db_xref="UniProtKB/TrEMBL:Q0PBD3" FT /inference="protein motif:Pfam:PF00004" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34527.1" FT /translation="MEKLKNFLILKNIEDTQIYKELKCAKNEALILRELCRNYVVSISS FT INAFTLLSTIFGNDKYLYLDALEDLKKLIERGFVNQNSSFFKSLENNKTQTLTLALLQS FT ELSLSEYFLEFLEAKPRLNFEKQEAYADYLEYLKDEFARIQLYERLSFIQKSAYNSEIK FT NQIKLYERHIKERLKKSKFYNVLADIFKEYNLEHKEQIIFLALLKEEYALSNESSISRE FT MNSLLSLISENDLERHKNKKLLQENAPLLNLIECDEYLNAFGDISKSFFIIDEILQRII FT NFEPKQSKKIKIESVLKDQDIFELIEPSTDINDIIMPENTKELLENILKQQDKKVLERL FT HSWGIKSNKNIEAKIIFYGPAGTGKTMSALAMAKSMKKSVLSFDCSKILSKWVGESEQN FT VRKIFDTYKNIVQTCKQSPILLLNEADQFLSTRVDGSSGSDKMHNQMQNIFLEQIERFS FT GVIIATTNFLESLDSAFSRRFDYKIEFKKPDFKDRLKIWEKFLPKKALFEKDFDINILS FT NYELSGAQILMVVKNTALKVAVSKDGVFKIQDFIESIQKELNSSFDKSKIVGF" FT misc_feature 344985..345542 FT /note="HMMPfam hit to PF00004, ATPase family associated FT with various cellul, score 1.4e-36" FT /inference="protein motif:Pfam:PF00004" FT misc_feature 345000..345023 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(345635..346174) FT /transl_table=11 FT /locus_tag="Cj0378c" FT /product="putative ferric reductase-like transmembrane FT protein. Functional classification-Membranes,lipoproteins FT and porins" FT /note="Original (2000) note: Cj0378c, probable integral FT membrane protein, len: 179 aa; no Hp match" FT /note="Updated (2006) note: Pfam domain PF01794 ferric FT reductase like transmembrane component identified within FT CDS. This was from a separate Pfam search. Pfam domain FT PF05252 Uncharacterised protein family (UPF0191) identified FT within CDS. Six probable transmembrace helices identified FT by TMHMM2.0 within CDS. Product functionality changed due FT to motif match. Literature search identified paper giving FT further support to product function. No specific FT characterisation has been carried out yet. Putative kept FT within product function" FT /note="PMID:15632442" FT /db_xref="GOA:Q0PBD2" FT /db_xref="InterPro:IPR013130" FT /db_xref="UniProtKB/TrEMBL:Q0PBD2" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF05252" FT /inference="protein motif:Pfam:PF01794" FT /protein_id="CAL34528.1" FT /translation="MQTKYFKFLAYFSFIISLIYGFYHIIKAFDFVKEAYIYTGIFALI FT FLNLSLLFSLLKFKKTKNYPKILGIFAAFWAILHFLNYFIFDRNAQILRLFDDISHRLL FT EAIGFIAFLIIFLMLLSSFKIFKKLSKIRKLGYLCLILASYHYFLTPKIPMFWEWSALI FT IALFYFIVRYTKTLKS" FT misc_feature complement(345638..346171) FT /note="HMMPfam hit to PF05252, Uncharacterised protein FT family (UPF0191), score 1.2e-08" FT /inference="protein motif:Pfam:PF05252" FT misc_feature complement(join(346097..346156,346010..346069, FT 345917..345976,345806..345874,345728..345772, FT 345662..345718)) FT /note="6 probable transmembrane helices predicted for FT Cj0378c by TMHMM2.0 at aa 7-26, 36-55, 67-86, FT 101-123,135-149 and 153-171" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(346174..347067) FT /transl_table=11 FT /locus_tag="Cj0379c" FT /product="putative molybdenum containing oxidoreductase" FT /note="Original (2000) note: Cj0379c, unknown, len: 297 aa; FT similar to hypothetical proteins e.g. E. coli TR:P76342 FT (EMBL:AE000288) (334 aa), fasta scores; opt: 1038 z-score: FT 1616.6 E(): 0, 56.3% identity in 272 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF00174 FT Oxidoreductase molybdopterin binding protein was identified FT within CDS. Product modified to more specific family member FT due to motif match. No specific characterisation has been FT carried out yet. Putative kept within product function. FT Literature search identified paper giving further clues to FT product function. Functional classification - Misc" FT /note="PMID:15632442" FT /db_xref="GOA:Q9PIC3" FT /db_xref="InterPro:IPR000572" FT /db_xref="InterPro:IPR022867" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIC3" FT /inference="protein motif:Pfam:PF00174" FT /protein_id="CAL34529.1" FT /translation="MLITPEKLYKQRRNFLKLGAGALISSSVLASKLSALNFTSDTNPN FT KLEISDEELATNYVNFYEFSTDKRKAVSLAQNFNTQNWKIDISGEIEKPLTLSMEDILK FT FPLEERIYRFRCVETWSMVVPWVGFELRRLIEMAKPTSEAKFVKFTTLLDKSQFPDQDA FT LFPTIDYPYVEGLRMDEAMHPLTLLAVGMYKKALKPQNGAPIRLVVPWKYGFKSIKSIV FT KIEFTKEQPKSTWESYAPSEYGFYANVNPNVSHPRWSQANERALGDFFTKPTLMFNGYE FT KEVASLYKNMDLKVNF" FT misc_feature complement(346360..346917) FT /note="HMMPfam hit to PF00174, Oxidoreductase molybdopterin FT binding d, score 3.2e-05" FT /inference="protein motif:Pfam:PF00174" FT sig_peptide complement(346948..347067) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000171_346174_347067 by SignalP 2.0 FT HMM (Signal peptide probability 0.978) with cleavage site FT probability 0.517 between residues 40 and 41" FT CDS complement(347123..347908) FT /transl_table=11 FT /locus_tag="Cj0380c" FT /product="hypothetical protein Cj0380c" FT /note="Original (2000) note: Cj0380c, unknonw, len: 261 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBD0" FT /protein_id="CAL34530.1" FT /translation="MNYQQLECDYFNLYNQFLSVDFQISLFEKDHKGLIKDFIFFYYQI FT LKQKDLSYLLEVRNKISLKVYNYMQEHSTSPKDLSLICLRENKHIEFFQIFYKALAYFV FT AFRKKLDGEQKIKNLISNINDCFGYHFLNSDFNNLQNFQKSDLFTLPEKHLKYFHFAMI FT HLCFMVLNPLNFKDSNRHLDKAINYLVDGTFEIYELIFKEYFLLFSKDKELKDELRKLK FT KLEFKILMQETSKIKLLNHYKEFCEEIFYNIELEKITQN" FT CDS complement(347905..348744) FT /transl_table=11 FT /gene="pyrF" FT /locus_tag="Cj0381c" FT /product="orotidine 5'-phosphate decarboxylase" FT /EC_number="4.1.1.23" FT /note="Original (2000) note: Cj0381c, pyrF, probable FT orotidine 5'-phosphate decarboxylase, len: similar to many FT e.g. DCOP_BACSU orotidine 5'-phosphate decarboxylase (EC FT 4.1.1.23) (239 aa), fasta scores; opt: 510 z-score: 723.4 FT E(): 5.2e-33, 39.6% identity in 217 aa overlap. 53.6% FT identity to HP0005. Contains PS00156 Orotidine 5'-phosphate FT decarboxylase active site and Pfam match to entry PF00215 FT OMPdecase, Orotidine 5'-phosphate decarboxylases, score FT 91.10, E-value 1.8e-25" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Pyrimidine FT ribonucleotide biosynthesis" FT /note="PMID:10681442, PMID:1709162" FT /db_xref="GOA:Q9PIC1" FT /db_xref="InterPro:IPR001754" FT /db_xref="InterPro:IPR011060" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR014732" FT /db_xref="InterPro:IPR018089" FT /db_xref="PDB:3RU6" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIC1" FT /inference="protein motif:Pfam:PF00215" FT /inference="protein motif:Prosite:PS00156" FT /protein_id="CAL34531.1" FT /translation="MKLCVALDLSTKEECLQLAKELKNLDIWLKVGLRAYLRDGFKFIE FT ELKKVDDFKIFLDLKFHDIPNTMADACEEVSKLGVDMINIHASAGKIAIQEVMTRLSKF FT SKRPLVLAVSALTSFDEENFFSIYRQKIEEAVINFSKISYENGLDGMVCSVFESKKIKE FT HTSSNFLTLTPGIRPFGETNDDQKRVANLAMARENLSDYIVVGRPIYKNENPRAVCEKI FT LNKIHRKNISENDIEQNYEVIQQKEWDMCNHFEEWIKTRPDKEHALKEFYAKCGIKY" FT misc_feature complement(348079..348744) FT /note="HMMPfam hit to PF00215, Orotidine 5'-phosphate FT decarboxylase / HUMP, score 7.3e-82" FT /inference="protein motif:Pfam:PF00215" FT misc_feature complement(348541..348582) FT /note="PS00156 Orotidine 5'-phosphate decarboxylase active FT site" FT /inference="protein motif:Prosite:PS00156" FT CDS complement(348741..349139) FT /transl_table=11 FT /gene="nusB" FT /locus_tag="Cj0382c" FT /product="transcription termination protein" FT /note="Original (2000) note: Cj0382c, nusB, probable FT transcription termination protein, len: 132 aa; similar to FT many e.g. NUSB_ECOLI N utilization substance protein B (139 FT aa), fasta scores; opt: 244 z-score: 305.0 E(): 1e-09, FT 35.9% identity in 128 aa overlap. 50.0% identity to HP0001. FT Contains Pfam match to entry PF01029 NusB, NusB family, FT score 119.00, E-value 8.8e-32" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Protein NusB stands for N FT utilization substance protein B. Functional classification FT - RNA synthesis, RNA modification and DNA transcription" FT /note="PMID:3019094, PMID:10881193" FT /db_xref="GOA:Q9PIC0" FT /db_xref="InterPro:IPR006027" FT /db_xref="InterPro:IPR011605" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIC0" FT /inference="protein motif:Pfam:PF01029" FT /protein_id="CAL34532.1" FT /translation="MATRHQVRQSVISLLYAFELNSQNNVFVDEILDEKKIRNEQKNFT FT LNLYNGILDNLNNIDETLNSFLNDNQITALGHVERAILRLGAYELLFTDTPSAIVINEA FT IELAKELANDNSPKFINGVLDALIKAKK" FT misc_feature complement(348747..349127) FT /note="HMMPfam hit to PF01029, NusB family, score 1.9e-36" FT /inference="protein motif:Pfam:PF01029" FT CDS complement(349139..349603) FT /transl_table=11 FT /gene="ribH" FT /locus_tag="Cj0383c" FT /product="6,7-dimethyl-8-ribityllumazine synthase" FT /EC_number="2.5.1.9" FT /note="Original (2000) note: Cj0383c, ribH (ribE),probable FT 6,7-dimethyl-8-ribityllumazine synthase (riboflavin FT synthase beta chain), len: 154 aa; similar to many e.g. FT RISB_BACSU 6,7-dimethyl-8-ribityllumazine synthase (EC FT 2.5.1.9) (154 aa), fasta scores; opt: 523 z-score: 959.8 FT E(): 0, 52.6% identity in 152 aa overlap. 67.5% identity to FT HP0002. Contains Pfam match to entry PF00885 DMRL_synthase, FT 6,7-dimethyl-8-ribityllumazine synthase, score 269.30, FT E-value 5e-77" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification FT -Biosynthesis of cofactors, prosthetic groups and carriers FT - Riboflavin" FT /note="PMID:12581640" FT /db_xref="GOA:Q9PIB9" FT /db_xref="InterPro:IPR002180" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIB9" FT /inference="protein motif:Pfam:PF00885" FT /protein_id="CAL34533.1" FT /translation="MNIIEGKLNLDSNTKIAIINARFNHIITDRLVEGAKDAFLRHGGK FT EENLSLILVPGAFELPYALKKAIESKKFDAICCVGAVIRGSTPHFDYVSAETTKGIANV FT SLNHNIPVSFGVLTTDTIEQAIERAGSKAGNKGFEAMTTVIEMLNLSKEL" FT misc_feature complement(349142..349573) FT /note="HMMPfam hit to FT PF00885,6,7-dimethyl-8-ribityllumazine synthase, score FT 1.8e-77" FT /inference="protein motif:Pfam:PF00885" FT CDS complement(349600..350415) FT /transl_table=11 FT /gene="kdsA" FT /locus_tag="Cj0384c" FT /product="3-deoxy-8-phosphooctulonate synthase" FT /EC_number="2.5.1.55" FT /note="Original (2000) note: Cj0384c, kdsA, probable FT 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P FT synthase), len: 271 aa; simlar to many e.g. KDSA_ECOLI FT 2-dehydro-3-deoxyphosphooctonate aldolase (EC 4.1.2.16) FT (284 aa), fasta scores; opt: 665 z-score: 1107.7 E(): FT 0,46.4% identity in 267 aa overlap. 63.2% identity to FT HP0003. Contains PS00017 ATP/GTP-binding site motif A FT (P-loop)" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. EC number and product FT function has now been updated. FT 2-dehydro-3-deoxyphosphooctonate aldolase, has been changed FT to 3-deoxy-8-phosphooctulonate synthase. Functional FT classification - Surface FT polysaccharides,lipopolysaccharides and antigens" FT /note="PMID:12581640" FT /db_xref="GOA:Q9PIB8" FT /db_xref="InterPro:IPR006218" FT /db_xref="InterPro:IPR006269" FT /db_xref="InterPro:IPR013785" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIB8" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34534.1" FT /translation="MKKMILIAGPCVIESKDLIFKVAEQLKNFNENPNIEFYFKSSFDK FT ANRTSINSFRGPGLEEGLKILQSVKDEFGMKILTDIHESNQANPVSEVADVLQIPAFLC FT RQTDLLVAAAKTKAKINIKKGQFLNPSDIKYSVKKVLQTRGIEDEGYEAAQRNGVFVAE FT RGASFGYGNLVVDMRSLVIMREFAPVIFDATHSVQMPGAAGGSSGGKSEFVEPLARAAA FT AVGIDGFFFETHINPCEALCDGPNMLNLTRLKNCVNTLLEIQNIIKENK" FT misc_feature complement(349609..350415) FT /note="HMMPfam hit to PF00793, DAHP synthetase I FT family,score 9.7e-105" FT /inference="protein motif:Pfam:PF00793" FT misc_feature complement(349783..349806) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(350412..351344) FT /transl_table=11 FT /locus_tag="Cj0385c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0385c, probable integral FT membrane protein, len: 310 aa; similar to many hypothetical FT integral membrane proteins e.g. TR:O29973 (EMBL:AE001087) FT Archaeoglobus fulgidus AF0266 (276 aa),fasta scores; opt: FT 155 z-score: 221.8 E(): 4.5e-05, 26.9% identity in 279 aa FT overlap. 30.8% identity to HP1234. Contains Pfam match to FT entry PF00892 DUF6, Integral membrane protein, score 29.90, FT E-value 5.9e-05" FT /note="Updated (2006) note: Pfam domain PF00892 Integral FT membrane protein DUF6 identified within CDS. Ten probable FT transmembrace helices identified by TMHMM2.0 within CDS. FT Further support given to product function. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PBC5" FT /db_xref="InterPro:IPR000620" FT /db_xref="UniProtKB/TrEMBL:Q0PBC5" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00892" FT /protein_id="CAL34535.1" FT /translation="MLKVIKHNLGIYFMILACLDFALMGACAKILSKEMSSIEIMFFRN FT IIGIFFIVYLLKRSKAHKEGGYFWLLVFRGVVGTLSLYMFFYNVSNITLGGAFAFQKTA FT PIFITLIAFVVFKENIGIKGWIGILIAFGGVLLIAQPWVHNLNHSGFDLKNSVIGITSG FT FLAALALTSVRELRKSYTTEQIAFSFILLGTLMPLISMISAEFFEPQHLDSLHLDFILA FT PFVMPSLTAWLIIAIMGTLGTIYQIHVTKAYGIAKQAGVVAGVSYLDVVFSMIVGIILG FT DNLPSTMVFLGIIGIIFGGLILVKNKGKK" FT misc_feature complement(join(351261..351320,351177..351233, FT 351084..351152,350997..351056,350916..350984, FT 350826..350879,350724..350792,350628..350696, FT 350502..350570,350433..350492)) FT /note="10 probable transmembrane helices predicted for FT Cj0385c by TMHMM2.0 at aa 9-28, 38-56, 65-87, FT 97-116,121-143, 156-173, 185-207, 217-239, 259-281 and FT 285-304" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(350925..351290) FT /note="HMMPfam hit to PF00892, Integral membrane protein FT DUF6, score 6.9e-16" FT /inference="protein motif:Pfam:PF00892" FT sig_peptide complement(351261..351344) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000173_350412_351344 by SignalP 2.0 FT HMM (Signal peptide probability 0.822) with cleavage site FT probability 0.676 between residues 28 and 29" FT misc_feature complement(351291..351323) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 351446..352828 FT /transl_table=11 FT /locus_tag="Cj0386" FT /product="putative GTP-binding protein" FT /note="Original (2000) note: Cj0386, probable GTP-binding FT protein; len: 460 aa; almost identical to, but longer than FT TR:P94645 (EMBL:U63330) C.jejuni putative GTPase (383 aa) FT (99.2% identity in 376 aa overlap), and similar to many FT members of the ERA/THDF family of GTP-binding proteins e.g. FT YPHC_BACSU (436 aa), fasta scores; opt: 717 z-score: 1271.3 FT E(): 0, 37.0% identity in 457 aa overlap. 51.6% identity to FT HP0834. Contains 2x PS00017 ATP/GTP-binding site motif A FT (P-loop)" FT /note="Updated (2006) note: Pfam domains x2 PF01926 GTPase FT of unknown function protein was identified within CDS. This FT family member is part of the G protein superfamily clan. FT Further support given towards product function. Putative FT kept within product function. Functional classification - FT Misc" FT /db_xref="GOA:Q9PIB6" FT /db_xref="InterPro:IPR005225" FT /db_xref="InterPro:IPR006073" FT /db_xref="InterPro:IPR015946" FT /db_xref="InterPro:IPR016484" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIB6" FT /inference="protein motif:Pfam:PF01926" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34536.1" FT /translation="MQSIILIGKPNVGKSSLFNRMARQRIAITSDISGTTRDTNKTQIH FT IHSKKAMLIDSGGLDESDELFKNVKKNTLKVAKESDIILYLVDGKLAPDDEDRQFFYSL FT KKLGKPIALVINKVDNKKDEERAWEFANFGVKEIFNLSVTHNVGLDELYEWLEKFLHEE FT FLIPDEEENLEDFLEYYEEGKEFQFKEVDQNHIRVGIVGRVNVGKSSLLNALVKQERSV FT VSSIAGTTIDPVNESVVHKDKVIEFVDTAGIRKRGKIQGLERFALNRTEKILSHSQIAL FT LVLDAHEGFNELDERIAGLVAKHYLGVIIVLNKWDKSEMDFDKTVKELRLDRFKFLAYA FT PVISVSALSGKRVHVLLDKILQIFENFTQKIQTSKLNTLIENATRAHPLPHDYGKLVKI FT YYAVQYDLAPPKIALIMNRPKALHFSYKRYLQNQIRKEFNFEGVPLVIASRKKGSKEND FT ES" FT misc_feature 351449..351802 FT /note="HMMPfam hit to PF01926, GTPase of unknown FT function,score 2.7e-36" FT /inference="protein motif:Pfam:PF01926" FT misc_feature 351467..351490 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 352031..352393 FT /note="HMMPfam hit to PF01926, GTPase of unknown FT function,score 1.3e-39" FT /inference="protein motif:Pfam:PF01926" FT misc_feature 352049..352072 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 352815..353312 FT /transl_table=11 FT /gene="aroK" FT /locus_tag="Cj0387" FT /product="shikimate kinase" FT /EC_number="2.7.1.71" FT /note="Original (2000) note: Cj0387, aroK, probable FT shikimate kinase, len: 165 aa; similar to many e.g. FT AROK_ECOLI shikimate kinase I (EC 2.7.1.71) (172 aa),fasta FT scores; opt: 268 z-score: 331.1 E(): 3.7e-11, 30.8% FT identity in 169 aa overlap. 40.6% identity to HP0157. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop) and FT Pfam match to entry PF01202 SKI, Shikimate kinase, score FT 106.90, E-value 3.8e-28" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Amino acid biosynthesis - Aromatic amino acid family" FT /note="PMID:7612934, PMID:1309529" FT /db_xref="GOA:Q0PBC3" FT /db_xref="InterPro:IPR000623" FT /db_xref="PDB:1VIA" FT /db_xref="UniProtKB/TrEMBL:Q0PBC3" FT /inference="protein motif:Pfam:PF01202" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34537.1" FT /translation="MMKAKNIVFIGFMGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQ FT KVSEIFEQKRENFFREQEQKMADFFSSCEKACIATGGGFVNVSNLEKAGFCIYLKADFE FT YLKKRLDKDEISKRPLFYDEIKAKKLYNERLSKYEQKANFILNIENKNIDELLSEIKKV FT IK" FT misc_feature 352845..352868 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 352851..353309 FT /note="HMMPfam hit to PF01202, Shikimate kinase, score FT 3.6e-48" FT /inference="protein motif:Pfam:PF01202" FT CDS 353309..354268 FT /transl_table=11 FT /gene="trpS" FT /locus_tag="Cj0388" FT /product="tryptophanyl-tRNA synthetase" FT /EC_number="6.1.1.2" FT /note="Original (2000) note: Cj0388, trpS,tryptophanyl-tRNA FT synthetase, len: 319 aa; similar to many e.g. SYW_ECOLI FT tryptophanyl-tRNA synthetase (EC 6.1.1.2) (334 aa), fasta FT scores; opt: 692 z-score: 1143.5 E(): 0,38.6% identity in FT 329 aa overlap. 37.3% identity to HP1253. Contains PS00178 FT Aminoacyl-transfer RNA synthetases class-I signature and FT Pfam match to entry PF00579 tRNA-synt_1b, tRNA synthetases FT class I (Trp and Tyr), score 113.70, E-value 3.6e-30" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Aminoacyl tRNA synthetases and their modification" FT /note="PMID:6171561" FT /db_xref="GOA:Q9PIB4" FT /db_xref="InterPro:IPR001412" FT /db_xref="InterPro:IPR002305" FT /db_xref="InterPro:IPR002306" FT /db_xref="InterPro:IPR014729" FT /db_xref="InterPro:IPR024109" FT /db_xref="PDB:3M5W" FT /db_xref="PDB:3TZL" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIB4" FT /inference="protein motif:Pfam:PF00579" FT /inference="protein motif:Prosite:PS00178" FT /protein_id="CAL34538.1" FT /translation="MRVLTGLQPSGDLHIGNYFGAIKQMVDAQEKSQMFMFIANYHAMT FT SSQDGEKLKQNSLKAAAAFLSLGIDPQKSVFWLQSDVKEVMELYWILSQFTPMGLLERA FT HSYKDKVAKGLSASHGLFSYPVLMAADILLFDTRIVPVGKDQIQHVEIARDIALKVNNE FT WGEIFTLPEARVNEEVAVVVGTDGAKMSKSYQNTIDIFSSEKTLKKQISSIVTDSTALE FT DPKDHENCNIFKIAKLFLDESGQKELQIRYEKGGEGYGHFKIYLNELVNAYFKEAREKY FT NELLEKPSHLKEILDFGATKARKIAQEKMQKIYEKIGL" FT misc_feature 353309..354133 FT /note="HMMPfam hit to PF00579, tRNA synthetases class I (W FT and Y), score 1.1e-66" FT /inference="protein motif:Pfam:PF00579" FT misc_feature 353333..353362 FT /note="PS00178 Aminoacyl-transfer RNA synthetases class-I FT signature" FT /inference="protein motif:Prosite:PS00178" FT CDS 354279..355514 FT /transl_table=11 FT /gene="serS" FT /locus_tag="Cj0389" FT /product="seryl-tRNA synthetase" FT /EC_number="6.1.1.11" FT /note="Original (2000) note: Cj0389, serS, seryl-tRNA FT synthetase, len: 411 aa; highly similar to many e.g. FT SYS_ECOLI seryl-tRNA synthetase (EC 6.1.1.11) (430 FT aa),fasta scores; opt: 1155 z-score: 1762.6 E(): 0, 47.0% FT identity in 423 aa overlap. 56.1% identity to HP1480. FT Contains PS00179 Aminoacyl-transfer RNA synthetases FT class-II signature 1 and Pfam match to entry PF00587 FT tRNA-synt_2b, tRNA synthetases class II (Gly, His, Pro and FT Ser), score 244.20, E-value 1.8e-69" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Aminoacyl tRNA synthetases and their modification" FT /note="PMID:3029694" FT /db_xref="GOA:Q9PIB3" FT /db_xref="InterPro:IPR002314" FT /db_xref="InterPro:IPR002317" FT /db_xref="InterPro:IPR006195" FT /db_xref="InterPro:IPR010978" FT /db_xref="InterPro:IPR015866" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIB3" FT /inference="protein motif:Pfam:PF00587" FT /inference="protein motif:Prosite:PS00179" FT /protein_id="CAL34539.1" FT /translation="MLDLKNLQNNFDEVAKKLKNKKVDENILKKLAELFASLKKEKIAL FT EEFQAFQNKFSKELATAEDKESLKAKLSENKSKINEQSAKVNALENELEEIAHAIPNIP FT DECVPVGEDENENVELKKVLNPPSFDFTPKEHFELGESLNWLDFMRGVKISQSRFCVLK FT NEGALLSRALVNYMIDFNRSRGFEFVNVPFLVNGATMFGTGQLPKFKEDMYKVDDEDLY FT LISTSEIPVTNLYSGEILASETLPIKMTCYSACFRKEAGSAGRDTRGIIRQHQFEKVEL FT VSITKPEQSDSVFNEMLECASDLLSSLGLAHRHLMLCTGDLGFSAAKTVDLEVWLPGQN FT KYREISSVSNCRDFQARRAKIRYKNEQGKNELVHTLNGSSLAVGRTLVAIMENYQDKEG FT KIHIPDVLKKYF" FT misc_feature 354279..354590 FT /note="HMMPfam hit to PF02403, Seryl-tRNA synthetase FT N-terminal domain, score 9.1e-26" FT /inference="protein motif:Pfam:PF02403" FT misc_feature 354750..355214 FT /note="HMMPfam hit to PF00587, tRNA synthetase class II FT core domain (G,, score 1.4e-52" FT /inference="protein motif:Pfam:PF00587" FT misc_feature 355044..355118 FT /note="PS00179 Aminoacyl-transfer RNA synthetases class-II FT signature 1" FT /inference="protein motif:Prosite:PS00179" FT CDS 355524..357986 FT /transl_table=11 FT /locus_tag="Cj0390" FT /product="putative transmembrane protein" FT /note="Original (2000) note: Cj0390, possible transmembrane FT protein, len: 820 aa; 28.7% identity in 703 aa overlap to FT HP1479. Contains possible transmembrane domain around aa FT 100 and Pfam match to entry PF00515 TPR,TPR Domain, score FT 26.90, E-value 0.00047" FT /note="Updated (2006) note: Pfam domains x4 PF07719 FT Tetratricopeptide repeat were identified within CDS. FT Functional classification - Membranes, lipoproteins and FT porins" FT /db_xref="GOA:Q0PBC0" FT /db_xref="InterPro:IPR001440" FT /db_xref="InterPro:IPR011990" FT /db_xref="InterPro:IPR013026" FT /db_xref="InterPro:IPR019734" FT /db_xref="UniProtKB/TrEMBL:Q0PBC0" FT /inference="protein motif:Pfam:PF07719" FT /inference="protein motif:Pfam:PF00515" FT /protein_id="CAL34540.1" FT /translation="MAEQEDIILEKPEDGLNQPRLDESLEGFKGQEGQAPEDEEFASLP FT EELPQENSESGFKFTRESAPEDVSTFEEVESQEPTPWYKDRKFMSLVGLSLGIICILVF FT TLFYLTFSEGKIKPDIIASKPLEQPVIMPDESYKYNDMQRIDGMIQKANALYLKGEVEQ FT ALKVYEQVAVYNESLSNYNLGVSQMNENKFQEAFESFKKAIANGENQSVAAINAAVCAL FT KLNDKEKFRYYIDLAQVYLPKEGKSKLYDYYLSLINYYKGYYPEALQMLQRTDVEPYSD FT VAKYLSAKIYAKMDFDSKAIQQLNSQGNFESSLSLGLLYARIGEYAKAKVALSTAMKIE FT RDFNQSLAALTLVDIKTGNYQDMLARLQNSYDNDKDRYKILDTYKIQVRLNKDLFNIAV FT AQNSFSKDLLKKQKDQFDLLFYFAPYQVFDSKQAALYIKKANVTDFVDDSTDAGIYLNI FT SKALSSTNVKIANIINYALNQKLRLANQEFQKLIKDYPEHSILHYNLALTYAQMQNYEL FT AYKHFSSSYHLNPKNYLAGAFAMFCAKLIDIDTTKLYNEILDNIAADSNFKANMQKSML FT FLVNNNYISMLPYLDETKKDTPLSLIFEAIVAKNNNLNNQVDVKIAKLRSELPEDILAN FT ILYFNSLNSNLNIKEYAQNAQIHFKNLKLDYRSVFGGPNIAREFYVNLMHIAGLLNLER FT QKFKELINVSGAKDEGILQTLAYLDIFAQQYEEAYALYNSLIDDYGAKDTKTLFLAAVA FT AVGANNPNSAIALLQLSKLTDKNNKESKAALGMLYQEVKNYEAAISQYKTLPNNFKSEF FT FTFDINNN" FT misc_feature 355791..355859 FT /note="1 probable transmembrane helix predicted for Cj0390 FT by TMHMM2.0 at aa 90-112" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 355956..356057 FT /note="HMMPfam hit to PF00515, Tetratricopeptide FT repeat,score 0.12" FT /note="HMMPfam hit to PF07719, Tetratricopeptide FT repeat,score 0.032" FT /inference="protein motif:Pfam:PF00515" FT /inference="protein motif:Pfam:PF07719" FT misc_feature 356064..356153 FT /note="HMMPfam hit to PF00515, Tetratricopeptide FT repeat,score 0.43" FT /inference="protein motif:Pfam:PF00515" FT misc_feature 356451..356552 FT /note="HMMPfam hit to PF07719, Tetratricopeptide FT repeat,score 0.15" FT /note="HMMPfam hit to PF00515, Tetratricopeptide FT repeat,score 0.034" FT /inference="protein motif:Pfam:PF00515" FT /inference="protein motif:Pfam:PF07719" FT misc_feature 357018..357119 FT /note="HMMPfam hit to PF00515, Tetratricopeptide FT repeat,score 5.3e-06" FT /note="HMMPfam hit to PF07719, Tetratricopeptide FT repeat,score 0.00052" FT /inference="protein motif:Pfam:PF00515" FT /inference="protein motif:Pfam:PF07719" FT stem_loop 357981..358018 FT CDS complement(358017..358652) FT /transl_table=11 FT /locus_tag="Cj0391c" FT /product="hypothetical protein Cj0391c" FT /note="Original (2000) note: Cj0391c, unknown, len: 211 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Literature search identified FT paper giving further clues to product function. Functional FT classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBB9" FT /protein_id="CAL34541.1" FT /translation="MQVNTFSNIASMARTQVSNKKADDAKENTKDKNVQSANSSKDVDK FT NTLEKLNALGGKGITQIYLVQFQQQTMNAVIGSSNAQTGLDSLLNGANLDTAKSILTNI FT DFASLGYSSKNPLDMNTDELQQLVSEDGFFGVENTANRIADFVIKGGGDDVEKLKKGLE FT GMKKGFEQAEKMWGGELPQISQNTIDAALKKVSDRIDELGGKTLDLQA" FT CDS complement(358750..360192) FT /transl_table=11 FT /gene="pyk" FT /locus_tag="Cj0392c" FT /product="pyruvate kinase" FT /EC_number="2.7.1.40" FT /note="Original (2000) note: Cj0392c, pyk, probable FT pyruvate kinase, len: 480 aa; similar to e.g. KPYK_BACSU FT pyruvate kinase (EC 2.7.1.40) (585 aa), fasta scores; opt: FT 1111 z-score: 1494.8 E(): 0, 41.8% identity in 476 aa FT overlap. No Hp match. Contains PS00659 Glycosyl hydrolases FT family 5 signature and Pfam match to entry PF00224 FT PK,Pyruvate kinase, score 523.20, E-value 1.8e-153" FT /note="Updated (2006) note: Pfam domain PF02887 Pyruvate FT kinase, alpha/beta domain protein was identified within FT CDS. Further support given to product function. FT Characterised within Bacillus subtilis with acceptable FT identity score. Putative not added to product function. FT Functional classification - Energy metabolism -Glycolysis" FT /note="PMID:10932722" FT /db_xref="GOA:Q0PBB8" FT /db_xref="InterPro:IPR001697" FT /db_xref="InterPro:IPR011037" FT /db_xref="InterPro:IPR015793" FT /db_xref="InterPro:IPR015794" FT /db_xref="InterPro:IPR015795" FT /db_xref="InterPro:IPR015806" FT /db_xref="InterPro:IPR015813" FT /db_xref="UniProtKB/TrEMBL:Q0PBB8" FT /inference="protein motif:Pfam:PF02887" FT /inference="protein motif:Pfam:PF00224" FT /inference="protein motif:Prosite:PS00659" FT /protein_id="CAL34542.1" FT /translation="MLKKTKIVATVGPASEKEEILRQMIINGVNVFRLNFSHGTHEYHK FT KNLDTIRRVAKELHTRIGILQDISGPKIRTGELKEPFELKKGDRLDFYRETILGEKIAQ FT NHYKISINQKSILDMLKIDEYIYLYDGSIRAKVVNIDNQKIETIIENDGFLNSNKGINF FT PNTKINIDVITQKDKNDLLWGIKNEVDFLAISFVQNAHDIDEVREILAQNNAKISIFAK FT IEKFDAVENIDEIIKSSDGIMVARGDLGIEVPYYKVPNIQKEIIQKANNASKPVITATQ FT MLFSLAKSKTATRAEISDVANAVLDGTDAVMLSEESAVGIDPANAVDIMCQTIIETEKR FT YPYNKFNDFNDLDNTDKIMRSSAHLATDLNADAIFSLTSSGKSAIKIARYRPNIEIIAV FT GHSEKTLNSLSIVWGVNPAILVNKSNELTELLKDSVRSSVEKGFMDEDKCYLLTAGFPT FT GVEGTSNLIRILNKEQIAYYLQ" FT misc_feature complement(358780..359130) FT /note="HMMPfam hit to PF02887, Pyruvate kinase, alpha/beta FT domain, score 1.4e-11" FT /inference="protein motif:Pfam:PF02887" FT misc_feature complement(359152..360189) FT /note="HMMPfam hit to PF00224, Pyruvate kinase, barrel FT domain, score 2.4e-135" FT /inference="protein motif:Pfam:PF00224" FT misc_feature complement(359623..359652) FT /note="PS00659 Glycosyl hydrolases family 5 signature" FT /inference="protein motif:Prosite:PS00659" FT CDS complement(360241..361587) FT /transl_table=11 FT /gene="mqo" FT /locus_tag="Cj0393c" FT /product="putative malate:quinone oxidoreductase" FT /EC_number="1.1.99.16" FT /note="Original (2000) note: Cj0393c, possible FT oxidoreductase, len: 448 aa; some simlarity to MQO_ECOLI FT probable malate:quinone oxidoreductase (548 aa), fasta FT scores; opt: 121 z-score: 223.1 E(): 3.8e-05, 24.6% FT identity in 455 aa overlap. 49.3% identity to HP0086. FT Contains PS00110 Pyruvate kinase active site signature" FT /note="Updated (2006) note: Pfam domain PF06039 FT Malate:quinone oxidoreductase (Mqo) protein was identified FT within CDS. Characterised within Helicobacter pylori with FT acceptable identity score. Product modified to more FT specific family member due to motif match and FT characterisation work. Putative kept within product FT function. Functional classification - Misc" FT /note="PMID:10809701" FT /db_xref="GOA:P56954" FT /db_xref="InterPro:IPR006231" FT /db_xref="UniProtKB/Swiss-Prot:P56954" FT /inference="protein motif:Pfam:PF06039" FT /inference="protein motif:Prosite:PS00110" FT /protein_id="CAL34543.1" FT /translation="MSQQEFDVLVIGAGISGAALFYELARYTNIKNIALIEKYNTAATL FT NSKGTSNSQTIHCGDIETNYTLEKARKVKRTADMIVKYGLMQNAQNNFMFSHQKMALAV FT GDIECDYMKKRYEEFKELYPYIKFFDKAKIKQIEPKVVLGEDCNQDRPENICAMGVESG FT EVFTTVDFGKMSINLIEQAQKQNKNTFVAFNQEIIHIEKKDDIFILKTSNHQEYHAKSV FT VVNAGAHSLYLAHKMNLGMDKSCWPVAGSFYLTKQKLLNGKVYMVQNPKLPFAALHGDP FT DLLADMNTRFGPTALVIPKLERYHGLKSVPEFFEALKLDKTVLKVTFNMFKDATIRNYI FT FYNYLFELPFVDKSLFVKDAKKIVPSLKASDIYYAKGFGGVRPQVIDKTKGELMLGEAS FT ITETPGIIFNMTPSPGATSCLGNAERDAKLVCNYLGMEFNEDKFSSELL" FT misc_feature complement(360244..361584) FT /note="HMMPfam hit to PF06039, Malate:quinone FT oxidoreductase (Mqo), score 1.3e-08" FT /inference="protein motif:Pfam:PF06039" FT misc_feature complement(360331..360363) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature complement(360667..360705) FT /note="PS00110 Pyruvate kinase active site signature" FT /inference="protein motif:Prosite:PS00110" FT CDS complement(361706..362335) FT /transl_table=11 FT /locus_tag="Cj0394c" FT /product="putative transcriptional activator" FT /note="Original (2000) note: Cj0394c, unknown, len: 209 aa; FT similar to hypothetical proteins e.g. TR:O67753 FT (EMBL:AE000763) Aquifex aeolicus AQ_1924 (229 aa), fasta FT scores; opt: 183 z-score: 230.1 E(): 1.6e-05. 26.2% FT identity in 225 aa overlap. 39.2% identity to HP0862" FT /note="Updated (2006) note: Pfam domain PF03309 Bordetella FT pertussis Bvg accessory factor (Baf) protein was identified FT within CDS. Product modified to more specific family member FT due to motif match. No specific characterisation has been FT carried out yet. Putative kept within product function. FT Functional classification - Broad regulatory functions" FT /note="PMID:11094274" FT /db_xref="GOA:Q0PBB6" FT /db_xref="InterPro:IPR004619" FT /db_xref="PDB:2NRH" FT /db_xref="UniProtKB/Swiss-Prot:Q0PBB6" FT /inference="protein motif:Pfam:PF03309" FT /protein_id="CAL34544.1" FT /translation="MLLCDIGNSNANFLDDNKYFTLNIDQFLEFKNEQKIFYINVNEHL FT KEHLKNQKNFINLEPYFLFDTIYQGLGIDRIAACYTIEDGVVVDAGSAITIDIISNSIH FT LGGFILPGIANYKKIYSHISPRLKSEFNTQVSLDAFPQKTMDALSYGVFKGIYLLIKDA FT AQNKKLYFTGGDGQFLANYFDHAIYDKLLIFRGMKKIIKENPNLLY" FT misc_feature complement(361838..362335) FT /note="HMMPfam hit to PF03309, Bordetella pertussis Bvg FT accessory fac, score 7.3e-09" FT /inference="protein motif:Pfam:PF03309" FT CDS complement(362322..362612) FT /transl_table=11 FT /locus_tag="Cj0395c" FT /product="hypothetical protein Cj0395c" FT /note="Original (2000) note: Cj0395c, unknown, len: 96 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PBB5" FT /protein_id="CAL34545.1" FT /translation="MIKILEQTIKALKLNLKPYDLSMLTRKKSYICAKDQNNILFMYTG FT KTKFLMKDALFLENLAQQININNKYFFSMASLCSKAKNHLEMKGFNIYVAL" FT CDS complement(362609..363607) FT /transl_table=11 FT /locus_tag="Cj0396c" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0396c, probable lipoprotein, FT len: 332 aa; 28.9% identity to HP0863. Conatins N-terminal FT signal sequence and PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="InterPro:IPR011042" FT /db_xref="InterPro:IPR011046" FT /db_xref="UniProtKB/TrEMBL:Q0PBB4" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34546.1" FT /translation="MKKIFLTLFCLIFLCACGTKRQYFEPKQTDGDLSHNSNLKSKIVD FT WNLVSAKLSNNTTILKNNISIDKFKLPKNYMLLAYQDGEYFTADNNGNLKIFDNSYNEI FT YNFQFDASVVGVASNGDDLALVLANNTIVLANRSLGIKFSQTLTSAPAQDSRTANPIFL FT DNIIVYPTLDGKILILSRNNLQIIKDVVISAENFFNNVIHLSVIGDKLIAATAKKIIVV FT SPARTLYLDADIKDVALSDDGIFILEKDGTIIKTDYNLRKIAEKKFEFAIFVKSNIYNN FT YLYIFEKTGYLIKMNLNLDNAQVFKLSEAVDKISFMGNGKFYYGDKILDLL" FT sig_peptide complement(363539..363607) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000179_362609_363607 by SignalP 2.0 FT HMM (Signal peptide probability 0.869) with cleavage site FT probability 0.381 between residues 23 and 24" FT misc_feature complement(363557..363589) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(363604..364182) FT /transl_table=11 FT /locus_tag="Cj0397c" FT /product="hypothetical protein Cj0397c" FT /note="Original (2000) note: Cj0397c, unknown, len: 192 aa; FT almost identical to C. jejuni hypothetical protein fragment FT TR:Q46096 (EMBL:U27272), 28.5% identity to HP0864" FT /note="Updated (2006) note: One probable transmembrace FT helices identified by TMHMM2.0 within CDS. Literature FT serach identified paper giving further clues about product FT function. Functional classification - Conserved FT hypothetical proteins" FT /note="PMID:10913692" FT /db_xref="UniProtKB/TrEMBL:Q0PBB3" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34547.1" FT /translation="MGLKDNLKAVKNELNTEEQFIENFIKGERFIRKYKFYISAVVIIL FT VAWFAGNFIISKINDYKTKEANEIYANLIQDPSNKNLLEQLKNKNTNLYAIFLLKENIN FT DFNNTTLQNELKQIYNNAQTNTLLKNIIALSLGDKSIFLKNYDKLLEAYKLLEQNKIEE FT ANVLLSQIKENSSLNQIAKNLKHYQGITQ" FT misc_feature complement(364018..364077) FT /note="1 probable transmembrane helix predicted for Cj0397c FT by TMHMM2.0 at aa 36-55" FT /inference="protein motif:TMHMM:2.0" FT CDS 364326..364610 FT /transl_table=11 FT /gene="gatC" FT /locus_tag="Cj0398" FT /product="Glu-tRNAGln amidotransferase subunit C" FT /EC_number="6.3.5.-" FT /note="Original (2000) note: Cj0398, gatC, probable FT Glu-tRNAGln amidotransferase subunit C, len: 94 aa; similar FT to e.g. TR:O06492 B. subtilis gatC (yedA) (101 aa), fasta FT scores; opt: 139 z-score: 248.0 E(): 1.6e-06,28.4% identity FT in 95 aa overlap. 40.6% identity to HP0975" FT /note="Updated (2006) note: Pfam domain PF02686 Glu-tRNAGln FT amidotransferase C subunit was identified within CDS. FT Further support given to product function. Characterised FT within Bacillus subtilis with marginal identity score. FT Putative not added to product function. Functional FT classification - Aminoacyl tRNA synthetases and their FT modification" FT /note="PMID:9342321" FT /db_xref="GOA:Q9PIA5" FT /db_xref="InterPro:IPR003837" FT /db_xref="UniProtKB/Swiss-Prot:Q9PIA5" FT /inference="protein motif:Pfam:PF02686" FT /protein_id="CAL34548.1" FT /translation="MQIDEKLLSKLEKLSALQITKNRNETIAQLSEIVNFVEKLNELDL FT DSQEITVSTIKGGAPLRIDEIRNSNVIDEVLDCAPKKQEHFFVVPKIIE" FT misc_feature 364380..364592 FT /note="HMMPfam hit to PF02686, Glu-tRNAGln amidotransferase FT C subunit, score 5.1e-09" FT /inference="protein motif:Pfam:PF02686" FT CDS 364678..365241 FT /transl_table=11 FT /locus_tag="Cj0399" FT /product="colicin V production protein homolog" FT /note="Original (2000) note: Cj0399, probable integral FT membrane protein, len: 187 aa; identical to C. jejuni FT hypothetical protein fragment TR:O68605 (EMBL:AF052056) FT (123 aa). 26.9% identity in 171 aa overlap to HP0181 (224 FT aa)" FT /note="Updated (2006) note: Four probable transmembrace FT helices identified by TMHMM2.0 within CDS. Pfam domain FT PF02674 Colicin V production protein identified within CDS. FT Product modified to more speicific family member based on FT motif matches. No specific characterisation with acceptable FT identity score has been carried out yet. Putative kept FT within product function. Functional classification - Misc" FT /db_xref="GOA:Q0PBB1" FT /db_xref="InterPro:IPR003825" FT /db_xref="UniProtKB/TrEMBL:Q0PBB1" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02674" FT /protein_id="CAL34549.1" FT /translation="MNFYWFDAFILGFTLLLGLKGIINGLIKEIFGLLGIIGGVFIASK FT YATQAAEFIQSTFYKIENQSLAGFAGFLAILIIFWIACLLAGNFLSKLIKLSGLGFLDR FT IGGFIFGGAKIFLIFAILVFCVARIDFLNDKLDNFAKNSYTLNLLKETGSFIMNQPLTE FT NSLDHASEKLQDIVSDLNNTQKGE" FT misc_feature order(364690..364758,364768..364821,364879..364947, FT 364990..365058) FT /note="4 probable transmembrane helices predicted for FT Cj0399 by TMHMM2.0 at aa 5-27, 31-48, 68-90 and 105-127" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 364690..365163 FT /note="HMMPfam hit to PF02674, Colicin V production FT protein, score 1.4e-48" FT /inference="protein motif:Pfam:PF02674" FT misc_feature 364894..364926 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 365243..365716 FT /transl_table=11 FT /gene="fur" FT /locus_tag="Cj0400" FT /product="ferric uptake regulator" FT /note="Original (2000) note: Cj0400, fur, ferric uptake FT regulator, len: 157 aa; identical to FUR_CAMJE ferric FT uptake regulation protein, and highly simliar to many FT others e.g. FUR_BORPE (139 aa), fasta scores; opt: 354 FT z-score: 552.9 E(): 1.7e-23 41.6% identity in 137 aa FT overlap. 40.8% identity to HP1027" FT /note="Updated (2006) note: Pfam domain PF01475 Ferric FT uptake regulator family was identified within CDS. FT Characterised within Campylobacter jejuni. Putative not FT added to product function. Functional classification -Broad FT regulatory functions" FT /note="PMID:8083178, PMID:7590316, PMID:9765558" FT /db_xref="GOA:P0C631" FT /db_xref="InterPro:IPR002481" FT /db_xref="UniProtKB/Swiss-Prot:P0C631" FT /inference="protein motif:Pfam:PF01475" FT /protein_id="CAL34550.1" FT /translation="MLIENVEYDVLLERFKKILRQGGLKYTKQREVLLKTLYHSDTHYT FT PESLYMEIKQAEPDLNVGIATVYRTLNLLEEAEMVTSISFGSAGKKYELANKPHHDHMI FT CKNCGKIIEFENPIIERQQALIAKEHGFKLTGHLMQLYGVCGDCNNQKAKVKI" FT misc_feature 365303..365668 FT /note="HMMPfam hit to PF01475, Ferric uptake regulator FT family, score 1.4e-63" FT /inference="protein motif:Pfam:PF01475" FT CDS 365717..367222 FT /transl_table=11 FT /gene="lysS" FT /locus_tag="Cj0401" FT /product="lysyl-tRNA synthetase" FT /EC_number="6.1.1.6" FT /note="Original (2000) note: Cj0401, lysS, lysyl-tRNA FT synthetase, len: 501 aa; 99.8% identical to SYK_CAMJE FT lysyl-tRNA synthetase (EC 6.1.1.6) (501 aa), and highly FT similar to many e.g. SYK2_ECOLI lysyl-tRNA synthetase,heat FT inducible (504 aa, fasta scores; )opt: 1526 z-score: 2137.2 FT E(): 0, 47.6% identity in 498 aa overlap. 58.8% identity to FT HP0182. Conatains PS00179 and PS00339 Aminoacyl-transfer FT RNA synthetases class-II signatures 1 and 2, and Pfam match FT to entry PF00152 tRNA-synt_2, tRNA synthetases class II, FT score 690.40, E-value 8.5e-204" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Putative not added to product FT function. Functional classification - Aminoacyl tRNA FT synthetases and their modification" FT /note="PMID:1732205" FT /db_xref="GOA:P41258" FT /db_xref="InterPro:IPR002313" FT /db_xref="InterPro:IPR004364" FT /db_xref="InterPro:IPR004365" FT /db_xref="InterPro:IPR006195" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR016027" FT /db_xref="InterPro:IPR018149" FT /db_xref="InterPro:IPR018150" FT /db_xref="UniProtKB/Swiss-Prot:P41258" FT /inference="protein motif:Pfam:PF00152" FT /inference="protein motif:Prosite:PS00339" FT /inference="protein motif:Prosite:PS00179" FT /protein_id="CAL34551.1" FT /translation="MFDNILEQQRIEKAKELKNLGINPYPHFLEKEMSLKTFKDKFSYI FT LEQVEKRDESVNAVVAGRLKLLRIAGKSIFANIEDEDTNLQIYFSKDSVGEELYTILKK FT NLEVGDIVLVKGFPFVTKTGEFSLHASEVKLATKAIVPLPEKYHGLTDIEQRYRKRYVD FT MIMNVEVRKDFLVRSKVVSLIRHFFENKGFLEVETPMMHPIAGGANAKPFVTFHNSLGV FT ERFLRIAPELYLKRLIVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLM FT DLTEELFALLLDKLNLGKTIEFDGKMINFSKPFERITYKDALCKYGGLDRDLIEDKEKI FT LTKLKADGFEANEKLELGHLQAELFDNYVEEKLINPTFVIDFPISISPLSRRSDEDSQI FT AERFELFICGRELANGFNELNDPLDQYERFLKQIEAKNAGDEEACEMDEDFVNALGYGM FT PPTAGQGIGIDRLVMLLTNKKSIRDVILFPAMRPLKSELKEKE" FT misc_feature 365888..366124 FT /note="HMMPfam hit to PF01336, OB-fold nucleic acid binding FT domain, score 5e-15" FT /inference="protein motif:Pfam:PF01336" FT misc_feature 366170..367192 FT /note="HMMPfam hit to PF00152, tRNA synthetases class II FT (D, K and N), score 4.6e-205" FT /inference="protein motif:Pfam:PF00152" FT misc_feature 366470..366523 FT /note="PS00179 Aminoacyl-transfer RNA synthetases class-II FT signature 1" FT /inference="protein motif:Prosite:PS00179" FT misc_feature 367109..367138 FT /note="PS00339 Aminoacyl-transfer RNA synthetases class-II FT signature 2" FT /inference="protein motif:Prosite:PS00339" FT CDS 367219..368463 FT /transl_table=11 FT /gene="glyA" FT /locus_tag="Cj0402" FT /product="serine hydroxymethyltransferase" FT /EC_number="2.1.2.1" FT /note="Original (2000) note: Cj0402, glyA, serine FT hydroxymethyltransferase, len: 414 aa; 99.3% identical to FT GLYA_CAMJE serine hydroxymethyltransferase (EC 2.1.2.1) FT (414 aa), and highly similar to many e.g. GLYA_ECOLI serine FT hydroxymethyltransferase (417 aa) fasta scores; opt: 1571 FT z-score: 2309.4 E(): 0, 55.7% identity in 411 aa overlap. FT 68.4% identity to HP0183. Contains PS00096 Serine FT hydroxymethyltransferase pyridoxal-phosphate attachment FT site and Pfam match to entry PF00464 SHMT, Serine FT hydroxymethyltransferase, score 944.50, E-value 2.3e-283" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Putative not added to product FT function. Functional classification - Amino acid FT biosynthesis - Serine family" FT /note="PMID:2060796" FT /db_xref="GOA:P24531" FT /db_xref="InterPro:IPR001085" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="InterPro:IPR019798" FT /db_xref="PDB:3N0L" FT /db_xref="UniProtKB/Swiss-Prot:P24531" FT /inference="protein motif:Pfam:PF00464" FT /inference="protein motif:Prosite:PS00096" FT /protein_id="CAL34552.1" FT /translation="MSLEMFDKEIFDLTNKELERQCEGLEMIASENFTLPEVMEVMGSI FT LTNKYAEGYPGKRYYGGCEFVDEIETLAIERCKKLFNCKFANVQPNSGSQANQGVYAAL FT INPGDKILGMDLSHGGHLTHGAKVSSSGKMYESCFYGVELDGRIDYEKVREIAKKEKPK FT LIVCGASAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAGEHPSPFPYAHVVSSTT FT HKTLRGPRGGIIMTNDEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEWKVYA FT KQVRTNAQVLANVLMDRKFKLVSDGTDNHLVLMSFLDREFSGKDADLALGNAGITANKN FT TVPGEIRSPFITSGLRLGTPALTARGFKEKEMEIVSNYIADILDDVNNEKLQENIKQEL FT KKLASNFIIYERAMF" FT misc_feature 367225..368355 FT /note="HMMPfam hit to PF00464, Serine FT hydroxymethyltransferase, score 1.9e-282" FT /inference="protein motif:Pfam:PF00464" FT misc_feature 367864..367914 FT /note="PS00096 Serine hydroxymethyltransferase FT pyridoxal-phosphate attachment site" FT /inference="protein motif:Prosite:PS00096" FT CDS 368460..369005 FT /transl_table=11 FT /locus_tag="Cj0403" FT /product="hypothetical protein Cj0403" FT /note="Original (2000) note: Cj0403, unknown, len: 181 aa; FT 57.8% identity to HP0184" FT /note="Updated (2006) note: Literature search identified FT paper giving further clues to product function. Functional FT classification - Conserved hypothetical proteins" FT /note="PMID:12595250" FT /db_xref="InterPro:IPR015061" FT /db_xref="UniProtKB/TrEMBL:Q0PBA7" FT /protein_id="CAL34553.1" FT /translation="MISPMDMSLIKIIGDHYYIRRDKIVNKITHRGRLFFDKFERVDAP FT LNLNVMREHAAKKIVVAHDLITKDNKVENIVFDYNGFNAERFYHRAQLILREEGFINFT FT AYKTKTPGHLHLYIHKGHTALNEGYSLASKLSMMFASKMPVEWKVFPSMDVPREFNILI FT LPYEVYQKERGSSWSKHM" FT CDS 369019..369855 FT /transl_table=11 FT /locus_tag="Cj0404" FT /product="putative transmembrane protein" FT /note="Original (2000) note: Cj0404, probable transmembrane FT protein, len: 278 aa; no Hp match. Contains probable FT transmembrane domain around 40 aa" FT /note="Updated (2006) note: Literature search identified FT paper giving further clues to product function. Functional FT classification - Membranes, lipoproteins and porins" FT /note="PMID:12595250" FT /db_xref="GOA:Q0PBA6" FT /db_xref="InterPro:IPR007730" FT /db_xref="UniProtKB/TrEMBL:Q0PBA6" FT /protein_id="CAL34554.1" FT /translation="MENQKNEFDDIILEKSNKSEKVKKILLRVIALVILFLAIMIVMKL FT INGSGDENTQNQSVLPSEPIATQDNNNDTSFESMPITDNTSAEDQFEALRKQFQDEQNT FT TQNTTTSSSNNNDTTNFAMPDQEVPAEPTATTSANTTPQASTPKQEVTQTAKSKEEAKK FT QTAVKKEKESAKQTPKKEQNANDLFKNVDAKPVHPSGLASGIYVQIFSVSNLDQKSKEL FT ASVKQKGYDYKLYKTTVGSKEITKVLIGPFEKADIAAELAKIRKDIAKDAFSFTLK" FT misc_feature 369091..369144 FT /note="1 probable transmembrane helix predicted for Cj0404 FT by TMHMM2.0 at aa 25-42" FT /inference="protein motif:TMHMM:2.0" FT CDS 369852..370640 FT /transl_table=11 FT /gene="aroE" FT /locus_tag="Cj0405" FT /product="shikimate 5-dehydrogenase" FT /EC_number="1.1.1.25" FT /note="Original (2000) note: Cj0405, aroE, probable FT shikimate 5-dehydrogenase, len: 262 aa; similar to many FT e.g. AROE_ECOLI shikimate 5-dehydrogenase (EC 1.1.1.25) FT (272 aa), fasta scores; opt: 255 z-score: 444.1 E(): FT 1.9e-17, 29.9% identity in 274 aa overlap. 41.2% identity FT to HP1249" FT /note="Updated (2006) note: Pfam domain PF01488 Shikimate / FT quinate 5-dehydrogenase family was identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli with marginal identity score. FT Putative not added to product function. Functional FT classification - Amino acid biosynthesis -Aromatic amino FT acid family" FT /note="PMID:3277621" FT /db_xref="GOA:Q0PBA5" FT /db_xref="InterPro:IPR006151" FT /db_xref="InterPro:IPR011342" FT /db_xref="InterPro:IPR013708" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR022893" FT /db_xref="UniProtKB/TrEMBL:Q0PBA5" FT /inference="protein motif:Pfam:PF01488" FT /protein_id="CAL34555.1" FT /translation="MKFLAVIGDPISHSKSPRMHNNAIKALGLDSIYTRYHLRNANCLR FT EDFFKLGLSGANITLPFKEKALDIADVKDDFARNIGSANTLCLKEDKIYAYNTDALGFL FT EAIKDFDNIKKALILGAGGTALALAYVLKQKGVEVYIANRSKERFKDFLAYPTYLYKNL FT QDFDFDLVINSTSAGLKDENLPCDRELLDRILPKAKFAFEVIYGRETPFYRLCKEYHLK FT IKDGLDMLLWQGVFAFELFFEIQDKREMIKNAMQQALILK" FT misc_feature 369906..370583 FT /note="HMMPfam hit to PF01488, Shikimate / quinate FT 5-dehydrogenase, score 8.1e-54" FT /inference="protein motif:Pfam:PF01488" FT CDS complement(370715..371614) FT /transl_table=11 FT /locus_tag="Cj0406c" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0406c, probable lipoprotein, FT len: 299 aa; no Hp match. Contains N-terminal signal FT sequence and PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site. Functional classification - Membranes, FT lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PBA4" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34556.1" FT /translation="MKKYILLASSMLILAACGGTSSNFVNVSMPNFKPQVPTKVEPIDS FT GVSIALVPINIEQNNNYSDYFENSVLKIRIEKEIDLLKQNLEEQIKTIAQLKGYKIVTT FT NPDYTLKSSISIYTEEKNVQKTSNFMSGDYVKSNLGINFKGKIDFIDAHNPQNSTNLSS FT STKLDSLVALNYPIKNDDGVNMFKTTISTVPTQLNKGLEQPAFEIDKSFLAFYKNTLNT FT LYNNLPKATDIGKTIPNTNSGFNSFDGDATFEESLPQTNSNQNNTIENAPTQNIPTNPS FT STNQNNQSKNQDGVEIFE" FT sig_peptide complement(371495..371614) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000184_370715_371614 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.319 between residues 40 and 41" FT misc_feature complement(371534..371602) FT /note="1 probable transmembrane helix predicted for Cj0406c FT by TMHMM2.0 at aa 5-27" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(371564..371596) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 371704..372519 FT /transl_table=11 FT /gene="lgt" FT /locus_tag="Cj0407" FT /product="prolipoprotein diacylglyceryl transferase" FT /EC_number="2.4.99.-" FT /note="Original (2000) note: Cj0407, lgt, probable FT prolipoprotein diacylglyceryl transferase, len: 271 aa; FT similar to many e.g. LGT_ECOLI prolipoprotein FT diacylglyceryl transferase (EC 2.4.99.-) (291 aa), fasta FT scores; opt: 182 z-score: 753.7 E(): 0, 32.0% identity in FT 281 aa overlap. 52.5% identity to HP0955. Contains PS01311 FT Prolipoprotein diacylglyceryl transferase signature" FT /note="Updated (2006) note: Pfam domain PF01790 FT Prolipoprotein diacylglyceryl transferase was identified FT within CDS. Seven probable transmembrane helices predicted FT by TMHMM2.0. Further support given to product function. FT Characterised within Escherichia coli with marginal FT identity score. Putative not added to product function. FT Functional classification - Synthesis and modification of FT macromolecules - Phospholipids" FT /note="PMID:8051048" FT /db_xref="GOA:Q9PI98" FT /db_xref="InterPro:IPR001640" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI98" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01790" FT /inference="protein motif:Prosite:PS01311" FT /protein_id="CAL34557.1" FT /translation="MEFWQHIYSNFNVIAFSIFGLKVHWYGIMYVIALLLALLLAKFFV FT RKFQLDINEKHLDSYFIWVEIGVILGARLGYILIYDANTMYYITHPWQIFNPYINGEFV FT GIRGMSYHGAIIGFLIATLLFCKKYKTNPWIFLDLVALSVPLAYVFGRIGNFLNQELFG FT RITNVPWGIYVDGVLRHPSQLYEAFLEGIVVFIIVYLARFKQSFQGELILVYAGAYSLA FT RFICEFYREPDFGIGFVLWGMSMGQILSFIMFITALLVYICIKFKKVNI" FT misc_feature 371734..372504 FT /note="HMMPfam hit to PF01790, Prolipoprotein FT diacylglyceryl transferase, score 4e-120" FT /inference="protein motif:Pfam:PF01790" FT misc_feature order(371770..371838,371899..371967,372010..372078, FT 372097..372165,372253..372306,372319..372378, FT 372421..372489) FT /note="7 probable transmembrane helices predicted for FT Cj0407 by TMHMM2.0 at aa 23-45, 66-88, 103-125, FT 132-154,184-201, 206-225 and 240-262" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 372154..372192 FT /note="PS01311 Prolipoprotein diacylglyceryl transferase FT signature" FT /inference="protein motif:Prosite:PS01311" FT CDS 372589..373371 FT /transl_table=11 FT /gene="frdC" FT /locus_tag="Cj0408" FT /product="fumarate reductase cytochrome B subunit" FT /note="Original (2000) note: Cj0408, frdC, probable FT fumarate reductase cytochrome B subunit, len: 260 aa; FT similar to FRDC_WOLSU fumarate reductase cytochrome B FT subunit (256 aa), fasta scores; opt: 823 z-score: 1258.2 FT E(): 0, 53.6% identity in 235 aa overlap. 50.0% identity to FT HP0193" FT /note="Updated (2006) note: Pfam domain PF02967 Fumarate FT reductase respiratory complex was identified within CDS. FT Five probable transmembrane helices predicted by TMHMM2.0. FT Characterised within Wolinella succinogenes with acceptable FT identity score. Putative not added to product function. FT Functional classification - Energy metabolism FT -Tricarboxylic acid cycle" FT /note="PMID:9492313" FT /db_xref="GOA:Q0PBA2" FT /db_xref="InterPro:IPR000701" FT /db_xref="InterPro:IPR004224" FT /db_xref="UniProtKB/TrEMBL:Q0PBA2" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02967" FT /protein_id="CAL34558.1" FT /translation="MRELIEGYLGKSIEGKKSKMPAKLDFIQSASGLFLGLFMWVHMLF FT VSTILVSEDFFNSVVHFLELKFVYDNPVMSYLTSFLAACVLVVFFVHALLAMRKFPINY FT RQYQILRTHSKKMNHSDTSLWWVQAFTGFIMFFLGSAHLIFIVTNADKISGDMSGDRVV FT SHFMWLFYAVLLVCVELHGSIGLYRLCVKWGWFEGKNVKESRKKLKTAKWIISIFFLVL FT GVLSLAAFIKIGYENYQNQTQTTAMIKNYNGANYEYTI" FT misc_feature 372589..372600 FT /note="PS00228 Tubulin-beta mRNA autoregulation signal" FT /inference="protein motif:Prosite:PS00228" FT misc_feature 372589..373314 FT /note="HMMPfam hit to PF02967, Fumarate reductase FT respiratory complex, tr, score 8e-102" FT /inference="protein motif:Pfam:PF02967" FT misc_feature order(372673..372741,372805..372873,372961..373029, FT 373087..373155,373225..373293) FT /note="5 probable transmembrane helices predicted for FT Cj0408 by TMHMM2.0 at aa 29-51, 73-95, 125-147, 167-189 and FT 213-235" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 372808..372840 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 373355..375346 FT /transl_table=11 FT /gene="frdA" FT /locus_tag="Cj0409" FT /product="fumarate reductase flavoprotein subunit" FT /EC_number="1.3.99.1" FT /note="Original (2000) note: Cj0409, frdA, probable FT fumarate reductase flavoprotein subunit, len: 663 aa; FT FRDA_WOLSU fumarate reductase flavoprotein subunit (EC FT 1.3.99.1) (656 aa), fasta scores; opt: 3050 z-score: 3174.9 FT E(): 0, 68.2% identity in 660 aa overlap. 62.2% identity to FT HP0192. Contains Pfam match to entry PF00890 FAD_binding_2, FT FAD binding domain, score 535.80, E-value 2.9e-157" FT /note="Updated (2006) note: Pfam domain PF02910 Fumarate FT reductase/succinate dehydrogenase was identified within FT CDS. Characterised within Wolinella succinogenes with FT acceptable identity score. Putative not added to product FT function. Functional classification - Energy metabolism FT -Tricarboxylic acid cycle" FT /note="PMID:9492313" FT /db_xref="GOA:Q0PBA1" FT /db_xref="InterPro:IPR003953" FT /db_xref="InterPro:IPR004112" FT /db_xref="InterPro:IPR014006" FT /db_xref="InterPro:IPR015939" FT /db_xref="UniProtKB/TrEMBL:Q0PBA1" FT /inference="protein motif:Pfam:PF02910" FT /inference="protein motif:Pfam:PF00890" FT /protein_id="CAL34559.1" FT /translation="MNIQYSDALVIGGGLAGLRAAIEVAKSGQSVTLLSICPVKRSHSA FT AVQGGMQASLANGAKGEGDNEDLHFADTVKGSDWGCDQEVARMFAQTAPKAVRELAAWG FT VPWTRVTKGPRTVVINAQKTVIEEKEEAHGLINARDFGGTKKWRTCYIADATGHCMLYG FT VANEAIKHQVKIIDRMEAVRIIHDGKKCLGVIARDLTNGQLIAYIARGTMIATGGYGRI FT YKQTTNAVICEGTGAAIALETGLCRLSNMEAVQFHPTPIVPSGILLTEGCRGDGGILRD FT VDGYRFMPDYEPEKKELASRDVVSRRMMEHIRKGKGVKSPYGDHLWLDISILGRAHVEK FT NLRDVQDICKTFNGIDPADEGPKGWAPVLPMQHYSMGGIRTKPTGESQWLNGLFACGEA FT ACWDMHGFNRLGGNSCAETVVAGMIVGDYFADYCKNNGEVIDTNVVKDFLTKEYQYLKS FT LVDKEGKHNVFEIKNRMKEIMWDKVAIFRTGEGLKEAVDELEKLYKDSQDVKVHCKELD FT CANPELEEAYRVPRMLKIALCVAYGALLRTESRGAHYREDYPKRDDLNWMKRTNTFWVE FT GETLPRIEYEELDIMKMEIPPAFRGYGAKGNIIENPLSEKRQAEVDAIREKMEAEGKGR FT YEIQNALMPYELQAKYKAPNQRIGVDYE" FT misc_feature 373742..374710 FT /note="HMMPfam hit to PF00890, FAD binding domain, score FT 2e-160" FT /inference="protein motif:Pfam:PF00890" FT misc_feature 374768..375160 FT /note="HMMPfam hit to PF02910, Fumarate reductase/succinate FT dehydroge, score 6.4e-53" FT /inference="protein motif:Pfam:PF02910" FT CDS 375339..376064 FT /transl_table=11 FT /gene="frdB" FT /locus_tag="Cj0410" FT /product="fumarate reductase iron-sulfur protein" FT /EC_number="1.3.99.1" FT /note="Original (2000) note: Cj0410, frdB, probable FT fumarate reductase iron-sulfur protein, len: 723 aa; FT similar to FRDB_WOLSU fumarate reductase iron-sulfur FT protein (EC 1.3.99.1) (239 aa), fasta scores; opt: 1211 FT z-score: 1762.6 E(): 0, 68.4% identity in 237 aa overlap. FT 65.8% identity to HP0191. Contains PS00197 2Fe-2S FT ferredoxins, iron-sulfur binding region signature and Pfam FT match to entry PF00037 fer4, 4Fe-4S ferredoxins and related FT iron-sulfur cluster binding domains., score 41.20,E-value FT 1.1e-10" FT /note="Updated (2006) note: Pfam domain PF00111 2Fe-2S FT iron-sulfur cluster binding domain was identified within FT CDS. Characterised within Wolinella succinogenes with FT acceptable identity score. Putative not added to product FT function. Functional classification - Energy metabolism FT -Tricarboxylic acid cycle" FT /note="PMID:9492313" FT /db_xref="GOA:Q0PBA0" FT /db_xref="InterPro:IPR001041" FT /db_xref="InterPro:IPR004489" FT /db_xref="InterPro:IPR006058" FT /db_xref="InterPro:IPR009051" FT /db_xref="InterPro:IPR012285" FT /db_xref="InterPro:IPR012675" FT /db_xref="InterPro:IPR017896" FT /db_xref="UniProtKB/TrEMBL:Q0PBA0" FT /inference="protein motif:Pfam:PF00111" FT /inference="protein motif:Pfam:PF00037" FT /inference="protein motif:Prosite:PS00197" FT /protein_id="CAL34560.1" FT /translation="MSRKLTIKAFKYNPLSKISKPHFVTYELEETPFMTVFVCLTLIRE FT KMDADLSFDFVCRAGICGSCAMMINGVPKLACKTLTKDYPDGVIELMPMPAFRHIKDLS FT VNTGEWFEDMCKRVESWVHNEKETDISKLEERIEPEVADETFELDRCIECGICVASCAT FT KLMRPNFIAATGLLRTARYLQDPHDHRSVEDFYELVGDDDGVFGCMSLLACEDNCPKEL FT PLQSKIAYMRRQLVAQRNK" FT misc_feature 375420..375587 FT /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster FT binding domain, score 0.0037" FT /inference="protein motif:Pfam:PF00111" FT misc_feature 375507..375533 FT /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00197" FT misc_feature 375768..375839 FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 0.0015" FT /inference="protein motif:Pfam:PF00037" FT misc_feature 375948..375980 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 376092..378278 FT /transl_table=11 FT /locus_tag="Cj0411" FT /product="putative ATP/GTP binding protein" FT /note="Original (2000) note: Cj0411, probable ATP/GTP FT binding protein, len: 728 aa; some similarity in C-term to FT YOR6_CALSR hypothetical protein (402 aa), fasta scores; FT opt: 220 z-score: 284.9 E(): 1.4e-08, 25.2% identity in 425 FT aa overlap, and to C-term of YPBR_BACSU hypothetical FT protein (1193 aa), fasta scores; opt: 173 z-score: 275.1 FT E(): 5e-08, 20.1% identity in 722 aa overlap. No Hp match. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF00350 Dynamin FT family protein was identified within CDS. Dynamin is a FT member of the G-protein superfamily clan. ATP/GTP binding FT proteins fall under this particular clan. Further support FT given to product function. No specific characterisation has FT been carried out yet. Putative kept within product FT function. Functional classification - Misc" FT /db_xref="GOA:Q0PB99" FT /db_xref="InterPro:IPR001401" FT /db_xref="UniProtKB/TrEMBL:Q0PB99" FT /inference="protein motif:Pfam:PF00350" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34561.1" FT /translation="MKELFQKIWQNELQFLNFDAKFQDKSKLDTAECAIILSVNKDNYE FT RYFLLKEFQELCKKIDLRVDIFSMQNAQICILNLFKSGFISKQDLLKALKILEKISKNT FT EIFDFILQEKVQSIDQKALFQNDFKELNTINLELQKLSFDENLKSRLQKTLEKFQNLEF FT NIAITGVMNAGKSSLLNALLKEDFLGVSNIPETANLTVLSYGKSEEAKIYFWDKKEWQN FT ILESSHFNADLKEFIDKLDKSVNIEDFIKDKPLIQNIALCELKNFSSAKNKISALIKKI FT EIKSHLEFLKNNISIVDTPGLDDVVVQREIVTNEYLRESDFLIHLMNASQSLTQKDADF FT LVHCLLNSRLSKFLIVLTKADLLSKKDLEEVIVYTKESLKSRLVDLDENLVEKIDFLCV FT SAKMASDFYKGLASKESLQKSGMQEFENYLFNELYAGEKSKIALRAYKKELHLELKNIL FT SEYEMQNRLIKENKQGVSEENQKLLLELQKQNTLLKEAQDEISNSIAKLKNIDSGIDNL FT VLLLAKKLKERLIDEFKYLKNNAQKLNLSRILNIVDITTKDGINDILREIKFENIKKIE FT ELKTNLSLKYDFLKDDFDNGFEGFKDGISKNIDSIFQSEKFALLRLKIEKLSNLKSDLY FT ELETNLDTVIFDTFKEFKMSEILNSLNINGAFFEFLNDKLKHYEKNQKSKLESLEKVLQ FT SLKNQDANILNSFEENLEKIEKLKQLEMGLLNAD" FT misc_feature 376578..377174 FT /note="HMMPfam hit to PF01926, GTPase of unknown FT function,score 2e-08" FT /inference="protein motif:Pfam:PF01926" FT misc_feature 376584..377171 FT /note="HMMPfam hit to PF00350, Dynamin family, score FT 8.1e-52" FT /inference="protein motif:Pfam:PF00350" FT misc_feature 376596..376619 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 378268..380097 FT /transl_table=11 FT /locus_tag="Cj0412" FT /product="putative ATP/GTP binding protein" FT /note="Original (2000) note: Cj0412, probable ATP/GTP FT binding protein, len: 609 aa; some similarity to YPBR_BACSU FT hypothetical protein (1193 aa), fasta scores; opt: 172 FT z-score: 237.5 E(): 6.2e-06, 23.7% identity in 439 aa FT overlap. No Hp match. Contains PS00017 ATP/GTP-binding site FT motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF00350 Dynamin FT family protein was identified within CDS. Dynamin is a FT member of the G-protein superfamily clan. ATP/GTP binding FT proteins fall under this particular clan. Further support FT given to product function. Literature search identified FT paper giving further clues to product function. Functional FT classification - Misc" FT /db_xref="GOA:Q0PB98" FT /db_xref="InterPro:IPR001401" FT /db_xref="InterPro:IPR022812" FT /db_xref="UniProtKB/TrEMBL:Q0PB98" FT /inference="protein motif:Pfam:PF00350" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34562.1" FT /translation="MQINLLNDFIKAYENTYSVSFDDSFKGRIQELCKELNEPFMHASY FT ALENELKELVFSLDKNVNIAIIGQFSSGKSSLLNLILGRDCLPTGVVPVTFKPTFLRYA FT KEYFLRVEFEDGSDIITNIEKLAFYTDQRNEVKQAKSLHIFAPIPLLEKITLVDTPGLN FT ANENDTLTTLDELKNIHGAIWLSLIDNAGKKSEEDAIKANLELLGENSICVLNQKDKLS FT AEELDNVLNYAKSVFLKYFNELIAISCKEAKDEQSYEKSNFQSLLDFLTQLDTTVLKEK FT FVKRKILNLCEILEDENQLFVGIFDRLLNQFQSYEKHLLLAYENFLKEIEILNHQILEQ FT LKSISERISSEIFASVKEKDAYFYKESKGFLKKDLYTRYDYKAPYISSDDAFLAMFYNS FT DVMSKEFKKIKNELYKSFEEIKMKLKDFINILEREILLFKAEFSNIQKDHIFQSDKNFS FT ELRAFCNASDEYFLKDFKELLFKSILELDLFFEKLNLKAFTNYENATKLSLAFFSRKIN FT ESRVLYELDSSEFVLFYPKKSEIYERVLNELNVYEFETLLINKPILTKIAKNFLEQSQN FT LIQEKNKFLDLKKAELQKRRAQILNVRESIKED" FT misc_feature 378451..378924 FT /note="HMMPfam hit to PF01926, GTPase of unknown FT function,score 1.5e-07" FT /inference="protein motif:Pfam:PF01926" FT misc_feature 378457..378921 FT /note="HMMPfam hit to PF00350, Dynamin family, score FT 6.6e-39" FT /inference="protein motif:Pfam:PF00350" FT misc_feature 378469..378492 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 380097..380801 FT /transl_table=11 FT /locus_tag="Cj0413" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0413, probable periplasmic FT protein, len: 234 aa; similar to several Hp proteins; FT HP0160, 30.3% identity; HP0211, 32.6% identity; HP1098 FT 31.1% identity; HP0336 31.3% identity; HP0235 30.9% FT identity; HP0628 26.5% identity; and HP1117 26.9% identity. FT This is the only copy in C. jejuni" FT /note="Updated (2006) note: Pfam domain PF07719 FT Tetratricopeptide repeat was identified within CDS. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /db_xref="GOA:Q0PB97" FT /db_xref="InterPro:IPR006597" FT /db_xref="InterPro:IPR011990" FT /db_xref="UniProtKB/TrEMBL:Q0PB97" FT /inference="protein motif:Pfam:PF07719" FT /protein_id="CAL34563.1" FT /translation="MRIFLTLFLFFNSLFALSELEEGLKLYEANKFDKAYEIFKSLCEK FT DISKACFSLAFMHESARGVSKDLNQAYKFYDKACKLGLANACSNMALLLQNQGYENEAL FT LAFNKACTLGESLSCNNIALFYEKEKDGQMASSFYKRSCDLKNARACYQLGSLYDKGEL FT VKASVKSALAFYSKSCTLGFGEACYLLGRYNQLEKQDLTKAKRYFGMACDQKHQEACAA FT YKELNSKDIELY" FT misc_feature 380346..380447 FT /note="HMMPfam hit to PF07719, Tetratricopeptide FT repeat,score 0.013" FT /inference="protein motif:Pfam:PF07719" FT CDS 380937..381665 FT /transl_table=11 FT /locus_tag="Cj0414" FT /product="putative oxidoreductase subunit" FT /note="Original (2000) note: Cj0414, possible FT oxidoreductase subunit, len: 242 aa; some similarity to FT TR:O34213 (EMBL:U97665) Erwinia cypripedii gluconate FT dehydrogenase subunit III precursor (220 aa), fasta scores; FT opt: 343 z-score: 502.3 E(): 1.1e-20, 32.6% identity in 193 FT aa overlap. No Hp match" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity score has been carried out yet. FT Putative kept within product function. Literature search FT identified paper giving further clues to product function. FT Functional classification - Misc" FT /note="PMID:15231804" FT /db_xref="UniProtKB/TrEMBL:Q0PB96" FT /protein_id="CAL34564.1" FT /translation="MQDNIIDRRSFFKLGLLGGSVVAASTIGGGAVLKAAELTHSHQAS FT QGKSNKIRGRMFFQTQTEFDTLSAACERIYPKDEQGEGAIGLGVPYFIDNQLASAYGYN FT DREYMQGPFMEGKAEQGYQTPMQRKDIFLEGVHALEENAQKRYKKSFSLLKGGDQDKIL FT SDFEKGKIQTTGFKSSYFFTLLRDMTVAGVLADPIYGGNDNKNGWRMMQYPGAQMSYVD FT KIASDEFFNIEPMGLADMES" FT sig_peptide 380937..381041 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000188_380937_381665 by SignalP 2.0 FT HMM (Signal peptide probability 0.996) with cleavage site FT probability 0.926 between residues 35 and 36" FT misc_feature 380967..381035 FT /note="1 probable transmembrane helix predicted for Cj0414 FT by TMHMM2.0 at aa 11-33" FT /inference="protein motif:TMHMM:2.0" FT CDS 381667..383388 FT /transl_table=11 FT /locus_tag="Cj0415" FT /product="putative GMC oxidoreductase subunit" FT /note="Original (2000) note: Cj0415, possible FT oxidoreductase subunit, len: 573 aa; similar to e.g. FT TR:O34214 (EMBL:U97665) Erwinia cypripedii gluconate FT dehydrogenase subunit precursor (615 aa), fasta scores; FT opt: 1025 z-score: 1674.4 E(): 0, 40.8% identity in 583 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF00732 GMC FT (glucose-methanol-choline) oxidoreductase was identified FT within CDS when carrying out own Pfam search. This family FT is a member of the FAD/NAD(P)-binding Rossmann fold FT Superfamily clan. These proteins bind FAD as a cofactor. FT Product modified to more specific family member due to FT motif match. Literature search identified paper giving FT further related functional clues. No specific FT characterisaion with acceptable identity score has been FT carried out yet, so putative kept within product function. FT Literature search identified paper linking protein to FT glycoprotein (PMID:12186869). Functional classification FT -Misc" FT /note="PMID:15231804, PMID:12186869" FT /db_xref="GOA:Q0PB95" FT /db_xref="InterPro:IPR000172" FT /db_xref="InterPro:IPR007867" FT /db_xref="UniProtKB/TrEMBL:Q0PB95" FT /inference="protein motif:Pfam:PF00732" FT /protein_id="CAL34565.1" FT /translation="MAEVLKKVDVVTVGAGWTGGIVAAELTKAGLNVLSLERGHMQSTE FT NFNYIHDEWRYGINYGLMQDCSKDTVTFRHDPSGLALPYRKMGSFLLGNNVGGAGVHWN FT GWTFRFMPYDFEIQTLSKQRYGNKLGNDYTLQDWGVTYKDMEPYYDRFEKTCGVSGEPN FT PLAEKMGAFRSSPYPQEPLENTKMLKRFESAAKSSNLHTYRLPASNSKGGYTNPDGQDL FT APCQYCAYCERFGCEYGAKASPLNTVIPKAMSTGKYTIRTYSNVTQILKKDGKVTGVKF FT VDTRTMKEYIQPADIVVLTSYMFNNAKLLMVSNIGEQYDPKTGKGTLGRNYCYQMNMGT FT TAFFDEQFNTFMGSGALGTTSDDFNGDNFDHSKEKFLHGAMIYSVQLGTRPIQSAPLPA FT GAPTWGAEFKKALNYNFTRAITVGGQGASLPHKNNYLSLDPTYKDAFGMPLLRLTYNFT FT DQDRALHKFITDKTAEVAKRMQGVKSIKKGAYLKDYSVVPYQSTHNTGGTTMGADRETS FT VVNTYLQHWDADNLFVVGAGNFQHNSGYNPTDTVGALAYRCAEGILKYHKSGKSLA" FT CDS 383559..383657 FT /transl_table=11 FT /locus_tag="Cj0416" FT /product="hypothetical protein Cj0416" FT /note="Original (2000) note: Cj0416, unknown, len: 32 aa; FT no Hp match, highly simlar to N-terminus of Cj0122 (88.2% FT identity in 34 aa overlap). Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PB94" FT /protein_id="CAL34566.1" FT /translation="MITLSSFNRYFGNNPLQTLTKIRDESIENAKI" FT CDS 383677..383823 FT /transl_table=11 FT /locus_tag="Cj0417" FT /product="hypothetical protein Cj0417" FT /note="Original (2000) note: Cj0417, unknown, len: 48 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PB93" FT /protein_id="CAL34567.1" FT /translation="MLNILHANSSHRFHKCMPKEVHQIYDTLKLMEQQEGTKKSRSQKR FT RAK" FT CDS complement(383947..384651) FT /transl_table=11 FT /locus_tag="Cj0418c" FT /product="hypothetical protein Cj0418c" FT /note="Original (2000) note: Cj0418c, unknown, len: 234 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="InterPro:IPR021973" FT /db_xref="UniProtKB/TrEMBL:Q0PB92" FT /protein_id="CAL34568.1" FT /translation="MQISSSYNSYDYYSSKPSFDKTNQSDSTQKDEKNLSENKDDKEKN FT GEQTQMVNGVELSQKEVAQVRELQSIDRNVKAHEAAHQAAGGGLAGAASFTYTRGPDNQ FT MYATAGEVPISMQKGNTPEETIANARQIAAAAMAPADPSPQDYKVAANATKMEFEARAE FT AMKLKAEEAKEKEEENKEKDDKNSENSLEKTDKDSKNNDKNSNFDKDFKNLVTRTYQQN FT SQNNDIKFSIAS" FT CDS 384759..385121 FT /transl_table=11 FT /locus_tag="Cj0419" FT /product="putative histidine triad (HIT) family protein" FT /note="Original (2000) note: Cj0419, unknown, len: 120 aa; FT no Hp match" FT /note="Updated (2006) note: Pfam domain PF01230 HIT FT (histidine triad) was identified within CDS by carrying out FT own Pfam search. Product modified to more specific family FT member due to motif match. No specific characterisation has FT been carried out yet. Literature search identified paper FT giving further information on HIT domains. Functional FT classification - Misc" FT /note="PMID:1472710, PMID:9164465" FT /db_xref="GOA:Q79JB6" FT /db_xref="InterPro:IPR001310" FT /db_xref="InterPro:IPR011146" FT /db_xref="InterPro:IPR011151" FT /db_xref="UniProtKB/TrEMBL:Q79JB6" FT /inference="protein motif:Pfam:PF01230" FT /protein_id="CAL34569.1" FT /translation="MIYENDLIYIEKEEAQVPWLKIFTKEIYKEFSDCPLELQKELFEK FT ILFCEKAMIEFYKPEKINIASFANYVPRVHFHVMARFKEDAFFPECMWGKQQRETIKLD FT LPKFEEFVKFLNSKIF" FT CDS 385195..385767 FT /transl_table=11 FT /locus_tag="Cj0420" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0420, probable periplasmic FT protein, len: 190 aa; similar to hypothetical proteins e.g. FT YCEI_ECOLI (191 aa), fasta scores; opt: 377 z-score: 504.2 FT E(): 8.7e-21, 37.4% identity in 195 aa overlap. 37.8% FT identity to HP1286. Contains probable N-terminal signal FT sequence" FT /note="Updated (2006) note: Pfam domain PF04264 YceI like FT family was identified within CDS. Product function was not FT altered since PF04264 is a base-induced periplasmic protein FT that has not been characterised. Literature search FT identified paper linking protein to be a glycoprotein. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /note="PMID:15231804" FT /db_xref="InterPro:IPR007372" FT /db_xref="PDB:2FGS" FT /db_xref="UniProtKB/TrEMBL:Q79JB5" FT /inference="protein motif:Pfam:PF04264" FT /protein_id="CAL34570.1" FT /translation="MKKVLLSSLVAVSLLSTGLFAKEYTLDKAHTDVGFKIKHLQISNV FT KGNFKDYSAVIDFDPASAEFKKLDVTIKIASVNTENQTRDNHLQQDDFFKAKKYPDMTF FT TMKKYEKIDNEKGKMTGTLTIAGVSKDIVLDAEIGGVAKGKDGKEKIGFSLNGKIKRSD FT FKFATSTSTITLSDDINLNIEVEANEK" FT sig_peptide 385195..385257 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000194_385195_385767 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.938 between residues 21 and 22" FT misc_feature 385255..385764 FT /note="HMMPfam hit to PF04264, YceI like family, score FT 1e-77" FT /inference="protein motif:Pfam:PF04264" FT CDS complement(385772..386728) FT /transl_table=11 FT /locus_tag="Cj0421c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0421c, probable integral FT membrane protein, len: 318 aa; no Hp match" FT /note="Updated (2006) note: Six probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="InterPro:IPR000160" FT /db_xref="UniProtKB/TrEMBL:Q0PB89" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34571.1" FT /translation="MFLLDFLISLSFIFEISALVLSFYFKNSKIFFLTLVLLGAKLPYF FT YTSFFQANLFVALFLPMIFTLFCVGKHHVLILNKKNIASITTLIFIGILSIILPRNTTF FT NSAGLEFHFIALDFFKPVSELGFLFFLVGLILIFIKTFKTKEYYLLIAFFTAYFQFLFQ FT EGAGIRYFEFASLVFCFYLLNHAYRLAFFDTLTKLPNEKSLTRFTKGKNNYIIALLHFN FT ELKDTKESYTKLILKQIAKILKRFRAKIFIVENDFILIFNDKNQALNHLAFLESTLKNT FT EFNLENENFKPDFKLIWQESEENLDKNLQSLRARLLD" FT misc_feature complement(join(386657..386725,386519..386587, FT 386432..386485,386312..386365,386240..386293, FT 386153..386212)) FT /note="6 probable transmembrane helices predicted for FT Cj0421c by TMHMM2.0 at aa 2-24, 48-70, 82-99, FT 122-139,146-163 and 173-192" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(386790..386999) FT /transl_table=11 FT /locus_tag="Cj0422c" FT /product="putative H-T-H containing protein" FT /note="Original (2000) note: Cj0422c, unknown, len: 69 aa; FT no Hp match. Contains probable helix-turn-helix motif at aa FT 5-26 (Score 1410, +3.99 SD). Functional classification - FT Broad regulatory functions" FT /db_xref="UniProtKB/TrEMBL:Q0PB88" FT /protein_id="CAL34572.1" FT /translation="MTKKSKRDMAYELDIDVSTLYNWRKYKPNLYRIVMLGFKFDELLD FT NSKKTHEELLHIEQTIQDEIAKFK" FT CDS 387168..387395 FT /transl_table=11 FT /locus_tag="Cj0423" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0423, probable integral FT membrane protein, len: 75 aa; similar to immunity proteins FT of T4 and T2 phage e.g. IMM_BPT4 immunity protein (83 FT aa),fasta scores; opt: 174 z-score: 240.8 E(): 4e-06, 40.2% FT identity in 82 aa overlap. No Hp match" FT /note="Updated (2006) note: Two probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="InterPro:IPR016410" FT /db_xref="UniProtKB/TrEMBL:Q0PB87" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34573.1" FT /translation="MEGASGGSIFVTILLFILYMLPAIIGLSRKHSNWLIISLLNLFFG FT WTIIVWLVCLIWSFTGSFKQTIIIKEKNEK" FT misc_feature order(387180..387248,387276..387344) FT /note="2 probable transmembrane helices predicted for FT Cj0423 by TMHMM2.0 at aa 5-27 and 37-59" FT /inference="protein motif:TMHMM:2.0" FT CDS 387404..388036 FT /transl_table=11 FT /locus_tag="Cj0424" FT /product="putative acidic periplasmic protein" FT /note="Original (2000) note: Cj0424, probable acidic FT periplasmic protein, len: 210 aa; no Hp match. Contains FT probable N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF07661 MORN repeat FT variant was identified within CDS. The MORN (Membrane FT Occupation and Recognition Nexus) repeat is found in FT multiple copies in several proteins. The function of this FT motif is unknown. Literature search identified paper giving FT functional link to iron stimulation. Functional FT classification - Miscellaneous periplasmic proteins" FT /note="PMID:15632442" FT /db_xref="InterPro:IPR011652" FT /db_xref="UniProtKB/TrEMBL:Q0PB86" FT /inference="protein motif:Pfam:PF07661" FT /protein_id="CAL34574.1" FT /translation="MTKFLSICSLIAMLLSGCGSDFPGQPSDVARVQQNKYPNGNLKKE FT IPYNKDSRIHGLKRAFYDNGQLRAEENYKNGKKDGISREYSRNGQLLEEVHFKDNRGYG FT DFASYYENGNMRAKGKLLGYNEDGMPEFEGNYKEYYENGTLMCDYNFDNKGKFDGVQKR FT YDENGALEDEENYKNGLKNGVFREYKKGEIVREEEYKNGILVAKPKN" FT sig_peptide 387404..387496 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000198_387404_388036 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.448 between residues 31 and 32" FT misc_feature 387425..387457 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 387488..387553 FT /note="HMMPfam hit to PF07661, MORN repeat variant, score FT 3.3" FT /inference="protein motif:Pfam:PF07661" FT misc_feature 387563..387628 FT /note="HMMPfam hit to PF07661, MORN repeat variant, score FT 0.0044" FT /inference="protein motif:Pfam:PF07661" FT misc_feature 387635..387700 FT /note="HMMPfam hit to PF07661, MORN repeat variant, score FT 0.0016" FT /inference="protein motif:Pfam:PF07661" FT misc_feature 387707..387772 FT /note="HMMPfam hit to PF07661, MORN repeat variant, score FT 43" FT /inference="protein motif:Pfam:PF07661" FT misc_feature 387797..387862 FT /note="HMMPfam hit to PF07661, MORN repeat variant, score FT 0.12" FT /inference="protein motif:Pfam:PF07661" FT misc_feature 387872..387937 FT /note="HMMPfam hit to PF07661, MORN repeat variant, score FT 0.0083" FT /inference="protein motif:Pfam:PF07661" FT misc_feature 387944..388006 FT /note="HMMPfam hit to PF07661, MORN repeat variant, score FT 4.1" FT /inference="protein motif:Pfam:PF07661" FT CDS 388049..388465 FT /transl_table=11 FT /locus_tag="Cj0425" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0425, probable periplasmic FT protein, len: 138 aa; no Hp match. Contains probable FT N-terminal signal sequence" FT /note="Updated (2006) note: Literature search identified FT paper giving functional link to iron stimulation. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /note="PMID:15632442" FT /db_xref="UniProtKB/TrEMBL:Q0PB85" FT /protein_id="CAL34575.1" FT /translation="MFKKVILFFLMGFALLQANSLDKCDNTAVVSNLKEKIPSEIFKNL FT YELSGLKAQGIDYEDYAKGLKEIAKHDGMVNYTDMIEVNSISNFDLNFDSCMATINAAL FT KGEQRKGLWSVVYKVSNINQVKITDITYINGDFQ" FT sig_peptide 388049..388102 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000199_388049_388465 by SignalP 2.0 FT HMM (Signal peptide probability 0.973) with cleavage site FT probability 0.610 between residues 18 and 19" FT CDS 388595..390172 FT /transl_table=11 FT /locus_tag="Cj0426" FT /product="putative ABC transporter ATP-binding protein" FT /note="Original (2000) note: Cj0426, probable ABC FT transporter ATP-binding protein, len: 525 aa; simlar to FT many e.g. YBIT_ECOLI hypothetical ABC transporter FT ATP-binding protein (530 aa), fasta scores; opt: 1461 FT z-score: 1750.6 E(): 0, 42.8% identity in 526 aa overlap. FT 60.5% identity to HP0853. Contains 2x PS00017 FT ATP/GTP-binding site motif A (P-loop) and Pfam match to FT entry PF00005 ABC_tran, ABC transporters, scores 115.00, FT E-value 1.4e-30, and 120.70, E-value 2.7e-32" FT /note="Updated (2006) note: Some characterisation within FT Escherichia coli with acceptable identity score. Putative FT added to product function as original designation was only FT hypothetical. Functional classification -Transport/binding FT proteins - Other" FT /db_xref="GOA:Q0PB84" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR007406" FT /db_xref="UniProtKB/TrEMBL:Q0PB84" FT /inference="protein motif:Prosite:PS00017" FT /inference="protein motif:Pfam:PF00005" FT /protein_id="CAL34576.1" FT /translation="MVEVKNLTMRFANQLLFENVNLKLVRGQRYGLIGANGAGKSTFLK FT ILSGEIESSSGEIVFDEGLKIAVLGQDQFAFENYTIKDAVMCANKRLYEALKEKEKLYM FT SEEFTDEINERLGELEIITAEEDPNYDCETRCEKILSSLKIKDFDALMSTLQSADKFKV FT LLAQVLFLGADALFLDEPTNNLDLEAISWLENELLRHEGTLVVISHDRHFLNKICTRIL FT DVDFKQIRDFAGNYDDWYMASTLLAKQAELKRDKTLKEREELENFIRRFSANASKAKQA FT TSRAKALEKLELEEIKISSRRDPSIVFRTNREIGNEVLEIKGIGKAYDKQLFSNLELKI FT EKNDKIALIGANGVGKSTLAKIIAHAISPDSGSIHLGATIELGYFPQDTSNLICENLKL FT YEWLMSEKFKDLDEIRKCLGRMLFSGSDQEKMAASLSGGEKHRLMLSRLMLERPNFLLL FT DEPDNHLDLESIIALGEALYNFKGVVLCISHDRELVSAFANRIWHLENGKLTDFRGTYQ FT EFLGENDG" FT misc_feature 388673..389275 FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 1.9e-33" FT /inference="protein motif:Pfam:PF00005" FT misc_feature 388694..388717 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 389621..390115 FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 1.1e-33" FT /inference="protein motif:Pfam:PF00005" FT misc_feature 389642..389665 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 390162..390497 FT /transl_table=11 FT /locus_tag="Cj0427" FT /product="hypothetical protein Cj0427" FT /note="Original (2000) note: Cj0427, unknown, len: 111 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PB83" FT /protein_id="CAL34577.1" FT /translation="MMAKFRIQYSAGFGHYTQNHKGFGPTIYIEEVVEFDNGKDYFDYI FT DFYKTYSKSDDTYFHISFLEDRPLSDKEITIRNEYRKMRDENCKKAKEEFIANNELDVE FT HLPTHHD" FT CDS 390572..390955 FT /transl_table=11 FT /locus_tag="Cj0428" FT /product="hypothetical protein Cj0428" FT /note="Original (2000) note: Cj0428, unknown, len: 127 aa; FT no Hp match" FT /note="Updated (2006) note: Literature search identified FT papers linking product function to be involved with FT motility. Functional classification - Unknown" FT /note="PMID:15812042, PMID:14985343" FT /db_xref="UniProtKB/TrEMBL:Q0PB82" FT /protein_id="CAL34578.1" FT /translation="MQVNYRTISSYEYDAISGQYKQVDKQIEDYSSSGDSDFMDMLNKA FT DEKSSGDALNSSSSFQSNAQNSNSNLSNYAQMSNVYAYRFRQNEGELSMRAQSASVHND FT LTQQGANEQSKNNTLLNDLLNAI" FT CDS complement(390999..391583) FT /transl_table=11 FT /locus_tag="Cj0429c" FT /product="conserved hypothetical protein Cj0429c" FT /note="Original (2000) note: Cj0429c, unknown, len: 194 aa; FT similar to hypothetical proteins e.g. YIGZ_ECOLI (205 aa), FT fasta scores; opt: 241 z-score: 370.8 E(): 2.3e-13,40.2% FT identity in 112 aa overlap. 39.1% identity to HP1485 FT (misannotated as proline dipeptidase)" FT /note="Updated (2006) note: Pfam domain PF01205 FT Uncharacterized protein family (UPF0029) was identified FT within CDS. Conserved added to product function. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="InterPro:IPR001498" FT /db_xref="InterPro:IPR020568" FT /db_xref="InterPro:IPR023582" FT /db_xref="UniProtKB/TrEMBL:Q0PB81" FT /inference="protein motif:Pfam:PF01205" FT /protein_id="CAL34579.1" FT /translation="MQTIDQIFQTQIDIKKSTFLSFLCPFKDFKFLIETLKKEHPKAVH FT FVYAYRVLNDFNQIVEDKSDDGEPKGTSGMPTLNVLRGYDLINAALITVRYFGGIKLGT FT GGLVRAYSDAANAVINNSSLLSFELKKNTTIAIDLKNLNRFEHFLKTYSFNFTKDFKDC FT KAILHIKLNEKEEQEFEIFCKNFAPFEIEKL" FT misc_feature complement(391224..391544) FT /note="HMMPfam hit to PF01205, Uncharacterized protein FT family UPF0029, score 3.1e-47" FT /inference="protein motif:Pfam:PF01205" FT CDS 391711..392937 FT /transl_table=11 FT /locus_tag="Cj0430" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0430, probable integral FT membrane protein, len: 408 aa; 33.8% identity to HP1235" FT /note="Updated (2006) note: Nine probable transmembrane FT helices predicted by TMHMM2.0. Further support given to FT product function. Literature search identified paper FT linking product function to stress response. Functional FT classification - Membranes, lipoproteins and porins" FT /note="PMID:16045618" FT /db_xref="UniProtKB/TrEMBL:Q0PB80" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34580.1" FT /translation="MEKIKNYKLIIILLSLDLLALLYGTSTLSISADEADIYFGEQGKS FT LIFSHSLLYYISHFGTFIFGQNDFGLRLPFLFFHFLSCLLLYLLALKYTKTKIDAFFSL FT LLFVLLPGTVASALLVNAASLVIFLTLAILCAYEYEKKWLFYILLIIVLFVDKSFNILF FT LTFFFFGIYKRNAILFTLSLVLFGASISFYGFDTGGRPRGYFLDTLGIFAACFSPLVFV FT YFFYTIYRLTFQKYKNLLWFLMSVTFVFCLLLSLRQKLFLDDFLPFCVICTPLLIKTLM FT QSYRVRLLVFRLRYKIFIECSIIFLIFCYFLIVANQLLYYFINNPNRHFANNYHFAKEL FT ALELKKQDVLELATAPSLQKRLRFYGIKNSNKFYLKALKQADKHDMDKKIVKVKLGKYE FT KVYQILNYD" FT sig_peptide 391711..391806 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000204_391711_392937 by SignalP 2.0 FT HMM (Signal peptide probability 0.998) with cleavage site FT probability 0.948 between residues 32 and 33" FT misc_feature order(391735..391803,391915..391983,392020..392121, FT 392149..392217,392236..392295,392323..392391, FT 392425..392478,392488..392541,392602..392670) FT /note="9 probable transmembrane helices predicted for FT Cj0430 by TMHMM2.0 at aa 9-31, 69-91, 104-137, FT 147-169,176-195, 205-227, 239-256, 260-277 and 298-320" FT /inference="protein motif:TMHMM:2.0" FT CDS 392930..393544 FT /transl_table=11 FT /locus_tag="Cj0431" FT /product="putative periplasmic ATP/GTP-binding protein" FT /note="Original (2000) note: Cj0431, possible periplasmic FT ATP/GTP-binding protein, len: 204 aa; no Hp match; contains FT possible N-terminal signal sequence and PS00017 FT ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: One probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PB79" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34581.1" FT /translation="MIKAFSLLEFVFIILILGIVFNLGSLYLKKDNLLEGAIQILNDIQ FT YTQSLAMMQEGIRVDELTIAKREWFKSKWQIYFIKSAATGYDQTYTIFLDKNGDGNANL FT GKTEINIDREIAVDVINHNKLMNSGQSGVISKDDEKTTQRFNLTKRFGIEKVEFKGSCS FT GFTRLVFDEMGRVYSPLKNANYAYEKTLAKNNSDCIIRLLS" FT misc_feature 392942..393010 FT /note="1 probable transmembrane helix predicted for Cj0431 FT by TMHMM2.0 at aa 5-27" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 393227..393250 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT rRNA 394130..395642 FT /note="16S rRNA" FT tRNA 395747..395822 FT /gene="tRNA-Ala" FT /note="tRNA Ala anticodon TGC, Cove score 92.14" FT tRNA 395831..395907 FT /gene="tRNA-Ile" FT /note="tRNA Ile anticodon GAT, Cove score 93.24" FT rRNA 396449..399360 FT /note="23S rRNA" FT rRNA 399644..399763 FT /note="5S rRNA" FT CDS complement(399936..401144) FT /transl_table=11 FT /gene="murD" FT /locus_tag="Cj0432c" FT /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase" FT /EC_number="6.3.2.9" FT /note="Original (2000) note: Cj0432c, murD, probable FT UDP-N-acetylmuramoylalanine--D-glutamate ligase, len: 402 FT aa; similar to many e.g. MURD_BACSU FT UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC FT 6.3.2.9) (451 aa), fasta scores; opt: 245 z-score: 510.4 FT E(): 3.9e-21, 29.3% identity in 382 aa overlap. 45.8% FT identity to HP0494. Contains PS01011 Folylpolyglutamate FT synthase signature 1" FT /note="Updated (2006) note: Pfam domains PF01225 Mur ligase FT family and PF02875 Mur ligase family, glutamate ligase FT domain was identified within CDS. Further support given to FT product function. Characterised within Bacillus subtilis FT and Escherichia coli with marginal identity scores. FT Putative not added to product function. Functional FT classification - Murein sacculus and peptidoglycan" FT /note="PMID:9218784" FT /db_xref="GOA:Q9PI73" FT /db_xref="InterPro:IPR004101" FT /db_xref="InterPro:IPR005762" FT /db_xref="InterPro:IPR013221" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI73" FT /inference="protein motif:Pfam:PF02875" FT /inference="protein motif:Pfam:PF01225" FT /inference="protein motif:Prosite:PS01011" FT /protein_id="CAL34582.1" FT /translation="MKISLFGYGKTTRAIAENLVDKFGPFDIYDDHFTETKKDTLGNLL FT LNPNDFDDNLSDIEIPSPGFPPKHKLIQKAKNLQSEYDFFYDIMPKSVWISGTNGKTTT FT TQMATHLLSHIGAVMGGNVGTPLAELNPYAKLWILETSSFTLHYTHKAKPEIYALLPIS FT PDHLSWHGSFDNYVQDKLSVLKRMNECDVVILPKIYANTPTKAHKISYEDEKDLAVKFG FT IDTEKISFKSPFLLDAIMALAIEKILLDTLSYKLLNSFVMEKNKLEELKDSQNRLWVND FT TKATNESAVMAALSRYKDKKIHLIIGGDDKGVDLSNLFDFMKGFDIELYAIGISTEKML FT DYAKKANLKAYKCEVLSKAVNEISNHLRVNEVALLSPACASLDQFNSYAERGKVFKECV FT NKI" FT misc_feature complement(400119..400352) FT /note="HMMPfam hit to PF02875, Mur ligase family,glutamate FT ligase doma, score 0.00084" FT /inference="protein motif:Pfam:PF02875" FT misc_feature complement(400386..401057) FT /note="HMMPfam hit to PF01225, Mur ligase family,catalytic FT domain, score 9.5e-09" FT /inference="protein motif:Pfam:PF01225" FT misc_feature complement(400797..400868) FT /note="PS01011 Folylpolyglutamate synthase signature 1" FT /inference="protein motif:Prosite:PS01011" FT CDS complement(401144..402205) FT /transl_table=11 FT /gene="mraY" FT /locus_tag="Cj0433c" FT /product="phospho-N-acetylmuramoyl-pentapeptide-transferase" FT /EC_number="2.7.8.13" FT /note="Original (2000) note: Cj0433c, mraY, probable FT phospho-N-acetylmuramoyl-pentapeptide-transferase, len: 353 FT aa; similar to many e.g. MRAY_ECOLI FT phospho-N-acetylmuramoyl-pentapeptide-transferase (EC FT 2.7.8.13) (360 aa), fasta scores; opt: 989 z-score: 1409.9 FT E(): 0, 42.5% identity in 348 aa overlap. 54.8% identity to FT HP0493. Contains Pfam match to entry PF00953 FT Glycos_transf_4, Glycosyl transferase, score 210.90,E-value FT 1.9e-59" FT /note="Updated (2006) note: Ten probable transmembrane FT helices predicted by TMHMM2.0 within CDS. Also Prosite FT motifs PS01347 MRAY_1,Phospho-N-acetylmuramoyl-pentapeptide FT transferase and PS01348 MRAY_2, FT Phospho-N-acetylmuramoyl-pentapeptide transferase were FT identified. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Putative not added to product function. FT Functional classification - Murein sacculus and FT peptidoglycan" FT /note="PMID:1846850" FT /db_xref="GOA:Q9PI72" FT /db_xref="InterPro:IPR000715" FT /db_xref="InterPro:IPR003524" FT /db_xref="InterPro:IPR018480" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI72" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00953" FT /inference="protein motif:Prosite:PS01348" FT /inference="protein motif:Prosite:PS01347" FT /protein_id="CAL34583.1" FT /translation="MYYLSDLSHYAFFTYISVRAGFAFFIALCLSLFLMPKFITWAKAK FT NASQPIYEYAPETHKTKCHTPTMGGLIFISSAVIASLFCIKFDNIFAISALLCLILFCL FT IGLIDDLGKVLKKDNHSGLSPRMKLLAQIIAGLICILPLYFSSELSTELFIPFYKHPLF FT DMEIFAIAFWILVLISSSNAVNLTDGLDGLATVPGIFSLSTLGIFLYLSGNLNYSEYLL FT LPKIQGLGEVVIICAALIGALMGFLWYNCYPAQVFMGDSGSLALGGFIGFLAVISKNEI FT LLLLIGFVFVLETVSVILQVGSFKIFNKRVFKMAPIHHHFEKVGWVENKIIVRFWMIAL FT LSNLLALASIKLR" FT misc_feature complement(join(402080..402148,401951..402019, FT 401882..401938,401765..401821,401654..401722, FT 401573..401641,401462..401530,401375..401443, FT 401294..401362,401156..401215)) FT /note="10 probable transmembrane helices predicted for FT Cj0433c by TMHMM2.0 at aa 20-42, 63-85, 90-108, FT 129-147,162-184, 189-211, 226-248, 255-277, 282-304 and FT 331-350" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(401357..401932) FT /note="HMMPfam hit to PF00953, Glycosyl transferase, score FT 2.9e-62" FT /inference="protein motif:Pfam:PF00953" FT CDS 402285..403763 FT /transl_table=11 FT /gene="pgm" FT /locus_tag="Cj0434" FT /product="2,3-bisphosphoglycerate-independent FT phosphoglycerate mutase" FT /EC_number="5.4.2.1" FT /note="Original (2000) note: Cj0434, pgm, probable FT phosphoglycerate mutase, len: 492 aa; highly similar to FT many e.g. PMGI_BACSU 2,3-bisphosphoglycerate-independent FT phosphoglycerate mutase (EC 5.4.2.1) (510 aa), fasta FT scores; opt: 638 z-score: 1364.7 E(): 0, 42.6% identity in FT 502 aa overlap. 55.9% identity to HP0974" FT /note="Updated (2006) note: Pfam domain PF06415 FT BPG-independent PGAM N-terminus and also PF01676 FT Metalloenzyme superfamily was identified within CDS. FT PF06415 motif represents the N-terminal region of the FT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase FT (or phosphoglyceromutase or BPG-independent PGAM) protein FT (EC:5.4.2.1). The family is found in conjunction with FT Metalloenzyme (located in the C-terminal region of the FT protein). PF01676 motif includes phosphopentomutase FT DEOB_ECO57 and 2,3-bisphosphoglycerate-independent FT phosphoglycerate mutase, GPMI_ECOLI. Product modified to FT more specific mutase due to motif results. Characterised FT within Bacillus subtilis with acceptable identity score. FT Putative not added to product function. Functional FT classification - Energy metabolism - Glycolysis" FT /note="PMID:10437801" FT /db_xref="GOA:Q9PI71" FT /db_xref="InterPro:IPR005995" FT /db_xref="InterPro:IPR006124" FT /db_xref="InterPro:IPR011258" FT /db_xref="InterPro:IPR017849" FT /db_xref="InterPro:IPR017850" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI71" FT /inference="protein motif:Pfam:PF01676" FT /inference="protein motif:Pfam:PF06415" FT /protein_id="CAL34584.1" FT /translation="MKQKCVLIITDGIGYNKNSKFNAFEAAKKPSYEKLFKEVPNSLLK FT TSGLAVGLPEGQMGNSEVGHMCIGSGRIIYQNLVRINKAIENKELEKNENLKKLLAKCK FT RVHIIGLYSDGGVHSMDTHFKAMLEICAKNGNEVFAHAITDGRDVSPKSGLNFIKDLKE FT FCENLGVHFATLCGRFYAMDRDKRWDRVKEYYECLLGKAYKVPNLLEYLQKSYDENVTD FT EFIKAAQNENYKGMREEDGIIFINFRNDRMKQLVEVLNSKDFKEFEREKIFENLLTMSV FT YDDKFKLPVLFEKEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGGKEELLENET FT RVLIPSPKVKTYDEKPQMSAFEVCDAVKKGIEKGEDFIVVNFANGDMVGHTGDFNATIK FT AVEAVDTCLGEILECAKKHDYAFIITSDHGNCEAMQDEKGNLLTNHTTFDVFVFVQARG FT VSKIKDNMGLSNIAASVLKILDLEIPKEMNEALF" FT misc_feature 402285..403325 FT /note="HMMPfam hit to PF06415, BPG-independent PGAM FT N-terminus (iPGM_N, score 1.4e-217" FT /inference="protein motif:Pfam:PF06415" FT misc_feature 403353..403697 FT /note="HMMPfam hit to PF01676, Metalloenzyme FT superfamily,score 4.8e-35" FT /inference="protein motif:Pfam:PF01676" FT CDS 403835..404578 FT /transl_table=11 FT /gene="fabG" FT /locus_tag="Cj0435" FT /product="3-oxoacyl-[acyl-carrier protein] reductase" FT /EC_number="1.1.1.100" FT /note="Original (2000) note: Cj0435, fabG, probable FT 3-oxoacyl-[acyl-carrier protein] reductase, len: 247 aa; FT highly similar to many e.g. FABG_ECOLI FT 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) FT (244 aa), fasta scores; opt: 669 z-score: 963.1 E(): FT 0S,45.2% identity in 248 aa overlap. 69.2% identity to FT HP0561. Contains PS00061 Short-chain FT dehydrogenases/reductases family signature, Pfam match to FT entry PF00106 adh_short, Alcohol/other dehydrogenases,short FT chain type, score 208.00, E-value 1.4e-58 and Pfam match to FT entry PF00678 adh_short_C2, Short chain FT dehydrogenase/reductase C-terminus, score 51.50, E-value FT 1.9e-11" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Fatty acid biosynthesis" FT /note="PMID:1556094" FT /db_xref="GOA:Q0PB75" FT /db_xref="InterPro:IPR002198" FT /db_xref="InterPro:IPR002347" FT /db_xref="InterPro:IPR011284" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR020904" FT /db_xref="UniProtKB/TrEMBL:Q0PB75" FT /inference="protein motif:Pfam:PF00678" FT /inference="protein motif:Pfam:PF00106" FT /inference="protein motif:Prosite:PS00061" FT /protein_id="CAL34585.1" FT /translation="MKFSGKNVLITGASKGIGASIAKTLAGFGLKVWINYRSKPELADA FT LKDEIIASGGVAAVIKFDASKEDEFENGVKTIVESDGELSYLVNNAGVTNDKLALRMKL FT EDFSGVVDTNLSSAFLGCREALKTMSKKRFGAVVNIASIVGEMGNAGQVNYSASKGGMI FT AMTKSFAKEGASRNLRFNCVTPGFIKSDMTEVLSNEIKQTYQDNIPLKRFAEPEEVANC FT VAFLLSDYASYVTGDVLKINGGLYM" FT misc_feature 403856..404569 FT /note="HMMPfam hit to PF00106, short chain FT dehydrogenase,score 3.3e-73" FT /inference="protein motif:Pfam:PF00106" FT misc_feature 404258..404344 FT /note="PS00061 Short-chain dehydrogenases/reductases family FT signature" FT /inference="protein motif:Prosite:PS00061" FT CDS 404585..404995 FT /transl_table=11 FT /locus_tag="Cj0436" FT /product="putative pyridoxamine 5'-phosphate oxidase" FT /EC_number="1.4.3.5" FT /note="Original (2000) note: Cj0436, unknown, len: 136 aa; FT no Hp match" FT /note="Updated (2006) note: Pfam domain PF01243 FT Pyridoxamine 5'-phosphate oxidase was identified within FT CDS. Product function modified to more specific family FT member based on motif match. Pyridoxamine 5'-phosphate FT oxidase (1.4.3.5) is a FMN flavoprotein involved in the de FT novo synthesis of pyridoxine (vitamin B6) and pyridoxal FT phosphate. It oxidizes pyridoxamine-5-P (PMP) and FT pyridoxine-5-P (PNP) to pyridoxal-5-P. No specific FT characterisation with acceptable identity scores has been FT carried out yet. Putative kept within product function. FT Functional classification - Biosynthesis of FT cofactors,prosthetic groups and carriers - Pyridoxine" FT /db_xref="GOA:Q0PB74" FT /db_xref="InterPro:IPR009002" FT /db_xref="InterPro:IPR011576" FT /db_xref="InterPro:IPR012349" FT /db_xref="UniProtKB/TrEMBL:Q0PB74" FT /inference="protein motif:Pfam:PF01243" FT /protein_id="CAL34586.1" FT /translation="MMDLKEIAQFLDDNAPAFLATLGTCGNPRVRPIQSPLLVGDKIYF FT CTANTKGLFKHIKNYNDIEFCSCAKDGTFLRLRANAVFEPNLEVKKMMFKKYPYLVNLY FT ETPQNPKFEVFYLDHLSARMQFMNGEFKLFKA" FT misc_feature 404594..404848 FT /note="HMMPfam hit to PF01243, Pyridoxamine 5'-phosphate FT oxidase, score 9.8e-09" FT /inference="protein motif:Pfam:PF01243" FT CDS 405333..407168 FT /transl_table=11 FT /gene="sdhA" FT /locus_tag="Cj0437" FT /product="succinate dehydrogenase flavoprotein subunit" FT /EC_number="1.3.99.1" FT /note="Original (2000) note: Cj0437, sdhA, probable FT succinate dehydrogenase flavoprotein subunit, len: 611 aa; FT similar to many e.g. DHSA_ECOLI succinate dehydrogenase FT flavoprotein subunit (EC 1.3.99.1) (588 aa), fasta scores; FT opt: 1036 z-score: 1136.5 E(): 0, 37.3% identity in 569 aa FT overlap and to e.g. FRDA_WOLSU fumarate reductase FT flavoprotein subunit (656 aa), fasta scores; opt: 862 FT z-score: 1211.2 E(): 0, 33.3% identity in 595 aa overlap. FT No Hp ortholog, but 32.3% identity to HP0192 fumarate FT reductase, flavoprotein subunit (frdA), and 33.8% identity FT to C. jejuni frdA (Cj0409). Contains Pfam match to entry FT PF00890 FAD_binding_2, FAD binding domain, score FT 386.60,E-value 2.5e-112" FT /note="Updated (2006) note: Pfam domain PF02910 Fumarate FT reductase/succinate dehydrogenase identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli with acceptable identity score. FT Recent EC number update has changed fumarate designation to FT succinate. Putative not added to product function. FT Functional classification - Energy metabolism FT -Tricarboxylic acid cycle" FT /note="PMID:1556094, PMID:2987185" FT /db_xref="GOA:Q0PB73" FT /db_xref="InterPro:IPR003953" FT /db_xref="InterPro:IPR004112" FT /db_xref="InterPro:IPR006311" FT /db_xref="InterPro:IPR014006" FT /db_xref="InterPro:IPR015939" FT /db_xref="InterPro:IPR019546" FT /db_xref="UniProtKB/TrEMBL:Q0PB73" FT /inference="protein motif:Pfam:PF02910" FT /inference="protein motif:Pfam:PF00890" FT /protein_id="CAL34587.1" FT /translation="MGEFSRRDFIKTACISVGALAASSSGVYALDDSSKMDKDINLPSC FT DVLVIGSGGAGLCAAAAVRKENPKLSVVVATKMMPSRNATCMAEGGINGVTDFSNGDSY FT KLHAYDTIKGGAYLVDQDAALKFCELAGKAIFNMDFIGTLFSRNEQGGVAQRLMGGASK FT KRCNYSADKTGHILMHSCLDDAISSGVKFLMNHELLDIGVVDGKCEGVVLRDIQSGGIY FT PVLCKALVIATGGYTRIFYNRTSTPFIATGDGVAAALRAGLGFEDPEMIQFHPTGVANG FT GTLITEAARGEGGYLLNNRGERFMKNYHEKMELAPRDVVARAIETEIREGRGYGEGLGA FT YVLCDVRHLGKEKILKDLPKIRHTAMLFENIDLVDTPVPIRPTAHYSMGGIEVAKFEDM FT GTKIAGIYVGGEASCISIHGANRLGGNSLADAVVTGHLAGIGATNYAKDASFGKGAKTH FT ELAQKWQVRFKEITNNGGNGQEMYELREELGSQNWDNMGIFRTQEKLDLLAKKLEDIQA FT RYEKIRIPNPNEVMNTAFTDYVELGNLILLSRCACLAARNRLESRGAHTREDYPKRDDK FT NFLKHSIVNLENDELKLSYKDVVVTEFSLDGRRVQ" FT sig_peptide 405333..405419 FT /note="Signal peptide predicted for sdhA by SignalP 2.0 HMM FT (Signal peptide probability 0.858) with cleavage site FT probability 0.697 between residues 29 and 30" FT misc_feature 405771..406706 FT /note="HMMPfam hit to PF00890, FAD binding domain, score FT 6.2e-115" FT /inference="protein motif:Pfam:PF00890" FT misc_feature 406785..407165 FT /note="HMMPfam hit to PF02910, Fumarate reductase/succinate FT dehydroge, score 1.6e-35" FT /inference="protein motif:Pfam:PF02910" FT CDS 407165..408130 FT /transl_table=11 FT /gene="sdhB" FT /locus_tag="Cj0438" FT /product="putative succinate dehydrogenase iron-sulfur FT protein" FT /EC_number="1.3.5.1" FT /note="Original (2000) note: Cj0438, sdhB, possibleble FT succinate dehydrogenase iron-sulfur protein, len: 321 aa; FT similar to e.g. DHSB_MYCGR succinate dehydrogenase FT (ubiquinone) iron-sulfur protein (EC 1.3.5.1) (297 FT aa),fasta scores; opt: 352 z-score: 442.4 E(): 2.4e-17, FT 29.3% identity in 215 aa overlap. No Hp ortholog, but 28.1% FT identical to HP0191 fumarate reductase, iron-sulfur subunit FT (frdB). Contains PS00197 2Fe-2S ferredoxins,iron-sulfur FT binding region signature, PS00198 4Fe-4S ferredoxins, FT iron-sulfur binding region signature, and Pfam match to FT entry PF00037 fer4, 4Fe-4S ferredoxins and related FT iron-sulfur cluster binding domains., score 13.70,E-value FT 0.01" FT /note="Updated (2006) note: Pfam domain PF00111 2Fe-2S FT iron-sulfur cluster binding domain was identified within FT CDS. Further support given to product function. No specific FT characterisation with acceptable identity score has been FT carried out yet. Putative kept within product function. FT Functional classification - Energy metabolism FT -Tricarboxylic acid cycle" FT /db_xref="GOA:Q0PB72" FT /db_xref="InterPro:IPR001041" FT /db_xref="InterPro:IPR004489" FT /db_xref="InterPro:IPR006058" FT /db_xref="InterPro:IPR009051" FT /db_xref="InterPro:IPR012285" FT /db_xref="InterPro:IPR012675" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR017900" FT /db_xref="UniProtKB/TrEMBL:Q0PB72" FT /inference="protein motif:Pfam:PF00111" FT /inference="protein motif:Pfam:PF00037" FT /inference="protein motif:Prosite:PS00198" FT /inference="protein motif:Prosite:PS00197" FT /protein_id="CAL34588.1" FT /translation="MKIIIDRFNGKEKYEQSYDIDDKDIQGKTLLSLLLFIKKTKDITL FT NFTASCQSAICGACAVRVNGHSYLACDTKMQDLLKEYDNPSSIRISPLGNFRVISDLIV FT DWEPSIENLRKIRPAMVAKNEFSAEKGCKQSQEEFDRISKQWDCILCGSCASECNKLEA FT DSSDYMQPFVFTHVWRAAADSRGKDPMLHVKPSVMNGLWLCVHCQECADRCPKGISSVS FT DIANLRVMAIKKGLNEGLGPDHAEAFYKDLVEGSGRLNEIYLALRSEGVIGSMGKTDIA FT FKLMRAGKMNPMHVFGEGEIEGYKDLVKMIKAAQEAAVKE" FT misc_feature 407231..407395 FT /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster FT binding domain, score 0.018" FT /inference="protein motif:Pfam:PF00111" FT misc_feature 407315..407341 FT /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00197" FT misc_feature 407774..407809 FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT CDS 408134..408991 FT /transl_table=11 FT /gene="sdhC" FT /locus_tag="Cj0439" FT /product="putative succinate dehydrogenase subunit C" FT /EC_number="1.3.99.1" FT /note="Original (2000) note: Cj0439, sdhC, probable FT succinate dehydrogenase subunit C, len: 285 aa; similar to FT e.g. TR:P77945 (EMBL:Y09041) Sulfolobus acidocaldarius FT succinate dehydrogenase subunit C (EC 1.3.99.1) (290 FT aa),fasta scores; opt: 612 z-score: 739.6 E(): 0, 34.2% FT identity in 275 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domains x2 PF02754 FT Cysteine-rich domain was identified within CDS. This domain FT is usually found in two copies per protein. It contains up FT to four conserved cysteines. No specific characterisation FT with acceptable identity score has been carried out yet. FT Putative kept within product function. Functional FT classification - Energy metabolism -Tricarboxylic acid FT cycle" FT /db_xref="GOA:Q0PB71" FT /db_xref="InterPro:IPR004017" FT /db_xref="UniProtKB/TrEMBL:Q0PB71" FT /inference="protein motif:Pfam:PF02754" FT /protein_id="CAL34589.1" FT /translation="MQKEYAFFPGCVLSQAAKESKISLEAIAPILGWKLNEIKGWSCCG FT ASQAQCVDPIATLVANARNIALAEEMKMPMLTTCSTCMLTLTKAKNTLDKGAKERINIF FT LAQGGMKYQGSTPITSLLWELYEDLDNLKSKVKKPLSNLKVALFYGCHSLRPEDAFGKK FT ESSTNPKSFESVVEVLGAKIVPFEKRLDCCGFHASYPAEKSVKKMSSQIVNNASENQAD FT CVVTPCPLCQMQLDIYQERFQDYTNSKARLPIIHLSQLVGLALGLSKEMVGLDYNIIDA FT SKIA" FT misc_feature 408215..408394 FT /note="HMMPfam hit to PF02754, Cysteine-rich domain, score FT 3.7e-06" FT /inference="protein motif:Pfam:PF02754" FT misc_feature 408659..408841 FT /note="HMMPfam hit to PF02754, Cysteine-rich domain, score FT 6.4e-11" FT /inference="protein motif:Pfam:PF02754" FT CDS complement(409015..409683) FT /transl_table=11 FT /locus_tag="Cj0440c" FT /product="putative transcriptional regulator" FT /note="Original (2000) note: Cj0440c, probable FT transcriptional regulator, len: 222 aa; similar to many FT putative regulators and to TENA_BACSU transcriptional FT activator TENA (236 aa), fasta scores; opt: 250 z-score: FT 275.4 E(): 4.8e-08, 28.8% identity in 215 aa overlap. 30.7% FT identity to HP1287" FT /note="Updated (2006) note: Pfam domain PF03070 TENA/THI-4 FT family was identified within CDS. Further support given to FT product function. No specific characterisation has been FT carried out yet. Putative kept within product function. FT Functional classification - Broad regulatory functions" FT /db_xref="InterPro:IPR004305" FT /db_xref="InterPro:IPR016084" FT /db_xref="UniProtKB/TrEMBL:Q0PB70" FT /inference="protein motif:Pfam:PF03070" FT /protein_id="CAL34590.1" FT /translation="MMLFSNLIKENQKIWNAYLHHDFVKKLEDKSLKQENFLFYLKQDY FT IYLLNYAKCYARLALNSNTAKELRFAMKFQNYIVEGEMELHRAILSLGINADELDIKDE FT SLVNIAYSRYMLSVGENGDFLDMLVALSACAIGYAKIGAEIINRLKNENLKDHPYKEWI FT LTYGSENFQNEAKEFEDFVNSYTSSVGAQKFQKLSEIFHTVTRLEVAFWEHSLRMELNL FT " FT misc_feature complement(409030..409677) FT /note="HMMPfam hit to PF03070, TENA/THI-4 family, score FT 1.2e-52" FT /inference="protein motif:Pfam:PF03070" FT CDS 409793..410026 FT /transl_table=11 FT /gene="acpP" FT /locus_tag="Cj0441" FT /product="acyl carrier protein" FT /note="Original (2000) note: Cj0441, acpP, probable acyl FT carrier protein, len: 77 aa; similar to many e.g. ACP_ECOLI FT acyl carrier protein (ACP) (77 aa), fasta scores; opt: 232 FT z-score: 434.1 E(): 6.9e-17, 49.3% identity in 67 aa FT overlap. 63.2% identity to HP0559 and 54.9% identity to FT C-terminal half of HP0962. Contains PS00012 FT Phosphopantetheine attachment site and Pfam match to entry FT PF00550 pp-binding, Phosphopantetheine attachment site, FT score 53.80, E-value 2.9e-13" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Fatty acid biosynthesis" FT /note="PMID:1556094" FT /db_xref="GOA:Q9PI64" FT /db_xref="InterPro:IPR003231" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR006163" FT /db_xref="InterPro:IPR009081" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI64" FT /inference="protein motif:Pfam:PF00550" FT /inference="protein motif:Prosite:PS00012" FT /protein_id="CAL34591.1" FT /translation="MATFDDVKAVVVEQLSIDADAVKMESKIIEDLGADSLDVVELIMA FT LEEKFEVEIPDSDAEKLIKIEDVVNYIDNLKK" FT misc_feature 409805..410008 FT /note="HMMPfam hit to PF00550, Phosphopantetheine FT attachment site, score 3.2e-13" FT /inference="protein motif:Pfam:PF00550" FT misc_feature 409883..409930 FT /note="PS00012 Phosphopantetheine attachment site" FT /inference="protein motif:Prosite:PS00012" FT CDS 410053..411267 FT /transl_table=11 FT /gene="fabF" FT /locus_tag="Cj0442" FT /product="3-oxoacyl-[acyl-carrier-protein] synthase" FT /EC_number="2.3.1.41" FT /note="Original (2000) note: Cj0442, fabF, probable FT 3-oxoacyl-[acyl-carrier-protein] synthase, len: 404 aa; FT highly similar to many e.g. FABF_ECOLI FT 3-oxoacyl-[acyl-carrier-protein] synthase II (EC 2.3.1.41) FT (412 aa), fasta scores; opt: 1380 z-score: 1676.1 E(): FT 0,52.0% identity in 410 aa overlap. 63.8% identity to FT HP0558. Contains Pfam match to entry PF00109 ketoacyl-synt, FT Beta-ketoacyl synthase, score 177.80,E-value 1.8e-49" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Fatty acid biosynthesis" FT /note="PMID:9013860" FT /db_xref="GOA:Q0PB68" FT /db_xref="InterPro:IPR000794" FT /db_xref="InterPro:IPR014030" FT /db_xref="InterPro:IPR014031" FT /db_xref="InterPro:IPR016038" FT /db_xref="InterPro:IPR016039" FT /db_xref="InterPro:IPR017568" FT /db_xref="UniProtKB/TrEMBL:Q0PB68" FT /inference="protein motif:Pfam:PF00109" FT /protein_id="CAL34592.1" FT /translation="MKRVVVTGIGMINALGLDKESSFKAICNGESGVNKITLFDATDFP FT VQIAAEVKNFDPLEVVDGKEVKKIDRFIQLGIKAAREAMQDAGFSEELDKEEFGIVSAS FT GIGGLPNIEKNSIICSERGPRKISPFFIPSALVNMLGGLISIEHGLKGPNISCVTACAA FT GTHAIGEAYKSIALGNAKKMLVIGAEAAICPVGIGGFASMKALSTRNEDPQHASRPFDK FT ERDGFVMGEGAGALVFEEYEEAKKRGATIYAELIGFGESADAHHITSPTLDGPLRAMKK FT ALNMAGNPKVDYINAHGTSTPVNDKNETAAIKELFGNNIPLISSTKGQTGHCLGAAGAI FT EAVVSVMVLRDGVVPPTINQLVKDDECDLDYIPNISRKVDLKVVMSNSFGFGGTNGCVV FT FKKVD" FT misc_feature 410056..410784 FT /note="HMMPfam hit to PF00109, Beta-ketoacyl FT synthase,N-terminal do, score 1.1e-67" FT /inference="protein motif:Pfam:PF00109" FT misc_feature 410806..411264 FT /note="HMMPfam hit to PF02801, Beta-ketoacyl FT synthase,C-terminal do, score 8.4e-54" FT /inference="protein motif:Pfam:PF02801" FT misc_feature 410818..410892 FT /note="PS00107 Protein kinases ATP-binding region FT signature" FT /inference="protein motif:Prosite:PS00107" FT CDS 411269..412207 FT /transl_table=11 FT /gene="accA" FT /locus_tag="Cj0443" FT /product="acetyl-coenzyme A carboxylase carboxyl FT transferase subunit alpha" FT /EC_number="6.4.1.2" FT /note="Original (2000) note: Cj0443, accA, probable FT acetyl-coenzyme A carboxylase carboxyl transferase subunit FT alpha, len: 312 aa; similar to many e.g. ACCA_ECOLI FT probable acetyl-coenzyme A carboxylase carboxyl transferase FT subunit alpha (EC 6.4.1.2) (318 aa), fasta scores; opt: 977 FT z-score: 1341.2 E(): 0, 49.2% identity in 315 aa overlap. FT 62.2% identity to HP0557" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Fatty acid biosynthesis" FT /note="PMID:16325142" FT /db_xref="GOA:Q9PI62" FT /db_xref="InterPro:IPR001095" FT /db_xref="InterPro:IPR011763" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI62" FT /protein_id="CAL34593.1" FT /translation="MASYLDFEKNIQQIDEDIINAQIKGDTEAVSILKKNLEKEISKTY FT KNLSDFQRLQLARHPDRPYALDYIELILNDAHEIHGDRAFRDDPAIVCFMGYLGEKKII FT VIGEQKGRGTKDKIARNFGMPHPEGYRKALRVAGLAEKFQIPILFLIDTPGAYPGIGAE FT ERGQSEAIARNLYELSDLKIPTIAIVIGEGGSGGALAIGVADKLAMMKNSVFSVISPEG FT CAAILWNDPAKSEAATKAMKVTADDLKSQGLIDDVIDEPTNGAHRNKEAAAVAIADYVK FT KSLNELENIDVRELSANRMQKILKLGAYQEA" FT misc_feature 411275..411691 FT /note="HMMPfam hit to PF03255, Acetyl co-enzyme A FT carboxylase carboxyltrans, score 3.3e-66" FT /inference="protein motif:Pfam:PF03255" FT CDS join(412359..412910,412907..413473,413477..414430) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0444" FT /product="pseudogene (putative TonB-denpendent outer FT membrane receptor)" FT /note="Original (2000) note: Cj0444, probable FT tonB-denpendent outer membrane receptor pseudogene, len: FT 2072 bp; similar to parts of various tonB-denpendent outer FT membrane receptors e.g. IRGA_VIBCH iron-regulated outer FT membrane virulence protein (652 aa), CIRA_ECOLI colicin I FT receptor precursor (663 aa), and FEPA_ECOLI FT ferrienterobactin receptor precursor (746 aa). No Hp FT ortholog. Contains N-terminal signal sequence, PS01156 FT TonB-dependent receptor proteins signature 2 and Pfam match FT to entry PF00593 TonB_boxC, TonB dependant receptor FT C-terminal region, score 28.00, E-value 4.3e-05. There is FT at least one frameshift and one stop codon in this CDS" FT /note="Updated (2006) note: Pfam domain PF07715 FT TonB-dependent Receptor Plug Domain identified within CDS. FT Further support given to product function. Some FT characterisation work in various bacteria. However,identity FT scores were marginal. Thus, putative was added to product FT function. Coding sequence has been updated to reflect the FT complete amino acid sequence for the encoded protein FT regardless of its expression. This will cause differences FT from the amino acid sequence of the previous annotation. FT Functional classification - Transport/binding proteins - FT Other" FT /note="PMID:15632442" FT /inference="protein motif:Pfam:PF07715" FT /inference="protein motif:Pfam:PF00593" FT /inference="protein motif:Prosite:PS01156" FT misc_feature 412473..412811 FT /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug FT Domain, score 2e-27" FT /inference="protein motif:Pfam:PF07715" FT misc_feature 413606..414430 FT /note="HMMPfam hit to PF00593, TonB dependent FT receptor,score 3.1e-33" FT /inference="protein motif:Pfam:PF00593" FT CDS 414516..415112 FT /transl_table=11 FT /locus_tag="Cj0447" FT /product="putative NUDIX hydrolase family protein" FT /note="Original (2000) note: Cj0447, unknown, len: 198 aa; FT similar to a hypothetical protein from E. coli; YFFH_ECOLI FT (191 aa), fasta scores; opt: 168 z-score: 344.6 E(): FT 6.7e-12, 31.1% identity in 122 aa overlap; and to part of a FT hypothetical protein from C. elegans TR:Q18745 FT (EMBL:Z70750) C50F4.11 (1092 aa), fasta scores; opt: 133 FT z-score: 491.0 E(): 4.7e-20, 35.3% identity in 215 aa FT overlap. 45.7% identity to HP0507" FT /note="Updated (2006) note: Pfam domain PF00293 NUDIX was FT identified within CDS. The generic name 'NUDIX hydrolases' FT (NUcleoside DIphosphate linked to some other moiety X) has FT been coined for this domain family . The family can be FT divided into a number of subgroups, of which MutT FT anti-mutagenic activity represents only one type; most of FT the rest hydrolyse diverse nucleoside diphosphate FT derivatives (including ADP-ribose, GDP- mannose, FT TDP-glucose, NADH,UDP-sugars, dNTP and NTP). Product FT modified to more specific family member due to motif match. FT Functional classification - Misc" FT /db_xref="GOA:Q0PB66" FT /db_xref="InterPro:IPR000086" FT /db_xref="InterPro:IPR004385" FT /db_xref="InterPro:IPR015797" FT /db_xref="UniProtKB/TrEMBL:Q0PB66" FT /inference="protein motif:Pfam:PF00293" FT /protein_id="CAL34595.1" FT /translation="MAFKNLKELSFEKSNYIKPKRFAYESNGRLCTWDFIESKDSVSVL FT LYHKELESFIFVRQFRIPLWYHQMHDKDYVKDDDMGYTIELCSGLVDKKLSLEEIAKEE FT CIEELGYAPKNLEKIGDFYTGFGSGVSKQSFYFVEVDEKDKISSGGGVDDEEIEAVYVK FT VQDFEKKCKNMIRTPLLDFAYMWFLKEKWGKLKII" FT misc_feature 414627..415070 FT /note="HMMPfam hit to PF00293, NUDIX domain, score 7.3e-11" FT /inference="protein motif:Pfam:PF00293" FT CDS complement(415144..416241) FT /transl_table=11 FT /locus_tag="Cj0448c" FT /product="putative MCP-type signal transduction protein" FT /note="Original (2000) note: Cj0448c, probable MCP-type FT signal transduction protein, len: 365 aa; similar to many FT proteins with MCP domains e.g. TR:Q56633 (EMBL:L25660) FT Vibrio cholerae acfB accessory colonization factor (626 FT aa), fasta scores; opt: 364 z-score: 455.7 E(): FT 4.4e-18,29.9% identity in 278 aa overlap, and PILJ_PSEAE FT PILJ protein (682 aa), fasta scores; opt: 314 z-score: FT 451.9 E(): 7.1e-18, 30.7% identity in 189 aa overlap. 31.9% FT identity to HP0599 (called hemolysin secretion protein FT precursor (hylB), but previously sequenced as TR:P94847 FT H.pylori 48 kDa antigen (433 aa), fasta scores; opt: 580 FT z-score: 833.7 E(): 0, 32.4% identity in 370 aa overlap). FT Contains Pfam match to entry PF00015 FT MCPsignal,Methyl-accepting chemotaxis protein (MCP) FT signaling domain, score 122.40, E-value 1.7e-33" FT /note="Updated (2006) note: Prosite domain PS50111 FT CHEMOTAXIS_TRANSDUC_2, Bacterial chemotaxis sensory FT transducers domain profile identified within CDS. Further FT support given to product function. No specific FT characterisation with acceptable identity score has been FT carried out yet. Putative kept within product function. FT Functional classification - Signal transduction" FT /db_xref="GOA:Q0PB65" FT /db_xref="InterPro:IPR004089" FT /db_xref="InterPro:IPR004090" FT /db_xref="UniProtKB/TrEMBL:Q0PB65" FT /inference="protein motif:Pfam:PF00015" FT /inference="protein motif:Prosite:PS50111" FT /protein_id="CAL34596.1" FT /translation="MFGSKINHSDLQKLEEENKNLTHKIEKFQSENLELKNKITSLEQA FT ALESKLKTDLLNVLLTGVLKNITIIQGDMLENVNKAEVISSYSKTSLAEMDELNHIANS FT INASLGNITESANKTRDVAGTLHRSVDEITNVINLIKDVSDQTNLLALNAAIEAARAGE FT HGRGFAVVADEVRKLAEKTQKATTEVEMNINLLKQNANEMYTQSEQVEKISIDSNAHIM FT SFSEKFTHLVNEAHSTNSNAVGIASEAFVSLAKLDHIAFKLNGYKEIFSKSGKQLADHT FT SCRLGKWLASTGKERFGQNKSFLKINEPHEKVHENMNNAITIANTEDISKDITQHSIIN FT KCEVAENASLDLFNVFKEMLDESDH" FT misc_feature complement(415426..416010) FT /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis FT protein (MCP) s, score 7.4e-12" FT /inference="protein motif:Pfam:PF00015" FT CDS complement(416251..416466) FT /transl_table=11 FT /locus_tag="Cj0449c" FT /product="conserved hypothetical protein Cj0449c" FT /note="Original (2000) note: Cj0449c, unknown, len: 71 aa; FT similar to E. coli hypothetical protein YDCH_ECOLI (55 aa), FT fasta scores; opt: 112 z-score: 209.2 E(): 0.00023,42.6% FT identity in 47 aa overlap. 45.1% identity to HP1242" FT /note="Updated (2006) note: Pfam domain PF04325 Protein of FT unknown function (DUF465) was identified within CDS. FT Conserved added to product function. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="InterPro:IPR007420" FT /db_xref="UniProtKB/TrEMBL:Q0PB64" FT /inference="protein motif:Pfam:PF04325" FT /protein_id="CAL34597.1" FT /translation="MLHEYRELMSELKGKDAHFDKLFDRHNELDDMIKDAEEGRTSLSS FT MEISTLKKEKLHVKDELSQYLANYKK" FT misc_feature complement(416263..416412) FT /note="HMMPfam hit to PF04325, Protein of unknown function FT (DUF465), score 9.2e-21" FT /inference="protein motif:Pfam:PF04325" FT CDS complement(416651..416845) FT /transl_table=11 FT /gene="rpmB" FT /locus_tag="Cj0450c" FT /product="50S ribosomal protein L28" FT /note="Original (2000) note: Cj0450c, rpmB, 50S ribosomal FT protein L28, len: RL28_ECOLI 50S ribosomal protein L28 (77 FT aa), fasta scores; opt: 191 z-score: 345.7 E(): FT 5.8e-12,49.2% identity in 61 aa overlap. 63.3% identity to FT HP0491. Contains Pfam match to entry PF00830 FT Ribosomal_L28,Ribosomal L28 family, score 87.20, E-value FT 3.4e-22" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity scores. Putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:332524" FT /db_xref="GOA:Q9PI58" FT /db_xref="InterPro:IPR001383" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI58" FT /inference="protein motif:Pfam:PF00830" FT /protein_id="CAL34598.1" FT /translation="MARVCQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTLEDGTT FT RKMRIAASTLRTLKKQNSK" FT misc_feature complement(416660..416839) FT /note="HMMPfam hit to PF00830, Ribosomal L28 family, score FT 1.3e-23" FT /inference="protein motif:Pfam:PF00830" FT CDS 416985..417632 FT /transl_table=11 FT /gene="rep" FT /locus_tag="Cj0451" FT /product="ribulose-phosphate 3-epimerase" FT /EC_number="5.1.3.1" FT /note="Original (2000) note: Cj0451, rep, probable FT ribulose-phosphate 3-epimerase, len: 215 aa; similar to FT many e.g. RPE_ECOLI ribulose-phosphate 3-epimerase (EC FT 5.1.3.1) (225 aa), fasta scores; opt: 620 z-score: 1037.9 FT E(): 0, 43.5% identity in 214 aa overlap. 54.7% identity to FT HP1386. Contains PS01085 and PS01086 Ribulose-phosphate FT 3-epimerase family signature 1 and 2, and Pfam match to FT entry PF00834 Ribul_P_3_epim, Ribulose-phosphate 3 FT epimerase family, score 347.50, E-value 1.5e-100" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Central intermediary metabolism - General" FT /note="PMID:9729441" FT /db_xref="GOA:Q0PB62" FT /db_xref="InterPro:IPR000056" FT /db_xref="InterPro:IPR011060" FT /db_xref="InterPro:IPR013785" FT /db_xref="UniProtKB/TrEMBL:Q0PB62" FT /inference="protein motif:Pfam:PF00834" FT /inference="protein motif:Prosite:PS01086" FT /inference="protein motif:Prosite:PS01085" FT /protein_id="CAL34599.1" FT /translation="MYVAPSLLSANFLKLEEEVKAIEAAGADLLHIDVMDGHFVPNLTF FT GPCVIEKISTISKLPLDVHLMVKDVSKFVDLFISLKPKFISFHMESEVHPIRLCEYIRS FT QGIHPAIVLNPHTPIDSIKHMLEFVDMVLLMSVNPGFGGQKFLPLIHEKIKELRQMIDK FT KNAKVFIEVDGGVNGLNASDLEESGADILVAGSYIFSSNDYKTAISSLKLEF" FT misc_feature 416988..417590 FT /note="HMMPfam hit to PF00834, Ribulose-phosphate 3 FT epimerase family, score 2.7e-102" FT /inference="protein motif:Pfam:PF00834" FT misc_feature 417072..417116 FT /note="PS01085 Ribulose-phosphate 3-epimerase family FT signature 1" FT /inference="protein motif:Prosite:PS01085" FT misc_feature 417378..417446 FT /note="PS01086 Ribulose-phosphate 3-epimerase family FT signature 2" FT /inference="protein motif:Prosite:PS01086" FT CDS 417629..418390 FT /transl_table=11 FT /gene="dnaQ" FT /locus_tag="Cj0452" FT /product="exonuclease, dna polymerase III epsilon subunit" FT /EC_number="2.7.7.7" FT /note="Original (2000) note: Cj0452, dnaQ, FT exonuclease,possibly dna polymerase III epsilon subunit, FT len: 253 aa; similar to part of e.g. DP3A_MYCPU DNA FT polymerase III,alpha chain (EC 2.7.7.7) (1435 aa), fasta FT scores; opt: 220 z-score: 322.2 E(): 1.2e-10, 27.7% FT identity in 267 aa overlap, and DING_BACSU probable FT ATP-dependent helicase DING homolog (931 aa), fasta scores; FT opt: 275 z-score: 312.6 E(): 4.1e-10, 35.3% identity in 170 FT aa overlap. Also some similarity to DP3E_ECOLI DNA FT polymerase III, epsilon chain (EC 2.7.7.7), wublastn FT scores; E= 3.2e-05, 25% identity in 174 aa overlap. 41.5% FT identity to HP1387. Contains Pfam match to entry PF00929 FT Exonuclease,Exonuclease, score 159.70, E-value 5.1e-44" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity score. The word FT 'possible' has been removed from product function. FT Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:6359162, PMID:15090519" FT /db_xref="GOA:Q0PB61" FT /db_xref="InterPro:IPR006054" FT /db_xref="InterPro:IPR006055" FT /db_xref="InterPro:IPR012337" FT /db_xref="InterPro:IPR013520" FT /db_xref="UniProtKB/TrEMBL:Q0PB61" FT /inference="protein motif:Pfam:PF00929" FT /protein_id="CAL34600.1" FT /translation="MSLQQIDQIISILNKQSKPYDWVMQEFAKVEELKNFDLDLETFEL FT LGLGLTLNKDNIFTLKTRTTKIKDEIFCIVDIESTGGVSKGEILEIGAVKIQNSKEIGR FT FQSFVKVKEIPKNITELTGITYEMVENASSLAKVLSDFRLFLKDSIFVAHNVRFDYSFI FT SKALNECGFGILLNRRICTIEFAQCCIESPKYKLEVLKEFLGVENMHHRALDDALAAAE FT IFKYCLGKLPYHIKTTEELINFTKTARIKQK" FT misc_feature 417842..418300 FT /note="HMMPfam hit to PF00929, Exonuclease, score 1.1e-35" FT /inference="protein motif:Pfam:PF00929" FT misc_RNA 418412..418516 FT /note="TPP riboswitch (THI element)" FT /note="Updated (2006) note: Running Rfam search revealed FT new non-coding RNA families within Campylobacter jejuni. FT Rfam RF00059, TPP riboswitch (THI element) was identified FT within CDS. Vitamin B(1) in its active form thiamin FT pyrophosphate (TPP) is an essential coenzyme that is FT synthesised by coupling of pyrimidine and thiazole moieties FT in bacteria. The previously detected thiamin-regulatory FT element, thi box (PMID:12376536) was extended, resulting in FT a new, highly conserved RNA secondary structure, the THI FT element. Analysis of operon structures identified a large FT number of new candidate thiamin-regulated genes, mostly FT transporters, in various prokaryotic organisms FT (PMID:1147090)" FT CDS 418573..419865 FT /transl_table=11 FT /gene="thiC" FT /locus_tag="Cj0453" FT /product="thiamin biosynthesis protein ThiC" FT /note="Original (2000) note: Cj0453, thiC, probable thiamin FT biosynthesis protein, len: 430 aa; simlar to many e.g. FT THIC_ECOLI thiamin biosynthesis protein THIC (631 aa), FT fasta scores; opt: 1116 z-score: 1641.2 E(): 0, 41.4% FT identity in 452 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF01964 ThiC family FT was identified within CDS. Further support given to product FT function. Characterised within Escherichia coli with FT acceptable identity score. Putative not added to product FT function. Functional classification - Biosynthesis of FT cofactors, prosthetic groups and carriers - Thiamine" FT /note="PMID:8432721" FT /db_xref="GOA:Q9PI55" FT /db_xref="InterPro:IPR002817" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI55" FT /inference="protein motif:Pfam:PF01964" FT /protein_id="CAL34601.1" FT /translation="MKTQMNYAKEGIFTKEMQIVAQKENLSKDFLLENIACGKIIIPAN FT INHKSLDPNGIGFGLRTKVNVNLGVSNDCVDYSEEMKKVELAHKFGIEAIMDLSNYGKT FT SRFRDELVNVSKAMIGTVPVYDAVGFLEKDLKQINAKDFLDVVYHHAKSGVDFMTIHAG FT INSRAAHIFKQSKRLTNIVSRGGSVLYAWMMMKDAENPFFEYYDDLLDICLKYDVTLSL FT GDALRPGSTHDASDGAQISELIELSLLTQRAWDVGIQVMIEGPGHMAINEIEANMQLEK FT RLCKGAPFYVLGPLVTDIGAGYDHISGAIGGAVAAASGADMLCYVTPAEHLRLPNLEDV FT REGIVATKIAAHAGDIAKLPKERARDDEMSKARQEIDWEKMFKLAIDGEKAKKMFNERR FT PDDLNSCSMCGKMCAMNTMNQILKGEDVSLA" FT misc_feature 418579..419838 FT /note="HMMPfam hit to PF01964, ThiC family, score 8.1e-216" FT /inference="protein motif:Pfam:PF01964" FT CDS complement(419857..420426) FT /transl_table=11 FT /locus_tag="Cj0454c" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0454c, possible membrane FT protein, len: 189 aa; no Hp match" FT /note="Updated (2006) note: One probable transmembrane FT helices predicted by TMHMM2.0 within CDS. Literature search FT identified paper linking product function to motility. FT Functional classification - Membranes,lipoproteins and FT porins" FT /note="PMID:15066034" FT /db_xref="UniProtKB/TrEMBL:Q0PB59" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34602.1" FT /translation="MGGIVLLVLANKFQELQMKDKSLEEIDLLKLIICALSFISVCTAL FT ILFLLLPTLKNYKQANLRENSQLAILKAAKSKFDFSEDKISTLRSENNKSLEQFEQNFN FT IGNFNIFLQKYFQNVKIQETKPEKQEKYLKNRLAIKATMNNPRRLYDFIDALKNYNNLI FT KLDYPLNLKAGEQGISIDLTLKVYSS" FT misc_feature complement(420274..420342) FT /note="1 probable transmembrane helix predicted for Cj0454c FT by TMHMM2.0 at aa 29-51" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(420548..420892) FT /transl_table=11 FT /locus_tag="Cj0455c" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0455c, possible membrane FT protein, len: 114 aa; no Hp match" FT /note="Updated (2006) note: One probable transmembrane FT helices predicted by TMHMM2.0 within CDS. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PB58" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34603.1" FT /translation="MTYSFIQPRKKPIFTLFDKIWLGLFGFSILFILLVYFTYTIKIAL FT INSSIDDEKQQVIVLQNQTKQNEMLYEILFDQSQIAKNFNTQNQIVKESLRNLFDIIVK FT TDNITLESVE" FT misc_feature complement(420776..420835) FT /note="1 probable transmembrane helix predicted for Cj0455c FT by TMHMM2.0 at aa 20-39" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(420889..421848) FT /transl_table=11 FT /locus_tag="Cj0456c" FT /product="hypothetical protein Cj0456c" FT /note="Original (2000) note: Cj0456c, unknown, len: 319 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PB57" FT /protein_id="CAL34604.1" FT /translation="MLFLLKKIFPQLFISIILEDKKNIVKASIYRGNKLISSNEKTFDK FT SENLLEYIKNLSKHFLFYHTALFLDAKEQGLIPSTNIQDCEHFNIGKISLQHILLNNAL FT VYTATEHVEYYSELFEEYRGLDFLYSPFALLYYNMQKEKQPDDQILLYGFKQGYLLAII FT VAKGNTILYGDFKIFEQELGLELELPSEDNQEIENNNDDTEVTLDNFNEALNNKFDLLD FT QENNLETLDNNDNFNLDELNQFSNDMELCRYIITSIEKFYNDDKYAGVFINGILLYSES FT DININAIDFLESETFLEIKTKQINTLDLMIELMRKEVK" FT CDS complement(421850..422479) FT /transl_table=11 FT /locus_tag="Cj0457c" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0457c, probable lipoprotein, FT len: 209 aa; similar to hypothetical protein fromRICKETTSIA FT PROWAZEKII TR:E1342403 (EMBL:AJ235270) RP090 (218 aa), FT fasta scores; opt: 372 z-score: 531.3 E(): 2.7e-22, 33.0% FT identity in 212 aa overlap. 35.9% identity in 153 aa FT overlap to HP0270. Contains N-terminal signal sequence and FT PS00013 Prokaryotic membrane lipoprotein lipid attachment FT site" FT /note="Updated (2006) note: Pfam domain PF04028 Domain of FT unknown function (DUF374) identified within CDS. One FT probable transmembrane helices predicted by TMHMM2.0 within FT CDS. Further support given to product function. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="InterPro:IPR007172" FT /db_xref="UniProtKB/TrEMBL:Q0PB56" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF04028" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34605.1" FT /translation="MGKSFKIHCLTYIIFILQWLIFLSCKKHYKGEKVDRKAGVILFWH FT GKLALMPFAFRHYRQKNKKAYVMISHHKDGEQIAKIIKLFGLDTVRGSTSRGASSALRA FT AFKVLEQNDDIVITPDGPRGPYHSISDGSIILAQKKELKIRILNYEANRFWKFKSWDKM FT ILPKPFSKITYSLSEPLDILSLDKEKAKEFLMKQFDKISLADQFKE" FT misc_feature complement(422096..422332) FT /note="HMMPfam hit to PF04028, Domain of unknown function FT (DUF374), score 1.7e-50" FT /inference="protein motif:Pfam:PF04028" FT misc_feature complement(join(422408..422461,422306..422365)) FT /note="2 probable transmembrane helices predicted for FT Cj0457c by TMHMM2.0 at aa 7-24 and 39-58" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(422405..422437) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(422463..423764) FT /transl_table=11 FT /gene="miaB" FT /locus_tag="Cj0458c" FT /product="putative tRNA 2-methylthioadenosine synthase" FT /note="Original (2000) note: Cj0458c, unknown, len: 433 aa; FT similar to many hypothetical proteins e.g. YLEA_ECOLI (474 FT aa), fasta scores; opt: 974 z-score: 1539.3 E(): 0 37.5% FT identity in 440 aa overlap. 59.5% identity to HP0269. Also FT similar to Cj1006c (28.6% identity in 391 aa overlap) and FT Cj1454c (26.7% identity in 371 aa overlap). Contains FT PS01278 Uncharacterized protein family UPF0004 signature FT Pfam match to entry PF00919 UPF0004,Uncharacterized protein FT family UPF0004, score 648.00,E-value 1.3e-203" FT /note="Updated (2006) note: Pfam domain PF04055 Radical SAM FT superfamily identified within CDS. Prosite domains PS50926 FT TRAM, Deoxyribonuclease/rho motif-related TRAM,PS01278 FT UPF0004, Protein of unknown function and PS00133 FT CARBOXYPEPT_ZN_2, Peptidase M14, carboxypeptidase A also FT identified. Characterised within Salmonella typhimurium FT with acceptable identity score, however, partial sequence FT alingment was achieved. Product function modified to new FT family member. Putative kept within product function. FT Functional classification - Aminoacyl tRNA synthetases and FT their modification" FT /note="PMID:10572129" FT /db_xref="GOA:Q0PB55" FT /db_xref="InterPro:IPR002792" FT /db_xref="InterPro:IPR005839" FT /db_xref="InterPro:IPR006463" FT /db_xref="InterPro:IPR006638" FT /db_xref="InterPro:IPR007197" FT /db_xref="InterPro:IPR013848" FT /db_xref="InterPro:IPR020612" FT /db_xref="InterPro:IPR023404" FT /db_xref="InterPro:IPR023970" FT /db_xref="UniProtKB/Swiss-Prot:Q0PB55" FT /inference="protein motif:Pfam:PF04055" FT /inference="protein motif:Pfam:PF00919" FT /inference="protein motif:Prosite:PS01278" FT /inference="protein motif:Prosite:PS00133" FT /inference="protein motif:Prosite:PS50926" FT /protein_id="CAL34606.1" FT /translation="MSAKKLFIQTLGCAMNVRDSEHMIAELTQKENYALTEDIKEADLI FT LINTCSVREKPVHKLFSEVGGFEKVKKEGAKIGVCGCTASHLGNEIFKRAPYVDFVLGA FT RNISKITQAIKTPKFMGVDIDYDESEFAFADFRNSIYKSYINISIGCDKHCTYCIVPHT FT RGDEISIPFNIIYKEAQKAIEKGAKEIFLLGQNVNNYGKRFRNEHKKMDFSDLLEELST FT IEGLERIRFTSPHPLHMDDKFLEVFANNPKVCKSMHMPLQSGSSEILKAMKRGYTKEWY FT LNRALKLRELCPNVSISTDIIVAFPGESEKDFEETVDVLEKVRFEQIFSFKYSKRPLTK FT AATMPNQIDEEIASRRLSTLQNRHSEILDKIVKKQENKTFKVLFEELRAGNSIAGRTDN FT NFLVQVEGSEELLGQFKEVKITNAKRMVLYGEIV" FT misc_feature complement(422466..422648) FT /note="HMMPfam hit to PF01938, TRAM domain, score 2.9e-10" FT /inference="protein motif:Pfam:PF01938" FT misc_feature complement(422805..423332) FT /note="HMMPfam hit to PF04055, Radical SAM FT superfamily,score 3.8e-32" FT /inference="protein motif:Pfam:PF04055" FT misc_feature complement(423249..423281) FT /note="PS00133 Zinc carboxypeptidases, zinc-binding region FT 2 signature" FT /inference="protein motif:Prosite:PS00133" FT misc_feature complement(423270..423332) FT /note="PS01278 Uncharacterized protein family UPF0004 FT signature" FT /inference="protein motif:Prosite:PS01278" FT misc_feature complement(423456..423752) FT /note="HMMPfam hit to PF00919, Uncharacterized protein FT family UPF0004, score 1.6e-40" FT /inference="protein motif:Pfam:PF00919" FT CDS complement(423761..424027) FT /transl_table=11 FT /locus_tag="Cj0459c" FT /product="hypothetical protein Cj0459c" FT /note="Original (2000) note: Cj0459c, unknown, len: 88 aa; FT 32.5% identical to HP0268. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PB54" FT /protein_id="CAL34607.1" FT /translation="MKILKDLAMELKLARTLINEKPKNISLEKIEEAIEKEGQKFFYFD FT KDNTHKQLIALVNHFEKKGVSIYHRTVKYGLDDNDFMYEVHIL" FT CDS 424131..425219 FT /transl_table=11 FT /gene="nusA" FT /locus_tag="Cj0460" FT /product="transcription termination factor" FT /note="Original (2000) note: Cj0460, nusA, probable FT transcription termination factor, len: 362 aa; similar to FT many e.g. NUSA_BACSU N utilization substance protein A FT homolog (371 aa), fasta scores; opt: 555 z-score: 698.3 FT E(): 1.3e-31, 30.0% identity in 367 aa overlap. 45.4% FT identity to HP1514" FT /note="Updated (2006) note: Prosite PS50126 S1, RNA binding FT S1 was identified within CDS. S1 is a binding domain found FT in NusA (N utilisation substance protein A) protein. NusA FT binds to RNA polymerase alpha subunit and promotes FT termination at certain RNA hairpin structures. FT Characterised within Bacillus subtilis with marginal FT identity score. Putative not added to product function. FT Functional classification - RNA synthesis, RNA modification FT and DNA transcription" FT /note="PMID:8491709, PMID:8535155" FT /db_xref="GOA:Q0PB53" FT /db_xref="InterPro:IPR003029" FT /db_xref="InterPro:IPR009019" FT /db_xref="InterPro:IPR010213" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR013735" FT /db_xref="InterPro:IPR015946" FT /db_xref="InterPro:IPR016027" FT /db_xref="InterPro:IPR022967" FT /db_xref="UniProtKB/TrEMBL:Q0PB53" FT /inference="protein motif:Prosite:PS50126" FT /protein_id="CAL34608.1" FT /translation="MEKIADIIESIANEKNLNLENVREKVATALINTAKRIYGQEYEFF FT VDPKNLNLYQKITIVADNDERLQNKSESFIALSKAKSEAPDVEIGDELTYECSLENLGR FT TAVNTLHKELEYHIQKLLEQTIFEKYKNKVGQMVFGTVVRVDNEENTFIEIDELRAFLP FT RKNRIKGEKFKIGDVVKAVIRRVYTDKGIKIELSRTSPKFLECLLEAEVPEIKDGYVNI FT IGCARIPGERAKIILQANGTNIDPVGATVGVKGVRINAVSKELHNENIDCIEFTNESEI FT LISRALAPAIVNSVKIEDKKAIVSLNSEQKSKAIGKNGINIRLASMLSGYEIELNELSS FT SQLNNAISNEEAMKNLQDLFKI" FT CDS complement(425235..426422) FT /transl_table=11 FT /locus_tag="Cj0461c" FT /product="putative MFS (Major Facilitator Superfamily) FT transport protein" FT /note="Original (2000) note: Cj0461c, probable integral FT membrane protein, len: 395 aa; some similarity to a FT hypothetical protein from B. subtilis TR:O31400 FT (EMBL:AJ222587) YKUC (430 aa), fasta scores; opt: 172 FT z-score: 369.7 E(): 2.7e-13, 23.8% identity in 407 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domains PF07690 Major FT Facilitator Superfamily (MFS) and PF04332 Protein of FT unknown function (DUF475) were identified within CDS. FT Twelve probable transmembrane helices predicted by FT TMHMM2.0. Product modified to more specific family member FT due to motif match. No specific characterisation has been FT carried out yet. Putative kept within product function. FT Functional classification - Membranes, lipoproteins and FT porins" FT /db_xref="GOA:Q0PB52" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR016196" FT /db_xref="UniProtKB/TrEMBL:Q0PB52" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF04332" FT /inference="protein motif:Pfam:PF07690" FT /protein_id="CAL34609.1" FT /translation="MNYIELLKNNKNIRILASVQFIVYFGAWFSQTGVFTLLVELNAPT FT WATATSAMLAFLPGVLLAPINGVIVEKNKPKKLLLSMISIELISIFCLIFVTSLSMLWL FT LFILIFIRLCVASIYFQAEMSLLAKILTPQELKLANEMHSVIWAISYTAGMASAGIFIY FT FLGVKTAFLFDCILILIGISFLVRLSIPDFHQKTQSRFFTMIKEGFFYVLNNKIIFHLI FT LLHAFIGLTAYETLVTLLAQHQYKEVLSAALVIGFLNAVRACSLAIGPMVLSKFINDKN FT LFYMYLGQGLGIILWALTQFNFYISFLGLIGAGFFTSALWAYTYTMIQKNADKEYHGRV FT IAYTDMIYLSFSAIISMLMGFLFEIGLSLELITGLLGMIFIFAAFYWKWFYKKYL" FT misc_feature complement(425238..426257) FT /note="HMMPfam hit to PF04332, Protein of unknown function FT (DUF475), score 3e-192" FT /inference="protein motif:Pfam:PF04332" FT misc_feature complement(join(426294..426362,426213..426281, FT 426126..426194,426057..426116,425928..425996, FT 425850..425918,425724..425792,425613..425681, FT 425526..425579,425448..425516,425319..425387, FT 425250..425309)) FT /note="12 probable transmembrane helices predicted for FT Cj0461c by TMHMM2.0 at aa 21-43, 48-70, 77-99, FT 103-122,143-165, 169-191, 211-233, 248-270, 282-299, FT 303-325,346-368 and 372-391" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(425331..426377) FT /note="HMMPfam hit to PF07690, Major Facilitator FT Superfamily, score 1.2e-15" FT /inference="protein motif:Pfam:PF07690" FT CDS 426496..427542 FT /transl_table=11 FT /locus_tag="Cj0462" FT /product="putative radical SAM domain protein" FT /note="Original (2000) note: Cj0462, unknown, len: 348 aa; FT similar to many hypothetical proteins e.g. TR:O66979 FT (EMBL:AE000707) Aquifex aeolicus AQ_789 (361 aa), fasta FT scores; opt: 1202 z-score: 1804.1 E(): 0, 51.4% identity in FT 348 aa overlap. 66.2% identity to HP0656. Also similar to FT Cj1368 (35.5% identity in 349 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF04055 Radical SAM FT superfamily identified within CDS. Radical SAM proteins FT catalyze diverse reactions, including unusual methylations, FT isomerization, sulphur insertion, ring formation, anaerobic FT oxidation and protein radical formation. Prosite PS50887 FT GGDEF domain identified within CDS. This domain appears to FT be ubiquitous in bacteria and is often linked to a FT regulatory domain, such as a phosphorylation receiver or FT oxygen sensing domain. Product modified to more specific FT family member due to motif match. Functional classification FT - Misc" FT /db_xref="GOA:Q0PB51" FT /db_xref="InterPro:IPR000160" FT /db_xref="InterPro:IPR005244" FT /db_xref="InterPro:IPR006638" FT /db_xref="InterPro:IPR007197" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR020050" FT /db_xref="InterPro:IPR022431" FT /db_xref="UniProtKB/TrEMBL:Q0PB51" FT /inference="protein motif:Pfam:PF04055" FT /inference="protein motif:Prosite:PS50887" FT /protein_id="CAL34610.1" FT /translation="MKRLDKKEALDLLHHASLTELGEMAYKRKLELHPEKITTFVVDRN FT INYTNVCCIDCSFCAFYRHHKEDDAYILSFEEIGKKIEELEAIGGTQILFQGGVHPKLK FT IEWYEELVSWIKEHYPNITVHGFSAVEIAYIAKASKISITEVLKRLQAKGLFSIPGAGA FT EVLSDRVRDIIAPNKCDTATWLEVHRQAHKIGMKSTATMMFGTVENDEEIIDHFEHLRK FT LQDETGGFRAFILWSFQSDNTALIQKHPEIMKQSSNKYLRLLALVRLYLDNFKNLQSSW FT VTQGSLIGQLALKFGANDLGSTMMEENVVSAAGASYRMNQDEMIRLIRSLGENPAKRNT FT AYEILERF" FT misc_feature 426631..427155 FT /note="HMMPfam hit to PF04055, Radical SAM FT superfamily,score 9.3e-25" FT /inference="protein motif:Pfam:PF04055" FT CDS 427542..428762 FT /transl_table=11 FT /locus_tag="Cj0463" FT /product="zinc protease-like protein" FT /note="Original (2000) note: Cj0463, zinc protease-like FT protein, len: 406 aa; some similarity to members of the FT peptidase M16 (insulinase) family e.g. Y4WB_RHISN FT hypothetical zinc protease-like protein Y4WB (447 aa),fasta FT scores; opt: 375 z-score: 306.4 E(): 9.1e-10, 22.7% FT identity in 396 aa overlap. 39.3% identity to HP0657" FT /note="Updated (2006) note: Pfam domain PF05193 Peptidase FT M16 inactive domain identified within CDS. No specific FT characterisation has been carried out yet. Product function FT left unchanged. Functional classification -Degradation of FT macromolecules - Proteins, peptides and glycopeptides" FT /db_xref="GOA:Q0PB50" FT /db_xref="InterPro:IPR007863" FT /db_xref="InterPro:IPR011237" FT /db_xref="InterPro:IPR011249" FT /db_xref="UniProtKB/TrEMBL:Q0PB50" FT /inference="protein motif:Pfam:PF05193" FT /protein_id="CAL34611.1" FT /translation="MQYLESRGIKIPFIFEKNSDFPIVVLKLVFRNCARSYDEIAGLAK FT MFSRILNEGVDDKFFKDLEFRAINLEASSGFESLEINLSCLKENFDFALKSLEKLLLKP FT RIEEKTLQKLKINALGELASKNSDFDYLAKNLLNAQIFKCKEFQSPNDGDEKSIETLSL FT KDLQNFYKNFIHLSDLVVILGGDLEEKQAKEDLLKLLSKLQIGKKNTPKKYELGKNIKD FT EILVRPESEQAYIYFATPFFADFKDKDLYLAKIALFVLGQGGFGSRIMEEIRVKRGLAY FT SAYAMLDMNMSFSRVFGYLQTKNESAKEAKKIVKELFEDFIKNGMTQNELDQAKNFLIG FT STPLRYESLSKRLSMSFNEFYQGLNLGYYKEELKLMEKVKLETINAYIKKHQELLNISF FT ASIQNEN" FT misc_feature 428019..428555 FT /note="HMMPfam hit to PF05193, Peptidase M16 inactive FT domain, score 1.5e-34" FT /inference="protein motif:Pfam:PF05193" FT CDS 428752..430575 FT /transl_table=11 FT /gene="recG" FT /locus_tag="Cj0464" FT /product="ATP-dependent DNA helicase" FT /EC_number="3.6.1.-" FT /note="Original (2000) note: Cj0464, recG, probable FT ATP-dependent DNA helicase, len: 607 aa; similarto many FT e.g. RECG_ECOLI ATP-dependent DNA helicase RECG (EC FT 3.6.1.-) (693 aa), fasta scores; opt: 491 z-score: 773.3 FT E(): 0,34.6% identity in 431 aa overlap. 42.9% identity to FT HP1523. Contains PS00017 ATP/GTP-binding site motif A FT (P-loop) and Pfam match to entry PF00271 FT helicase_C,Helicases conserved C-terminal domain, score FT 53.20,E-value 5.5e-12" FT /note="Updated (2006) note: Pfam domain PF04851 Type III FT restriction enzyme, res subunit and PF00270 DEAD/DEAH box FT helicase identified within CDS. Prosite PS50136 FT HELICASE,DEAD/DEAH box helicase identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli with marginal identity score. FT Putative not added to product function. Functional FT classification -DNA replication, restriction/modification, FT recombination and repair" FT /note="PMID:7774596" FT /db_xref="GOA:Q0PB49" FT /db_xref="InterPro:IPR001650" FT /db_xref="InterPro:IPR011545" FT /db_xref="InterPro:IPR014001" FT /db_xref="UniProtKB/TrEMBL:Q0PB49" FT /inference="protein motif:Pfam:PF00270" FT /inference="protein motif:Pfam:PF04851" FT /inference="protein motif:Pfam:PF00271" FT /inference="protein motif:Prosite:PS00017" FT /inference="protein motif:Prosite:PS50136" FT /protein_id="CAL34612.1" FT /translation="MKIKESDFEFFKKLKIRSAIDLALLLPKKIENLNPSKNPKENEIC FT TQKITIKSVSSRKNQLFGLGFCEEWQENISFVFFHPRAWHFGICKVGKELIFNAKLSHF FT NHTWQFNNPKILTSFEGFSPKYQILGLKDTKIAAFIHKYLNYENLKESGIEDKYIHFLL FT NLHAYDEKSFFMFENLQNFSKDLKYIEIYNFLKRLKAKKTHFKAHQINVFNIANWLKDL FT PFSLTKDQLNALKDIEKDLHSKEAKRRVIMGDVGCGKTLVLLGAALMVYPKQAILMAPT FT SILAYQLYEEAKKFLPDFMNILFIKGGKKEKDLEQNIQKANLVIGTHALIHLESHNAVL FT VMIDEQHRFGSAQREKIHSLNKQEFAPHFIQFSATPIPRTLSMIQSELLNFSFIKQMPF FT KKDITTYCIQNEGFSKLSEKIKEEIAKNHQIIIIYPLLSASDKIPYLSLEQAKEYWQSH FT YEKVFVTHGKDKQKDEILERFRDEGNILLSTTVVEVGISLPRLSMIVIVGAERLGLATL FT HQLRGRVGRVGLKSACYLYTKLKEIPSRLKEFASTLDGFKIAELDLKNRLSGDLLDGFM FT QHGNEFKFFDFSKDEEILEKVKKDLAKKLPN" FT misc_feature 429421..429888 FT /note="HMMPfam hit to PF04851, Type III restriction enzyme, FT res subunit, score 4.1e-06" FT /inference="protein motif:Pfam:PF04851" FT misc_feature 429427..429903 FT /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,score FT 6.9e-25" FT /inference="protein motif:Pfam:PF00270" FT misc_feature 429508..429531 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 430117..430335 FT /note="HMMPfam hit to PF00271, Helicase conserved FT C-terminal domain, score 2.2e-13" FT /inference="protein motif:Pfam:PF00271" FT CDS complement(430572..430955) FT /transl_table=11 FT /gene="ctb" FT /locus_tag="Cj0465c" FT /product="group III truncated haemoglobin" FT /note="Original (2000) note: Cj0465c, unknown, len: 127 aa; FT identical to C. jejuni hypothetical protein TR:O52917 FT (EMBL:CJAJ2417) clone 1g9 ORF1 (fragment) (74 aa). No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF01152 FT Bacterial-like globin identified within CDS. This family of FT heme binding proteins are found mainly in bacteria. FT Characterised within Campylobacter jejuni. Ctb protein is FT shown to be involved in moderating oxygen flux within FT Campylobacter jejuni. NssR (Nitrosative stress sensing FT Regulator - Cj0466) controls the expression of a FT nitrosative stress-responsive regulon in Campylobacter FT jejuni which includes ctb (Cj0465c) and cgb (Cj1586). FT Putative not added to product function. Functional FT classification - Energy metabolism - Electron transport" FT /note="PMID:16681372, PMID:16339953, FT PMID:16045618,PMID:15292134" FT /db_xref="GOA:Q0PB48" FT /db_xref="InterPro:IPR001486" FT /db_xref="InterPro:IPR009050" FT /db_xref="InterPro:IPR012292" FT /db_xref="PDB:2IG3" FT /db_xref="UniProtKB/Swiss-Prot:Q0PB48" FT /inference="protein motif:Pfam:PF01152" FT /protein_id="CAL34613.1" FT /translation="MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAIGTSDEEWKE FT HKAKIGNFWAGMLLGEGDYNGQPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEEMKN FT VILQRAQMIASHFQNMLYKYGGH" FT CDS 431050..431646 FT /transl_table=11 FT /gene="nssR" FT /locus_tag="Cj0466" FT /product="transcriptional regulator" FT /note="Original (2000) note: Cj0466, probable FT transcriptional regulator, len: 198 aa; similar to members FT of the crp/fnr family e.g. CRP_SALTY catabolite gene FT activator (210 aa), fasta scores; opt: 191 z-score: 236.7 FT E(): 6.9e-06, 24.1% identity in 195 aa overlap, and FT FNR_BACSU anaerobic regulatory protein (238 aa), fasta FT scores; opt: 182 z-score: 215.5 E(): 0.0001, 23.0% identity FT in 209 aa overlap. No Hp match. Contains helix-turn-helix FT motif at aa 150-171 (Score 1452, +4.13 SD)" FT /note="Updated (2006) note: Pfam domain PF00027 Cyclic FT nucleotide-binding domain identified within CDS. Prosite FT PS50042 CNMP_BINDING_3, Cyclic nucleotide-binding FT identified within CDS. Characterised within Campylobacter FT jejuni. NssR (Nitrosative stress sensing Regulator) FT controls the expression of a nitrosative stress-responsive FT regulon in Campylobacter jejuni which includes ctb FT (Cj0465c) and cgb (Cj1586). Putative not added to product FT function. Functional classification - Broad regulatory FT functions" FT /note="PMID:16045618, PMID:15292134, FT PMID:16339953,PMID:16681372" FT /db_xref="GOA:Q0PB47" FT /db_xref="InterPro:IPR000595" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR014710" FT /db_xref="InterPro:IPR018490" FT /db_xref="UniProtKB/TrEMBL:Q0PB47" FT /inference="protein motif:Pfam:PF00027" FT /inference="protein motif:Prosite:PS50042" FT /protein_id="CAL34614.1" FT /translation="MKDYLELLSSVGKLKKFQKNSILFYEGEEAKNFFILLKGKIRIYK FT STASDKEITLHYFNPPNFIAEMPAFKKLNYPANAVFEEDGEILEIDFINFQNLCSENKE FT FNFLLISSLFDKIKILEKKLSQNALDLRTRLLKYLLENEKNLDTISQKQIAIDLNVRAQ FT SLSRVLKELKISELIDTKKGRIEILNKDMIMKELW" FT misc_feature 431080..431361 FT /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding FT domain, score 2.2e-15" FT /inference="protein motif:Pfam:PF00027" FT CDS 431662..432363 FT /transl_table=11 FT /locus_tag="Cj0467" FT /product="amino-acid ABC transporter integral membrane FT protein" FT /note="Original (2000) note: Cj0467, probable amino-acid FT ABC transporter integral membrane protein, len: 233 aa; FT similar to many e.g. GLNP_ECOLI glutamine transport system FT permease protein (219 aa), fasta scores; opt: 237 z-score: FT 468.8 E(): 8.1e-19, 32.6% identity in 233 aa overlap. 45.3% FT identity to HP1169. Contains PS00402 FT Binding-protein-dependent transport systems inner membrane FT comp sign. and Pfam match to entry PF00528 FT BPD_transp,Binding-protein-dependent transport systems FT inner membrane component, score 50.10, E-value 4.9e-11" FT /note="Updated (2006) note: Literature search identified FT paper within Campylobacter jejuni linking Cj0467, Cj0468 FT and Cj0469 as putative cysteine transporters. Three FT probable transmembrane helices predicted by TMHMM2.0. FT Putative not added to product function. Functional FT classification - Transport/binding proteins - Amino acids FT and amines" FT /note="PMID:15948956" FT /db_xref="GOA:Q0PB46" FT /db_xref="InterPro:IPR000515" FT /db_xref="InterPro:IPR010065" FT /db_xref="UniProtKB/TrEMBL:Q0PB46" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00528" FT /inference="protein motif:Prosite:PS00402" FT /protein_id="CAL34615.1" FT /translation="MDFDFILAQAPAFLTAAWLTIKLSFFGIIFSLIIGLFCILMSYFK FT IKILENICKLYIEFSRNTPLLIQLFFLYYALPKFNIHLEQIPPLDLICLSVEETLRPSF FT ACAIVGLSFLGGSYMAESLRAGFEAIRKQQFEAGLSLGFSKFGNLRYVILPQALAISMP FT SISANIIFLIKETSVVSIIALPDLVNLMKSLNSLTYKTDELLFLLFMGYLCIILPLSFI FT LLKFEKRLLHA" FT misc_feature order(431704..431772,432112..432180,432271..432339) FT /note="3 probable transmembrane helices predicted for FT Cj0467 by TMHMM2.0 at aa 15-37, 151-173 and 204-226" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 431710..432357 FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 1.8e-15" FT /inference="protein motif:Pfam:PF00528" FT misc_feature 432040..432126 FT /note="PS00402 Binding-protein-dependent transport systems FT inner membrane comp. sign" FT /inference="protein motif:Prosite:PS00402" FT CDS 432356..433012 FT /transl_table=11 FT /locus_tag="Cj0468" FT /product="amino-acid ABC transporter integral membrane FT protein" FT /note="Original (2000) note: Cj0468, probable amino-acid FT ABC transporter integral membrane protein, len: 218 aa; FT similar to many e.g. GLTJ_ECOLI glutamate/aspartate FT transport system permease (246 aa), fasta scores; opt: 194 FT z-score: 425.1 E(): 2.2e-16, 25.7% identity in 222 aa FT overlap. 49.3% identity to HP1170. Contains PS00402 FT Binding-protein-dependent transport systems inner membrane FT comp sign. and Pfam match to entry PF00528 FT BPD_transp,Binding-protein-dependent transport systems FT inner membrane component, score 52.80, E-value 7.6e-12" FT /note="Updated (2006) note: Literature search identified FT paper within Campylobacter jejuni linking Cj0467, Cj0468 FT and Cj0469 as putative cysteine transporters. Five probable FT transmembrane helices predicted by TMHMM2.0. Putative not FT added to product function. Functional classification - FT Transport/binding proteins - Amino acids and amines" FT /note="PMID:15948956" FT /db_xref="GOA:Q0PB45" FT /db_xref="InterPro:IPR000515" FT /db_xref="InterPro:IPR010065" FT /db_xref="UniProtKB/TrEMBL:Q0PB45" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00528" FT /inference="protein motif:Prosite:PS00402" FT /protein_id="CAL34616.1" FT /translation="MLELLNTDTLLRLWQGLFVTLEISFISIIITSIGGLFLGILMSFK FT NTYIYAFCRLGLEFVRVMPLLVWLFVVYFGFPRWFGWDLSSVSAAIIVFSIWGCFEMMD FT LVRVSLQSIPKHQYESASSLGLNTVQSFAYVIIPQAMRRLTPMSMNLLTRMIKSTTFAY FT LIGAVELVKVGQQIIEFHNRNDFAPFIIYGLIFFIFFILCYPITLYSRKLEKKWS" FT misc_feature 432404..433003 FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 8.5e-13" FT /inference="protein motif:Pfam:PF00528" FT misc_feature order(432413..432481,432518..432586,432614..432682, FT 432806..432868,432911..432979) FT /note="5 probable transmembrane helices predicted for FT Cj0468 by TMHMM2.0 at aa 20-42, 55-77, 87-109, 151-171 and FT 186-208" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 432683..432769 FT /note="PS00402 Binding-protein-dependent transport systems FT inner membrane comp. sign" FT /inference="protein motif:Prosite:PS00402" FT CDS 433014..433775 FT /transl_table=11 FT /locus_tag="Cj0469" FT /product="amino-acid ABC transporter ATP-binding protein" FT /note="Original (2000) note: Cj0469, probable amino-acid FT ABC transporter ATP-binding protein, len: 2t53 aa; highly FT similar to many e.g. GLNQ_BACST glutamine transport FT ATP-binding protein (242 aa), fasta scores; opt: 902 FT z-score: 1279.6 E(): 0, 55.4% identity in 242 aa overlap. FT 61.4% identity to HP1171. Contains PS00017 ATP/GTP-binding FT site motif A (P-loop), PS00211 ABC transporters family FT signature, and Pfam match to entry PF00005 ABC_tran, ABC FT transporters, score 227.80, E-value 1.6e-64" FT /note="Updated (2006) note: Literature search identified FT paper within Campylobacter jejuni linking Cj0467, Cj0468 FT and Cj0469 as putative cysteine transporters. Putative not FT added to product function. Functional classification FT -Transport/binding proteins - Amino acids and amines" FT /note="PMID:15948956" FT /db_xref="GOA:Q0PB44" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/TrEMBL:Q0PB44" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34617.1" FT /translation="MSILKIENLQKYYGSHHALKDINLEVKAKEVVVILGPSGCGKSTL FT LRCINGLEEIASGNIYIDNEKIDKDFKEWPRMRQKVGMVFQSYELFEHLSVEENILLGP FT MKVQKRKKDEVLKEAKIWLEKVGLLHKIHAYPRELSGGQKQRIAIVRSLCMNPELMLFD FT EVTAALDPEIVREVLEVMLNLAKEGMTMLIVTHEMGFAKAVADKIIFMDEGKIIEENDP FT KSFFKNPKSERAKKFLNLFDYHNIDKNNIGL" FT misc_feature 433098..433655 FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 1.7e-65" FT /inference="protein motif:Pfam:PF00005" FT misc_feature 433119..433142 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 433428..433472 FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT tRNA 433867..433942 FT /gene="tRNA-Thr" FT /note="tRNA Thr anticodon TGT, Cove score 96.83" FT tRNA 433992..434077 FT /gene="tRNA-Tyr" FT /note="tRNA Tyr anticodon GTA, Cove score 64.32" FT tRNA 434084..434160 FT /gene="tRNA-Gly" FT /note="tRNA Gly anticodon TCC, Cove score 96.94" FT tRNA 434265..434339 FT /gene="tRNA-Thr" FT /note="tRNA Thr anticodon GGT, Cove score 83.71" FT CDS 434408..435607 FT /transl_table=11 FT /gene="tuf" FT /locus_tag="Cj0470" FT /product="elongation factor TU" FT /note="Original (2000) note: Cj0470, tuf, probable FT elongation factor TU, len: 399 aa; identical to TR:O69303 FT (EMBL:CJY17167) EF-TU protein (399 aa), and highly similar FT to many e.g. EFTU_ECOLI elongation factor TU (EF-TU) (P-43) FT (393 aa), fasta scores; opt: 1992 z-score: 2427.3 E(): 0, FT 73.3% identity in 397 aa overlap. 84.2% identity to HP1205. FT Contains 2x PS00017 ATP/GTP-binding site motif A (P-loop), FT PS00301 GTP-binding elongation factors signature, and Pfam FT match to entry PF00009 GTP_EFTU,Elongation factor Tu family FT (contains ATP/GTP binding P-loop), score 545.30, E-value FT 4.2e-160" FT /note="Updated (2006) note: Pfam domain PF03143 Elongation FT factor Tu C-terminal domain and PF03144 Elongation factor FT Tu domain identified within CDS. Further support given to FT product function. Characterised within Escherichia coli FT with acceptable identity score. Putative not added to FT product function. Functional classification - Protein FT translation and modification" FT /note="PMID:7011903, PMID:9918724" FT /db_xref="GOA:O69303" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR004160" FT /db_xref="InterPro:IPR004161" FT /db_xref="InterPro:IPR004541" FT /db_xref="InterPro:IPR005225" FT /db_xref="InterPro:IPR009000" FT /db_xref="InterPro:IPR009001" FT /db_xref="UniProtKB/Swiss-Prot:O69303" FT /inference="protein motif:Pfam:PF03144" FT /inference="protein motif:Pfam:PF03143" FT /inference="protein motif:Pfam:PF00009" FT /inference="protein motif:Prosite:PS00301" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34618.1" FT /translation="MAKEKFSRNKPHVNIGTIGHVDHGKTTLTAAISAVLSRRGLAELK FT DYDNIDNAPEEKERGITIATSHIEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAIL FT VVSAADGPMPQTREHILLSRQVGVPYIVVFMNKADMVDDAELLELVEMEIRELLSSYDF FT PGDDTPIISGSALKALEEAKAGQDGEWSAKIMDLMAAVDSYIPTPTRDTEKDFLMPIED FT VFSISGRGTVVTGRIEKGVVKVGDTIEIVGIKDTQTTTVTGVEMFRKEMDQGEAGDNVG FT VLLRGTKKEEVIRGMVLAKPKSITPHTDFEAEVYILNKDEGGRHTPFFNNYRPQFYVRT FT TDVTGSIKLADGVEMVMPGENVRITVSLIAPVALEEGTRFAIREGGKTVGSGVVSKIIK FT " FT misc_feature 434435..435034 FT /note="HMMPfam hit to PF00009, Elongation factor Tu GTP FT binding domain, score 3.9e-98" FT /inference="protein motif:Pfam:PF00009" FT misc_feature 434462..434485 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 434558..434605 FT /note="PS00301 GTP-binding elongation factors signature" FT /inference="protein motif:Prosite:PS00301" FT misc_feature 435095..435304 FT /note="HMMPfam hit to PF03144, Elongation factor Tu domain, FT score 3.6e-25" FT /inference="protein motif:Pfam:PF03144" FT misc_feature 435317..435601 FT /note="HMMPfam hit to PF03143, Elongation factor Tu FT C-terminal domain, score 1.4e-59" FT /inference="protein motif:Pfam:PF03143" FT misc_feature 435548..435571 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 435660..435818 FT /transl_table=11 FT /gene="rpmG" FT /locus_tag="Cj0471" FT /product="50S ribosomal protein L33" FT /note="Original (2000) note: Cj0471, rpmG, probable 50S FT ribosomal protein L33, len: 52 aa; highly similar to many FT e.g. RL33_BACST 50S ribosomal protein L33 (49 aa), fasta FT scores; opt: 209 z-score: 388.8 E(): 2.3e-14, 59.2% FT identity in 49 aa overlap. 73.1% identity to HP1204. FT Contains PS00582 Ribosomal protein L33 signature and Pfam FT match to entry PF00471 L33, Ribosomal protein L33, score FT 79.10, E-value 9.3e-20" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:786732, PMID:16272117" FT /db_xref="GOA:Q9PI38" FT /db_xref="InterPro:IPR001705" FT /db_xref="InterPro:IPR011332" FT /db_xref="InterPro:IPR018264" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI38" FT /inference="protein motif:Pfam:PF00471" FT /inference="protein motif:Prosite:PS00582" FT /protein_id="CAL34619.1" FT /translation="MRIKVGLKCEECGDINYSTYKNSKNTTEKLELKKYCPRLKKHTLH FT KEVKLKS" FT misc_feature 435663..435806 FT /note="HMMPfam hit to PF00471, Ribosomal protein L33,score FT 3.3e-21" FT /inference="protein motif:Pfam:PF00471" FT misc_feature 435708..435767 FT /note="PS00582 Ribosomal protein L33 signature" FT /inference="protein motif:Prosite:PS00582" FT tRNA 435831..435906 FT /gene="tRNA-Trp" FT /note="tRNA Trp anticodon CCA, Cove score 74.26" FT CDS 435925..436104 FT /transl_table=11 FT /gene="secE" FT /locus_tag="Cj0472" FT /product="preprotein translocase SecE subunit" FT /note="Original (2000) note: Cj0472, secE, probable FT preprotein translocase SecE subunit, len: 59 aa; similar to FT many e.g. SECE_THEMA preprotein translocase SecE subunit FT (65 aa), fasta scores; opt: 133 z-score: 288.0 E(): FT 9.5e-09, 34.5% identity in 58 aa overlap. and SECE_BACSU FT preprotein translocase SecE subunit (59 aa),fasta scores; FT opt: 96 z-score: 191.3 E(): 0.0023, 29.8% identity in 57 aa FT overlap. CDS present in Hp, but not predicted; 53% identity FT to positions c(1280048..1280227). Contains Pfam match to FT entry PF00584 SecE,SecE/Sec61-gamma subunits of protein FT translocation complex, score 39.50, E-value 7.7e-08" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis (and many others), with marginal identity scores. FT Putative not added to product function. Functional FT classification - Protein and peptide secretion" FT /note="PMID:7968510" FT /db_xref="GOA:Q0PB41" FT /db_xref="InterPro:IPR001901" FT /db_xref="InterPro:IPR005807" FT /db_xref="UniProtKB/TrEMBL:Q0PB41" FT /inference="protein motif:Pfam:PF00584" FT /protein_id="CAL34620.1" FT /translation="MEKLITYFKLSKAELRKVIFPLKEQVRNAYITVFVVVAVISLFLA FT LVDWLMSSIVSAIV" FT misc_feature 435931..436101 FT /note="HMMPfam hit to PF00584, SecE/Sec61-gamma subunits of FT protein translo, score 4.9e-09" FT /inference="protein motif:Pfam:PF00584" FT misc_feature 436009..436077 FT /note="1 probable transmembrane helix predicted for Cj0472 FT by TMHMM2.0 at aa 29-51" FT /inference="protein motif:TMHMM:2.0" FT CDS 436114..436647 FT /transl_table=11 FT /gene="nusG" FT /locus_tag="Cj0473" FT /product="transcription antitermination protein" FT /note="Original (2000) note: Cj0473, nusG, probable FT transcription antitermination protein, len: 177 aa; similar FT to many e.g. NUSG_ECOLI transcription antitermination FT protein NUSG (181 aa), fasta scores; opt: 516 z-score: FT 868.1 E(): 0, 41.0% identity in 173 aa overlap. 69.9% FT identity to HP1203. Contains PS01014 Transcription FT termination factor nusG signature" FT /note="Updated (2006) note: Pfam domains PF02357 FT Transcription termination factor nusG and PF00467 KOW motif FT were identified within CDS. In addition, Prosite PS01331 FT THYMIDYLATE_KINASE, Thymidylate kinase was identified. FT Characterised within Escherichia coli with acceptable FT identity score. Putative not added to product function. FT Functional classification - RNA synthesis, RNA modification FT and DNA transcription" FT /note="PMID:7968510, PMID:8181706" FT /db_xref="GOA:Q9PI36" FT /db_xref="InterPro:IPR001062" FT /db_xref="InterPro:IPR005824" FT /db_xref="InterPro:IPR006645" FT /db_xref="InterPro:IPR008991" FT /db_xref="InterPro:IPR014722" FT /db_xref="InterPro:IPR015869" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI36" FT /inference="protein motif:Pfam:PF00467" FT /inference="protein motif:Pfam:PF02357" FT /inference="protein motif:Prosite:PS01014" FT /inference="protein motif:Prosite:PS01331" FT /protein_id="CAL34621.1" FT /translation="MSTHKWYAIQTYAGSEMAVKRAIENLVKDNGIEEQLKEIVVPTED FT VIEFKNGKEKISERSLYSGYVFALLDLNTELWHRIQSLPKVGRFIGESKKPTPLTEKDI FT NLILEKVHNRAAPKPKISFEEGENVRITEGPFANFTAIVEEYDMVRGLLKLNVSIFGRS FT TPVEILYSQVEKII" FT misc_feature 436120..436251 FT /note="HMMPfam hit to PF02357, Transcription termination FT factor nusG, score 2e-14" FT /inference="protein motif:Pfam:PF02357" FT misc_feature 436480..436593 FT /note="HMMPfam hit to PF00467, KOW motif, score 2.4e-07" FT /inference="protein motif:Pfam:PF00467" FT misc_feature 436588..436617 FT /note="PS01014 Transcription termination factor nusG FT signature" FT /inference="protein motif:Prosite:PS01014" FT CDS 436673..437098 FT /transl_table=11 FT /gene="rplK" FT /locus_tag="Cj0474" FT /product="50S ribosomal protein L11" FT /note="Original (2000) note: Cj0474, rplK, 50S ribosomal FT protein L11, len: 141 aa; highly similar to many e.g. FT RL11_ECOLI 50S ribosomal protein L11 (141 aa), fasta FT scores; opt: 560 z-score: 949.6 E(): 0, 61.7% identity in FT 141 aa overlap. 77.3% identity to HP1202. Contains PS00359 FT Ribosomal protein L11 signature and Pfam match to entry FT PF00298 L11, Ribosomal protein L11, score 244.90, E-value FT 1.1e-69" FT /note="Updated (2006) note: Pfam domain PF03946 Ribosomal FT protein L11 identified within CDS. Further support given to FT product function. Characterised within Escherichia coli FT with acceptable identity score. Putative not added to FT product function. Functional classification - Ribosomal FT protein synthesis and modification" FT /note="PMID:7004866" FT /db_xref="GOA:Q9PI35" FT /db_xref="InterPro:IPR000911" FT /db_xref="InterPro:IPR006519" FT /db_xref="InterPro:IPR020783" FT /db_xref="InterPro:IPR020784" FT /db_xref="InterPro:IPR020785" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI35" FT /inference="protein motif:Pfam:PF03946" FT /inference="protein motif:Pfam:PF00298" FT /inference="protein motif:Prosite:PS00359" FT /protein_id="CAL34622.1" FT /translation="MAKKVVGEIKLQIAATKANPSPPVGPALGQQGVNIMEFCKAFNER FT TKDMAGFNIPVVITVYADKSFTFITKQPPATDLIKKAAGISKGTDNPLKNKVGKLTRAQ FT VLEIVDKKIADLNTKDRDQAAKIIAGSARSMGVEIVD" FT misc_feature 436694..436870 FT /note="HMMPfam hit to PF03946, Ribosomal protein FT L11,N-terminal dom, score 1.4e-33" FT /inference="protein motif:Pfam:PF03946" FT misc_feature 436883..437089 FT /note="HMMPfam hit to PF00298, Ribosomal protein L11, RNA FT binding do, score 9.7e-27" FT /inference="protein motif:Pfam:PF00298" FT misc_feature 437048..437095 FT /note="PS00359 Ribosomal protein L11 signature" FT /inference="protein motif:Prosite:PS00359" FT CDS 437153..437854 FT /transl_table=11 FT /gene="rplA" FT /locus_tag="Cj0475" FT /product="50S ribosomal protein L1" FT /note="Original (2000) note: Cj0475, rplA, 50S ribosomal FT protein L1, len: 233 aa; RL1_ECOLI 50S ribosomal protein L1 FT (233 aa), fasta scores; opt: 773 z-score: 1245.3 E(): 0, FT 50.4% identity in 224 aa overlap. 68.4% identity to HP1201. FT Contains PS01199 Ribosomal protein L1 signature and Pfam FT match to entry PF00687 L1, L1P family of ribosomal FT proteins, score 403.80, E-value 1.6e-117" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:365581, PMID:16272117" FT /db_xref="GOA:Q9PI34" FT /db_xref="InterPro:IPR002143" FT /db_xref="InterPro:IPR005878" FT /db_xref="InterPro:IPR016094" FT /db_xref="InterPro:IPR016095" FT /db_xref="InterPro:IPR023673" FT /db_xref="InterPro:IPR023674" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI34" FT /inference="protein motif:Pfam:PF00687" FT /inference="protein motif:Prosite:PS01199" FT /protein_id="CAL34623.1" FT /translation="MAKIAKRLKELSQKIDSNKEYALSDAIDTIKTLKSAKFDETVEIA FT LKLNVDPRHADQMVRGSVVLPAGTGKKVRVAVIAKDAKADEAKNAGADIVGSDDLVEEI FT QKGNMNFDVLIATPNLMGLVGKVGRILGPKGLMPNPKTGTVTMDVAQAVNNAKSGQVNF FT RVDKQGNIHAGLGKVSFSKEQLWDNVSTFVKAINKHKPAAAKGRYIKNAALSLTMSPSV FT KLETQELLDMK" FT misc_feature 437195..437815 FT /note="HMMPfam hit to PF00687, Ribosomal protein L1p/L10e FT family, score 3.8e-119" FT /inference="protein motif:Pfam:PF00687" FT misc_feature 437513..437569 FT /note="PS01199 Ribosomal protein L1 signature" FT /inference="protein motif:Prosite:PS01199" FT stem_loop 437883..437931 FT CDS 438006..438485 FT /transl_table=11 FT /gene="rplJ" FT /locus_tag="Cj0476" FT /product="50S ribosomal protein L10" FT /note="Original (2000) note: Cj0476, rplJ, probable 50S FT ribosomal protein L10, len: 159 aa; similar to many, e.g. FT RL10_BACSU 50S ribosomal protein L10 (165 aa), fasta FT scores; opt: 312 z-score: 558.7 E(): 8e-24, 35.8% identity FT in 159 aa overlap. 46.2% identity to HP1200. Contains FT PS00017 ATP/GTP-binding site motif A (P-loop), and Pfam FT match to entry PF00466 L10, Ribosomal protein L10, score FT 74.80, E-value 1.7e-18" FT /note="Updated (2006) note: Prosite domain PS01109 FT RIBOSOMAL_L10, Eubacterial ribosomal protein L10 identified FT within CDS. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Putative not added to product function. FT Functional classification - Ribosomal protein synthesis and FT modification" FT /note="PMID:782920" FT /db_xref="GOA:Q9PI33" FT /db_xref="InterPro:IPR001790" FT /db_xref="InterPro:IPR002363" FT /db_xref="InterPro:IPR022973" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI33" FT /inference="protein motif:Pfam:PF00466" FT /inference="protein motif:Prosite:PS00017" FT /inference="protein motif:Prosite:PS01109" FT /protein_id="CAL34624.1" FT /translation="MTRSEKVEIIAKLEEGFKASEAIVVCNYRGLSTKKLEELRNNARE FT NNVKVQIVKNTLANIALNNSGKTGLVLKDTNIYLWGEDQLSVSKVAAKFEENNDKFEIK FT TAHIEGEVADVAKVKALAKMPSRNELLAMLLQVWNAPITNFTIGLNALKNKKESE" FT misc_feature 438006..438293 FT /note="HMMPfam hit to PF00466, Ribosomal protein L10,score FT 9.6e-20" FT /inference="protein motif:Pfam:PF00466" FT misc_feature 438186..438209 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 438506..438883 FT /transl_table=11 FT /gene="rplL" FT /locus_tag="Cj0477" FT /product="50S ribosomal protein L7/L12" FT /note="Original (2000) note: Cj0477, rplL, probable 50S FT ribosomal protein L7/L12, len: 125 aa; similar to many e.g. FT RL7_ECOLI 50S ribosomal protein L7/L12 (L8) (120 aa),fasta FT scores; opt: 428 z-score: 623.7 E(): 1.9e-27, 58.1% FT identity in 124 aa overlap. 73.6% identity to HP1199. FT Contains Pfam match to entry PF00542 L12, Ribosomal protein FT L7/L12 C-terminal domain, score 135.90, E-value 7.1e-37" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:773698, PMID:9515737" FT /db_xref="GOA:Q9PI32" FT /db_xref="InterPro:IPR000206" FT /db_xref="InterPro:IPR008932" FT /db_xref="InterPro:IPR013823" FT /db_xref="InterPro:IPR014719" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI32" FT /inference="protein motif:Pfam:PF00542" FT /protein_id="CAL34625.1" FT /translation="MAISKEDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAV FT AGGAVAAAEEKTEFDIVLTDGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVA FT KAEAEEAKKQLEEAGAKVELK" FT misc_feature 438677..438880 FT /note="HMMPfam hit to PF00542, Ribosomal protein L7/L12 FT C-terminal dom, score 2.3e-38" FT /inference="protein motif:Pfam:PF00542" FT CDS 438992..443128 FT /transl_table=11 FT /gene="rpoB" FT /locus_tag="Cj0478" FT /product="DNA-directed RNA polymerase beta chain" FT /EC_number="2.7.7.6" FT /note="Original (2000) note: Cj0478, rpoB, DNA-directed RNA FT polymerase beta chain. len: 1378 aa; almost identical,in FT part, to RPOB_CAMJE (fragment) (694 aa); 99.6% identity in FT 684 aa overlap, and highly similar to many e.g. RPOB_ECOLI FT DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (1342 FT aa), fasta scores; opt: 2230 z-score: 4457.9 E(): 0, 48.1% FT identity in 1371 aa overlap. 68.5% identity to N-terminus FT of HP1198. Contains PS01166 RNA polymerases beta chain FT signature and Pfam match to entry PF00562 RNA_pol_B, RNA FT polymerase beta subunit, score 903.00, E-value 8.6e-268" FT /note="Updated (2006) note: Four additional Pfam domains FT have now been identified all encoding the same motif; RNA FT polymerase Rpb2, domain. Further support given to product FT function. Characterisation within Campylobacter jejuni. FT Putative not added to product function. Functional FT classification - RNA synthesis, RNA modification and DNA FT transcription" FT /note="PMID:7489896" FT /db_xref="GOA:Q46124" FT /db_xref="InterPro:IPR007120" FT /db_xref="InterPro:IPR007121" FT /db_xref="InterPro:IPR007641" FT /db_xref="InterPro:IPR007642" FT /db_xref="InterPro:IPR007644" FT /db_xref="InterPro:IPR007645" FT /db_xref="InterPro:IPR010243" FT /db_xref="InterPro:IPR014724" FT /db_xref="InterPro:IPR015712" FT /db_xref="InterPro:IPR019462" FT /db_xref="UniProtKB/Swiss-Prot:Q46124" FT /inference="protein motif:Pfam:PF00562" FT /inference="protein motif:Prosite:PS01166" FT /protein_id="CAL34626.1" FT /translation="MCDMLDNKLGNRLRVDFSNISKQIEIPNLLQLQKKSFDYFLNLDN FT GESGIEKVFKSIFPIHDPQNRLSLEYVSSEIGKPKYTIRECMERGLTYSVNLKMKIRLT FT LHEKDEKTGEKVGVKDIKEQEIYIREIPLMTDRVSFIINGVERVVVNQLHRSPGVIFKE FT EESSTVANKLVYTAQIIPDRGSWLYFEYDAKDVLYVRINKRRKVPVTMLFRALGYKKQD FT IIKLFYPIQTIHVKKDKFLTEFNPNDFMDRIEYDIKDEKGKIVHQAGKRLTKKKAEQLI FT KDGLKWIEYPVEILLNRYLANPIIDKESGEVLFDSLTLLDESKLAKIKEQKSFDIANDL FT ANGVDAAIINSFAQDGETLKLLKQSENIDDENDLAAIRIYKVMRPGEPVVKDAAKAFVN FT DLFFNPERYDLTKVGRMKMNHKLGLEVPEYVTVLTNEDIIKTAKYLIKVKNGKGHIDDR FT DHLGNRRIRSIGELLANELHLGLAKMQKAIRDKFTSLNADLDKVMPYDLINPKMITTTI FT IEFFTGGQLSQFMDQTNPLSEVTHKRRLSALGEGGLVKERAGFEVRDVHATHYGRICPV FT ETPEGQNIGLINTLSTYAKVNELGFVEAPYRKVVNGKVTNEVVYLTATQEEGLFIAPAS FT TKVDAKGNIVEEFVEARQDGETILARREEVQLIDLCSGMVVGVAASLIPFLEHDDANRA FT LMGSNMQRQAVPLLTASAPIVGTGMEQIIARDAWEAVKAKRGGVVEKVDNKSIFILGED FT DKGPFIDHYTMEKNLRTNQNTNYIQHPIVKKGDIVKAGQIIADGPSMDQGELAIGKNAL FT IAFMPWNGYNYEDAIVVSERIIREDTFTSVHIYEKEIEARELKDGIEEITKDIPNVKEE FT DVAHLDESGIAKIGTHIKPGMILVGKVSPKGEVKPTPEERLLRAIFGEKAGHVVNKSLY FT ATASLEGVVVDVKIFTKKGYEKDDRAIKSYDKEKMALEKEHHDRLLMMDREEMLRVCAL FT LSKASLNSDQKIGDKNYKKGQTADISELEKINRFTLTTLIKAYSKEIQKEYDDLKNHFQ FT NEKKKLKAEHDEKLEILEKDDILPSGVIKLVKVYIATKRKLKVGDKMAGRHGNKGIVST FT IVPEVDMPYLPNGKSVDIALNPLGVPSRMNIGQILESHLGLVGLRLGDQIQEIFDRKQK FT DFLKELRAKILEICSIPRLANEKEFIKSLSDEELLNYARDWSKGVKFSTPVFEGVNIEE FT FSKLFKMAKIDMDGKTELYDGRTGEKIAERVHVGCMYMLKLHHLVDEKVHARSTGPYSL FT VTQQPVGGKALFGGQRFGEMEVWALEAYGAAHTLREMLTIKSDDVEGRFSAYKALTKGE FT NVPATGIPETFFVLTNELKSLALDVEIFDKDEDNE" FT misc_feature 439073..440563 FT /note="HMMPfam hit to PF04563, RNA polymerase beta subunit, FT score 3e-05" FT /inference="protein motif:Pfam:PF04563" FT misc_feature 439454..440392 FT /note="HMMPfam hit to PF04561, RNA polymerase Rpb2,domain, FT score 1.8e-11" FT /inference="protein motif:Pfam:PF04561" FT misc_feature 440564..440782 FT /note="HMMPfam hit to PF04565, RNA polymerase Rpb2,domain, FT score 3.9e-44" FT /inference="protein motif:Pfam:PF04565" FT misc_feature 441179..442876 FT /note="HMMPfam hit to PF00562, RNA polymerase Rpb2,domain, FT score 1.4e-148" FT /inference="protein motif:Pfam:PF00562" FT misc_feature 442265..442303 FT /note="PS01166 RNA polymerases beta chain signature" FT /inference="protein motif:Prosite:PS01166" FT misc_feature 442880..443110 FT /note="HMMPfam hit to PF04560, RNA polymerase Rpb2,domain, FT score 3.7e-46" FT /inference="protein motif:Pfam:PF04560" FT CDS 443121..447674 FT /transl_table=11 FT /gene="rpoC" FT /locus_tag="Cj0479" FT /product="DNA-directed RNA polymerase beta' chain" FT /EC_number="2.7.7.6" FT /note="Original (2000) note: Cj0479, rpoC, DNA-directed RNA FT polymerase beta' chain, len: 1517 aa; highly similar to FT many e.g. RPOC_ECOLI DNA-directed RNA polymerase beta' FT chain (EC 2.7.7.6) (1407 aa), fasta scores; opt: 1505 FT z-score: 5793.8 E(): 0, 46.1% identity in 1541 aa overlap. FT 69.7% identity to C-terminus of HP1198. Contains Pfam match FT to entry PF00623 RNA_pol_A, RNA polymerase alpha subunit, FT score 779.40, E-value 1.4e-230" FT /note="Updated (2006) note: A total of five Pfam domains FT have now been identified all encoding the same motif; RNA FT polymerase Rpb1 domain. Further support given to product FT function. Characterised within Escherichia coli with FT acceptable identity score. Putative not added to product FT function. Functional classification - RNA synthesis, RNA FT modification and DNA transcription" FT /note="PMID:6287430, PMID:6278450" FT /db_xref="GOA:Q9PI30" FT /db_xref="InterPro:IPR000722" FT /db_xref="InterPro:IPR006592" FT /db_xref="InterPro:IPR007066" FT /db_xref="InterPro:IPR007080" FT /db_xref="InterPro:IPR007081" FT /db_xref="InterPro:IPR007083" FT /db_xref="InterPro:IPR012754" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI30" FT /inference="protein motif:Pfam:PF00623" FT /protein_id="CAL34627.1" FT /translation="MSKFKVIEIKEDARPRDFEAFQLRLASPEKIKSWSYGEVKKPETI FT NYRTLKPERDGLFCAKIFGPIRDYECLCGKYKKMRFKGVKCEKCGVEVANSKVRRSRMG FT HIELVTPVAHIWYVNSLPSRIGTLLGVKMKDLERVLYYEAYIVENPGDAFYDNESTKKV FT EYCDVLNEEQYQNLMQRYENSGFKARMGGEVVRDLLANLDLVALLNQLKEEMGATNSEA FT KKKTIIKRLKVVENFLNSNLNANTDSDEAVPNRPEWMMITNLPVLPPDLRPLVALDGGK FT FAVSDVNDLYRRVINRNTRLKKLMELDAPEIIIRNEKRMLQEAVDALFDNGRRANAVKG FT ANKRPLKSLSEIIKGKQGRFRQNLLGKRVDFSGRSVIVVGPKLRMDQCGLPKKMALELF FT KPHLLAKLEEKGYATTVKQAKKMIENKTNEVWECLEEVVKGHPVMLNRAPTLHKLSIQA FT FHPVLVEGKAIQLHPLVCAAFNADFDGDQMAVHVPLSQEAIAECKVLMLSSMNILLPAS FT GKSVTVPSQDMVLGIYYLSLEKAGAKGSHKICTGIDEVMMALESKCLDIHASIQTMVDG FT RKITTTAGRLIVKSILPDFVPENSWNKVLKKKDIAALVDYVYKQGGLEITASFLDRLKN FT LGFEYATKAGISISIADIIVPNDKQKAIDEAKKQVREIQNSYNLGLITSGERYNKIIDI FT WKSTNNVLSKEMMKLVEKDKEGFNSIYMMADSGARGSAAQISQLAAMRGLMTKPDGSII FT ETPIISNFREGLNVLEYFISTHGARKGLADTALKTANAGYLTRKLIDVAQNVKITIEDC FT GTHEGVEINEITADSSIIETLEERILGRVLAEDVIDPITNSVLFAEGTLMDEEKAKILG FT ESGIKSVNIRTPITCKAKKGICAKCYGINLGEGKLVKPGEAVGIISAQSIGEPGTQLTL FT RTFHSGGTASTDLQDRQVSAQKEGFIRFYNLKTYKNKEGKNIVANRRNAAVLLVEPKIK FT TPFKGVINIENIHEDVIVSIKDKKQEVKYILRKYDLAKPNELAGVSGSIDGKLYLPYQS FT GMQVEENESIVEVIKEGWNVPNRIPFASEILVEDGEPVVQNIKAGEKGTLKFYILKGDG FT LDRVKNVKKGDIVKEKGFFVVIADENDREAKRHYIPRESKIEFNDSEKIDDANTIIASA FT PKKERKVIAEWDAYNNTIIAEIDGVVSFEDIEAGYSADEQIDEATGKRSLVINEYLPSG FT VRPTLVIAGKGDKAVRYHLEPKTVIFVHDGDKIAQADILAKTPKAAAKSKDITGGLPRV FT SELFEARKPKNAAVIAEIDGVVRFDKPLRSKERIIIQAEDGTSAEYLIDKSKHIQVRDG FT EFIHAGEKLTDGVVSSHDVLKILGEKALHYYLISEIQQVYRGQGVVISDKHIEVIVSQM FT LRQVKVVDSGHTKFIEGDLVSRRKFREENERIIRMGGEPAIAEPVLLGVTRAAIGSDSV FT ISAASFQETTKVLTEASIAGKFDYLEDLKENVILGRMIPVGTGLYGEQNLKLKEQE" FT misc_feature 443163..444212 FT /note="HMMPfam hit to PF04997, RNA polymerase Rpb1,domain, FT score 3.7e-127" FT /inference="protein motif:Pfam:PF04997" FT misc_feature 444216..444644 FT /note="HMMPfam hit to PF00623, RNA polymerase Rpb1,domain, FT score 6.6e-84" FT /inference="protein motif:Pfam:PF00623" FT misc_feature 444651..445079 FT /note="HMMPfam hit to PF04983, RNA polymerase Rpb1,domain, FT score 3.5e-44" FT /inference="protein motif:Pfam:PF04983" FT misc_feature 445152..445406 FT /note="HMMPfam hit to PF05000, RNA polymerase Rpb1,domain, FT score 3.6e-33" FT /inference="protein motif:Pfam:PF05000" FT misc_feature 445410..447512 FT /note="HMMPfam hit to PF04998, RNA polymerase Rpb1,domain, FT score 6.7e-68" FT /inference="protein motif:Pfam:PF04998" FT CDS complement(447705..448466) FT /transl_table=11 FT /locus_tag="Cj0480c" FT /product="putative transcriptional regulator" FT /note="Original (2000) note: Cj0480c, probable FT transcriptional regulator, len: 253 aa; similar to many FT e.g. KDGR_ECOLI transcriptional regulator KDGR (263 FT aa),fasta scores; opt: 305 z-score: 319.1 E(): 1.8e-10, FT 24.1% identity in 212 aa overlap. No Hp match. Contains FT helix-turn-helix motif at aa 21-42 (Score 1424, +4.04 SD)" FT /note="Updated (2006) note: Pfam domain PF01614 Bacterial FT transcriptional regulator identified within CDS. This FT family of bacterial transcriptional regulators includes the FT glycerol operon regulatory protein and acetate operon FT repressor both of which are members of the iclR family. FT These proteins have a Helix-Turn-Helix motif at the FT N-terminus. Further support given to product function. No FT specific characterisation with acceptable identity score FT has been carried out yet. Putative kept within product FT function. Functional classification - Broad regulatory FT functions" FT /db_xref="GOA:Q0PB33" FT /db_xref="InterPro:IPR005471" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR014757" FT /db_xref="UniProtKB/TrEMBL:Q0PB33" FT /inference="protein motif:Pfam:PF01614" FT /protein_id="CAL34628.1" FT /translation="MHQPTLRVLNILELLAKEKLTLSAIAKKLNIPAGTLWPILQTLQE FT KKYIKCDLKNKSYYLDFKIIELGCNIKNENNIFEIIKKHMKNIRNLTNQTCQMGILKDG FT NVLYLEKIDANNTVQLKSFIGTSYPAYATSLGKALLSNKNKKELEKLYPKNFDKITENT FT LNNINELYQQIKQIKKEKIAIEIGEMNPQIECMAIGIEHKNKIIAAISISYLIYCSNKA FT FREKNKKILLEEKNKIEKVLKIYFNDLDTLY" FT misc_feature complement(447744..448295) FT /note="HMMPfam hit to PF01614, Bacterial transcriptional FT regulator, score 8.6e-16" FT /inference="protein motif:Pfam:PF01614" FT CDS 448697..449605 FT /transl_table=11 FT /gene="dapA" FT /locus_tag="Cj0481" FT /product="putative dihydrodipicolinate synthase" FT /EC_number="4.2.1.52" FT /note="Original (2000) note: Cj0481, probable lyase, len: FT 302 aa; similar to members of the DHDPS family; e.g. FT DAPA_BACSU dihydrodipicolinate synthase (290 aa), fasta FT scores; opt: 444 z-score: 557.2 E(): 9.6e-24, 27.6% FT identity in 275 aa overlap, and NPL_HAEIN probable FT N-acetylneuraminate lyase subunit (293 aa), fasta scores; FT opt: 358 z-score: 428.6 E(): 1.4e-16, 28.5% identity in 291 FT aa overlap. No Hp match. Also similar to C. jejuni dapA, FT Cj0806; 26.1% identity in 295 aa overlap. ContainsPfam FT match to entry PF00701 DHDPS,Dihydrodipicolinate FT synthetase, score 70.30, E-value 4e-17" FT /note="Updated (2006) note: Based on similarity search FT results, product modified to more specific family member. FT Characterised within Bacillus subtilis and Eschereichia FT coli, however identity scores were marginal. Putative kept FT within product function. Functional classification - Misc" FT /note="PMID:8098035, PMID:P9047371" FT /db_xref="GOA:Q0PB32" FT /db_xref="InterPro:IPR002220" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR020625" FT /db_xref="UniProtKB/TrEMBL:Q0PB32" FT /inference="protein motif:Pfam:PF00701" FT /protein_id="CAL34629.1" FT /translation="MGILKGTLPALLTPYKDDGSINEKEFIRYCEFGISKGLNGLFCNG FT SAGDSQALSVEEQVKLMKLTKKATKNNIPIITGITSTIYENTFILAQKAYELGLDALLL FT AMPYYYKLSEDALFEYVKYLASEVKLPLYVYNIPLFAPALSLKFIEKVSKLDNVVGIKD FT SSGDALLLNHILDVVPSNFDVFVGREEFYVGALLAGVKGSMTSIGGVFPELMSEIYKSI FT NEKNIGRALLIQKSLLKAIRFGMSIAFPMGFALLLKARGFEFVNASIHPLSPATKEELN FT TRFDEAKELIKTIEKETGIKL" FT misc_feature 448703..449569 FT /note="HMMPfam hit to PF00701, Dihydrodipicolinate FT synthetase family, score 3.8e-30" FT /inference="protein motif:Pfam:PF00701" FT CDS 449602..449865 FT /transl_table=11 FT /gene="uxaA'" FT /locus_tag="Cj0482" FT /product="putative altronate hydrolase N-terminus" FT /EC_number="4.2.1.7" FT /note="Original (2000) note: Cj0482, uxaA' possible FT altronate hydrolase N-terminus, len: 87 aa; similar to FT N-terminus of e.g. UXAA_ECOLI altronate hydrolase (495 aa), FT fasta scores; opt: 199 z-score: 322.2 E(): 1.2e-10. 46.2% FT identity in 78 aa overlap. Simlarity continues in FT downstream ORF Cj0485. No Hp match. Note that B. subtilis FT paralog of uxaA, YCBI_BACSU, also has a separate N-terminus FT (YCBH_BACSU)" FT /note="Updated (2006) note: Pfam domain PF04292 FT D-galactarate dehydratase / Altronate hydrolase identified FT within CDS. Further support given to product function. FT Characterisation work carried out within Escherichia coli FT with acceptable identity score. C-terminus seems to be FT downstream Cj0483. Gene names for Cj0482 and Cj0483 are FT identical with a ' denoting two separate terminals for the FT same CDS. May well be a pseudogene. Putative kept within FT product function. Functional classification - Central FT intermediary metabolism - General" FT /note="PMID:3038546, PMID:10762278" FT /db_xref="GOA:Q0PB31" FT /db_xref="InterPro:IPR013974" FT /db_xref="UniProtKB/TrEMBL:Q0PB31" FT /inference="protein motif:Pfam:PF04292" FT /protein_id="CAL34630.1" FT /translation="MKGYIIVNEKDNVATALRDFKKGEKVANIELLNDIASGHKFALKD FT IKKDEIIIKYAEAIASASCDISTGEWVHIHNTAGIRGRGDKE" FT misc_feature 449608..449847 FT /note="HMMPfam hit to PF04292, D-galactarate dehydratase / FT Altronate hydrol, score 1.1e-47" FT /inference="protein motif:Pfam:PF04292" FT CDS 449862..451034 FT /transl_table=11 FT /gene="uxaA'" FT /locus_tag="Cj0483" FT /product="putative altronate hydrolase C-terminus" FT /EC_number="4.2.1.7" FT /note="Original (2000) note: Cj0483, uxaA' possible FT altronate hydrolase C-terminus, len: 390 aa; similar to FT C-terminus of e.g. UXAA_ECOLI altronate hydrolase (495 aa), FT fasta scores; opt: 832 z-score: 1121.7 E(): 0, 36.1% FT identity in 391 aa overlap. Simlarity continues from FT upstream ORF Cj0482. No Hp match. Note that B. subtilis FT paralog of uxaA, YCBI_BACSU, also has a separate N-terminus FT (YCBH_BACSU)" FT /note="Updated (2006) note: Pfam domain PF04295 FT D-galactarate dehydratase / Altronate hydrolase identified FT within CDS. Further support given to product function. FT Characterisation work carried out within Escherichia coli FT with acceptable identity score. N-terminus seems to be FT downstream Cj0483. Gene names for Cj0482 and Cj0483 are FT identical with a ' denoting two separate terminals for the FT same CDS. May well be a pseudogene. Putative kept within FT product function. Functional classification - Central FT intermediary metabolism - General" FT /note="PMID:3038546, PMID:10762278" FT /db_xref="GOA:Q0PB30" FT /db_xref="InterPro:IPR007392" FT /db_xref="UniProtKB/TrEMBL:Q0PB30" FT /inference="protein motif:Pfam:PF04295" FT /protein_id="CAL34631.1" FT /translation="MKMKKIMGYRREDGKFGLRNKVIIIPSVHCANKVCENIARKCNGA FT VYINHQHGCSQLEFDALQTRDVLIGHGSNANVFGVLIIGLGCEVIQAKAVAEKIKEAMP FT YKKVEYLVIQECGGSKNTIENGIKIVNEMLESAAKLQKSEGDFSDLILGTECGGSDSYS FT GLSANPTLGSLSDFVIDEGGAVILAETTELIGCEAILAKRAKNDEIAKKVYDKILAYEN FT LVKSFHADIRGANPSPGNMAGGLSTIEEKSLGCVYKAGTRTLMDVIDYAKPVVSKGLTF FT MNTPGNDIEQLSAMVAGGANICVFTTGRGTPTGSAIVPTIKMSSNTFCYENMNDAIDIN FT AGSIIDGVKTKEEVRDELIELIVRISDGELVKAELNEQNDFSAWRLATTC" FT misc_feature 449862..451031 FT /note="HMMPfam hit to PF04295, D-galactarate dehydratase / FT Altronate hydrol, score 3.8e-251" FT /inference="protein motif:Pfam:PF04295" FT misc_feature 450090..450122 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 451046..452278 FT /transl_table=11 FT /locus_tag="Cj0484" FT /product="putative MFS (Major Facilitator Superfamily) FT transport protein" FT /note="Original (2000) note: Cj0484, probable transmembrane FT transport protein, len: 410 aa; similar to members of the FT phalate transporter family e.g. TR:Q44470 (EMBL:U25634) FT Agrobacterium vitis putative tartrate transporter (433 aa), FT fasta scores; opt: 1004 z-score: 1322.2 E(): 0, 40.4% FT identity in 408 aa overlap, and PHT1_PSEPU phthalate FT transporter (451 aa), fasta scores; opt: 663 z-score: 835.4 FT E(): 0, 29.8% identity in 413 aa overlap. No Hp ortholog" FT /note="Updated (2006) note: Pfam domain PF07690 Major FT Facilitator Superfamily (MFS) identified within CDS. Eleven FT probable transmembrane helices predicted by TMHMM2.0. FT Product modified to more specific family member due to FT motif match. Functional classification -Transport/binding FT proteins - Other" FT /db_xref="GOA:Q0PB29" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR016196" FT /db_xref="InterPro:IPR020846" FT /db_xref="UniProtKB/TrEMBL:Q0PB29" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF07690" FT /protein_id="CAL34632.1" FT /translation="MKHANSIKLELVCKKISWRILPLIVLMFCLSMLDRTNISFVKSHI FT EIDAGIGEAAYALGAGIFFIGYAIFEVPSNLFLHKLGAKIWLSRIMITWGLVTMAMIFI FT QGEISFYVLRFLLGLTEAGFSPGIILYLSYFFPAIYRSKAYGIYQMGVPIAFVFGSLIS FT GFILDYTPNIYFKNWQWMFLIEGGITVLVGIFCLFYLDSHPKDAKWLDIKEKDILLKHI FT EISNTKAKDYSIKDIFKSILVWKFVFVYFCIQLSVYGVLFYLPSKIAQILQINVGFEVG FT LLNAIPWIFVFIALPIFTSLADKKHSWNLHAILFLLLASLSMIASTFVTNLAAFLFFIS FT LAAIGFIVIQPIFWNLPTQVLKGKGAAAAIALIGSLGNLGGFVAPTLKTYIENHFGVEF FT GLIVLALIAIL" FT misc_feature order(451103..451168,451211..451279,451298..451357, FT 451385..451453,451478..451546,451574..451642, FT 451769..451837,451880..451948,451967..452035, FT 452045..452113,452138..452206) FT /note="11 probable transmembrane helices predicted for FT Cj0484 by TMHMM2.0 at aa 20-41, 56-78, 85-104, FT 114-136,145-167, 177-199, 242-264, 279-301, 308-330, FT 334-356 and 365-387" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 451115..452224 FT /note="HMMPfam hit to PF07690, Major Facilitator FT Superfamily, score 6.8e-47" FT /inference="protein motif:Pfam:PF07690" FT CDS 452320..453108 FT /transl_table=11 FT /locus_tag="Cj0485" FT /product="putative oxidoreductase" FT /note="Original (2000) note: Cj0485, probable FT oxidoreductase, len: 262 aa; similar to many e.g. FT FABG_AQUAE 3-oxoacyl-[acyl-carrier protein] reductase (248 FT aa), fasta scores; opt: 384 z-score: 465.5 E(): FT 1.2e-18,34.3% identity in 254 aa overlap, and BA71_EUBSP FT 7-alpha-hydroxysteroid dehydrogenase (249 aa), fasta FT scores; opt: 349 z-score: 421.2 E(): 3.6e-16, 32.3% FT identity in 254 aa overlap. No Hp ortholog. Also similar to FT C. jejuni fabG, Cj0435 (31.7% identity in 252 aa overlap). FT Contains Pfam matches to entry PF00106 adh_short, FT Alcohol/other dehydrogenases, short chain type,score FT 143.40, E-value 4e-39 and to entry PF00678 adh_short_C2, FT Short chain dehydrogenase /reductase C-terminus, score FT 31.00, E-value 2.7e-05" FT /note="Updated (2006) note: Characterisation work in more FT than one species with marginal identity scores. Putative FT kept within product function. Functional classification FT -Misc" FT /db_xref="GOA:Q0PB28" FT /db_xref="InterPro:IPR002198" FT /db_xref="InterPro:IPR002347" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:Q0PB28" FT /inference="protein motif:Pfam:PF00678" FT /inference="protein motif:Pfam:PF00106" FT /protein_id="CAL34633.1" FT /translation="MDLKIKNKVCIITGGAKGIGYGIAKLWASEGGIPVIFSRSMPKEH FT DKELKKLSSEYEFYEIDLKNYEQIEKLVKKVAIKHGGIYALVNNAGTNDNLHIENTSTQ FT DLIKSYENNLFHYYTMTKECLPYIKKEQGSILNIVSKTGITGQGRTSAYASAKAAQMGF FT TREWACAFAKDNVRVNAIAPAEVMTPLYEKWLQNFPNPKEQYEKIAKAIPLGHRFTTIE FT EIANTAVFTLSPLASHTTGQILMPDGGYVHLDRALNWDEN" FT misc_feature 452347..453069 FT /note="HMMPfam hit to PF00106, short chain FT dehydrogenase,score 2.8e-49" FT /inference="protein motif:Pfam:PF00106" FT CDS 453119..454375 FT /transl_table=11 FT /locus_tag="Cj0486" FT /product="putative sugar transporter" FT /note="Original (2000) note: Cj0486, probable sugar FT transporter, len: 418 aa; simlar to members of the FHS FT family e.g. FUCP_ECOLI L-fucose permease (438 aa), fasta FT scores; opt: 848 z-score: 1022.1 E(): 0, 37.2% identity in FT 390 aa overlap, and GLUP_BRUAB glucose/galactose FT transporter (412 aa), fasta scores; opt: 456 z-score: 830.5 FT E(): 0, 33.4% identity in 410 aa overlap. 32.6% identity to FT HP1174" FT /note="Updated (2006) note: Pfam domain PF07690 Major FT Facilitator Superfamily identified within CDS. Prosite FT PS50850 MFS, Major facilitator superfamily also identified FT along with twelve probable transmembrane helices predicted FT by TMHMM2.0. TIGRFAM motif TIGR00885 L-fucose permease was FT also identified. Fasta search gave high score to FT L-fucose-proton symporter (L-fucose permease). This FT permease mediates the uptake of L-fucose across the FT boundary membrane with the concomitant transport of protons FT into the cell (symport system). It can also transport FT L-galactose and D-arabinose, but at reduced rates compared FT with L-fucose. Other sugar transporters also identified. FT Product function kept the same along with putative. FT Functional classification - Transport/binding proteins - FT Carbohydrates, organic acids and alcohols" FT /note="PMID:15919996, PMID:7783647, PMID:8052131" FT /db_xref="GOA:Q0PB27" FT /db_xref="InterPro:IPR005275" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR016196" FT /db_xref="InterPro:IPR020846" FT /db_xref="UniProtKB/TrEMBL:Q0PB27" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF07690" FT /inference="protein motif:Prosite:PS50850" FT /protein_id="CAL34634.1" FT /translation="MTDSKNIKIAIVLVTSLFFLWGVSYGLIDVMNKNFQNHLHISQHE FT SGFLQFAYFGAYFIIALPAGYIANRFSYKMGIIFGLALYAIGALLIIPATNLASFHLFL FT FAFFILACGIGSLETSANPYMTKLGDEKNASFRINAAQSFNGLGQFVGPIIGGALFLSI FT TKQEEGASKEQIQAALVANMGNVQLVYIGIAVIVILILIAFVANKLPEGSAVSDDYKQK FT DDSKPIYVFKHRHFNLGLLAQFLYIANQVAAGAFFINYVVEHNEGLKDAQGAYYFSIAL FT VAFMLGRIVSTPLMKIIKGEKILGFYSLINVLICFSLYFASGFFSIVLLIALFFFMSIS FT FPTIFAVATKNLPLNQVKLGGSLLVMSIVGGAIMPIIIGFINDHYGTGAGYLAMAPLFL FT YVAWYGFIGSKVRKNAKDF" FT misc_feature 453143..454267 FT /note="HMMPfam hit to PF07690, Major Facilitator FT Superfamily, score 2.2e-30" FT /inference="protein motif:Pfam:PF07690" FT misc_feature order(453143..453211,453254..453322,453341..453409, FT 453422..453490,453548..453607,453665..453733, FT 453824..453892,453935..453988,454025..454078, FT 454091..454159,454193..454261,454271..454339) FT /note="12 probable transmembrane helices predicted for FT Cj0486 by TMHMM2.0 at aa 9-31, 46-68, 75-97, FT 102-124,144-163, 183-205, 236-258, 273-290, 303-320, FT 325-347,359-381 and 385-407" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 453422..453454 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 454359..455129 FT /transl_table=11 FT /locus_tag="Cj0487" FT /product="putative amidohydrolase" FT /note="Original (2000) note: Cj0487, unknown, len: 256 aa; FT some similarity to Y4MH_RHISN hypothetical protein Y4MH FT (297 aa), fasta scores; opt: 98 z-score: 200.8 E(): FT 0.00069, 22.7% identity in 295 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF04909 FT Amidohydrolase identified within CDS. Product modified to FT more specific family member due to motif match. No specific FT characterisation has been carried out yet. Thus,putative FT kept within product function. Functional classification - FT Misc" FT /db_xref="GOA:Q0PB26" FT /db_xref="InterPro:IPR006992" FT /db_xref="UniProtKB/TrEMBL:Q0PB26" FT /inference="protein motif:Pfam:PF04909" FT /protein_id="CAL34635.1" FT /translation="MQKIFDAHLHLWDLEKIPISWIKDDEKLEQNYDFFRMKQEYKEFE FT FIGAMYVEVNSDDLEKEALFALEQKKLHNLLFCLADFKHKEELSSFREVMHTSKKGAKR FT LFEADFEEKIEILKTFNIPFEACIKNEELGFLEKFLSKNPNLKVVLNHLGSPKINRLNE FT YKKDLSFLKKFQNLYIKLSIPDGFSQETPKEFIFELFAFLKENFSENKFIFGSNYPVAK FT ITPAKWAKLIIESKIFDDLDKIFYKNALLIYKGG" FT misc_feature 454371..455123 FT /note="HMMPfam hit to PF04909, Amidohydrolase, score FT 3.4e-29" FT /inference="protein motif:Pfam:PF04909" FT CDS 455130..455447 FT /transl_table=11 FT /locus_tag="Cj0488" FT /product="conserved hypothetical protein Cj0488" FT /note="Original (2000) note: Cj0488, unknown, len: ; FT similar to a hypothetical protein from B. subtilis FT TR:O05263 (EMBL:Z93938) YULD(104 aa), fasta scores; opt: FT 183 z-score: 266.1 E(): 1.6e-07, 33.6% identity in 107 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF05336 Protein of FT unknown function (DUF718) identified within CDS. Conserved FT added to product function. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="GOA:Q0PB25" FT /db_xref="InterPro:IPR008000" FT /db_xref="UniProtKB/TrEMBL:Q0PB25" FT /inference="protein motif:Pfam:PF05336" FT /protein_id="CAL34636.1" FT /translation="MQRYGQIIKIKKEKIEEYKELHTKPYEGVCEMIKECNIQNYSIYL FT FGEYLFAYFEYIGADFEADMAKMARDESTQKWWKVTDPCQISLGYAGQKWLNMEEVFHL FT D" FT misc_feature 455133..455444 FT /note="HMMPfam hit to PF05336, Protein of unknown function FT (DUF718), score 3e-63" FT /inference="protein motif:Pfam:PF05336" FT CDS 455461..455682 FT /transl_table=11 FT /gene="ald'" FT /locus_tag="Cj0489" FT /product="putative aldehyde dehydrogenase N-terminus" FT /EC_number="1.2.1.22" FT /note="Original (2000) note: Cj0489, ald', aldehyde FT dehydrogenase N-terminus, len: 73 aa; highly similar to FT ALDA_ECOLI aldehyde dehydrogenase A (EC 1.2.1.22) (478 aa), FT fasta scores; opt: 229 z-score: 319.3 E(): 1.7e-10,51.5% FT identity in 68 aa overlap. Similarity continues into FT downstream ORF Cj0490. No error in the sequence can be FT found. No Hp match" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Gene names FT for Cj0489 and Cj0490 are identical with a ' denoting two FT separate terminals for the same CDS. May well be a FT pseudogene. Putative kept within product function. FT Functional classification - Central intermediary metabolism FT - General" FT /note="PMID:3308886" FT /db_xref="GOA:Q0PB24" FT /db_xref="InterPro:IPR015590" FT /db_xref="InterPro:IPR016161" FT /db_xref="InterPro:IPR016162" FT /db_xref="UniProtKB/TrEMBL:Q0PB24" FT /protein_id="CAL34637.1" FT /translation="MTTYLNYIDGKFIPHNGEFIEVLNPATKEVISRVASASLEDTKRA FT IEAAKKAQKVWEAKPAIERANHLKEIAS" FT CDS 455718..456899 FT /transl_table=11 FT /gene="ald'" FT /locus_tag="Cj0490" FT /product="putative aldehyde dehydrogenase C-terminus" FT /EC_number="1.2.1.22" FT /note="Original (2000) note: Cj0490, ald', aldehyde FT dehydrogenase C-terminus, len: 393 aa; highly similar to FT ALDA_ECOLI aldehyde dehydrogenase A (EC 1.2.1.22) (478 aa), FT fasta scores; opt: 1653 z-score: 2398.4 E(): 0, 63.7% FT identity in 388 aa overlap. Similarity continues from FT upstream ORF Cj0489. No error in the sequence can be found. FT No Hp match. Contains PS00687 Aldehyde dehydrogenases FT glutamic acid active site and Pfam match to entry PF00171 FT aldedh, Aldehyde dehydrogenase, score 433.60, E-value FT 1.8e-126" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Gene names FT for Cj0489 and Cj0490 are identical with a ' denoting two FT separate terminals for the same CDS. May well be a FT pseudogene. Putative kept within product function. FT Functional classification - Central intermediary metabolism FT - General" FT /note="PMID:3308886" FT /db_xref="GOA:Q0PB23" FT /db_xref="InterPro:IPR015590" FT /db_xref="InterPro:IPR016160" FT /db_xref="InterPro:IPR016161" FT /db_xref="InterPro:IPR016162" FT /db_xref="InterPro:IPR016163" FT /db_xref="UniProtKB/TrEMBL:Q0PB23" FT /inference="protein motif:Pfam:PF00171" FT /inference="protein motif:Prosite:PS00687" FT /protein_id="CAL34638.1" FT /translation="MQEQGKTRVLASIEINFTADYMDYTAEWARRYEGEIIQSDRANEH FT IYLYKSAIGVIGGILPWNFPFFLIARKMAPALLTGNTIVIKPSSETPNNAFEFAKLVSQ FT SSLPKGVFNLVAGKGSVVGYELSSNENIGMVSLTGSVEAGTRVMEAAAKNIIKVSLELG FT GKAPAIVCKDADIDLAVEAIKASRICNNGQVCNCAERAYVHTSVYDEFVDKFVKAMSKV FT SVGNTLKGDFDMGPLVNQAGVDNALAMLQRATAKGAIVECGGKITDTSGYYFPASVLTN FT VKHEDEIMQKEIFAPILPIAKFDTLDEVIDMANDCEYGLTSSIYTQNLDIAMRASREIK FT FGETYINRENFEAMQGFHAGFRKSGIGGADGKHGLEEYLATHVVYLQYNTNKQ" FT misc_feature 455721..456881 FT /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase FT family, score 9.2e-130" FT /inference="protein motif:Pfam:PF00171" FT misc_feature 455853..455921 FT /note="1 probable transmembrane helix predicted for Cj0490 FT by TMHMM2.0 at aa 46-68" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 456195..456218 FT /note="PS00687 Aldehyde dehydrogenases glutamic acid active FT site" FT /inference="protein motif:Prosite:PS00687" FT CDS 457227..457613 FT /transl_table=11 FT /gene="rpsL" FT /locus_tag="Cj0491" FT /product="30S ribosomal protein S12" FT /note="Original (2000) note: Cj0491, rpsL, 30S ribosomal FT protein S12, len: 128 aa; highly similar to many e.g. FT RS12_ECOLI 30S ribosomal protein S12(123 aa), fasta scores; FT opt: 642 z-score: 1211.5 E(): 0, 76.2% identity in 122 aa FT overlap. 87.5% identity to HP1197. Contains PS00055 FT Ribosomal protein S12 signature and Pfam match to entry FT PF00164 S12, Ribosomal protein S12, score 259.60, E-value FT 4.3e-74" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:320034" FT /db_xref="GOA:Q9PI18" FT /db_xref="InterPro:IPR005679" FT /db_xref="InterPro:IPR006032" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR016027" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI18" FT /inference="protein motif:Pfam:PF00164" FT /inference="protein motif:Prosite:PS00055" FT /protein_id="CAL34639.1" FT /translation="MPTINQLVRKERKKVLEKSKSPALKNCPQRRGVCTRVYTTTPKKP FT NSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDT FT AGVAKRTVSRSKYGAKRPKAGAAK" FT misc_feature 457233..457595 FT /note="HMMPfam hit to PF00164, Ribosomal protein S12,score FT 4.3e-73" FT /inference="protein motif:Pfam:PF00164" FT misc_feature 457353..457376 FT /note="PS00055 Ribosomal protein S12 signature" FT /inference="protein motif:Prosite:PS00055" FT CDS 457683..458153 FT /transl_table=11 FT /gene="rpsG" FT /locus_tag="Cj0492" FT /product="30S ribosomal protein S7" FT /note="Original (2000) note: Cj0492, rpsG, 30S ribosomal FT protein S7, len: 156 aa; highly similar to many e.g. FT RS7_ECOLI 30S ribosomal protein S7 (178 aa), fasta scores; FT opt: 619 z-score: 1114.1 E(): 0, 58.1% identity in 155 aa FT overlap. 69.9% identity to HP1196. Contains PS00052 FT Ribosomal protein S7 signature and Pfam match to entry FT PF00177 S7, Ribosomal protein S7, score 285.50, E-value FT 6.5e-82" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:385062" FT /db_xref="GOA:Q9PI17" FT /db_xref="InterPro:IPR000235" FT /db_xref="InterPro:IPR005717" FT /db_xref="InterPro:IPR020606" FT /db_xref="InterPro:IPR023798" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI17" FT /inference="protein motif:Pfam:PF00177" FT /inference="protein motif:Prosite:PS00052" FT /protein_id="CAL34640.1" FT /translation="MRRRKAPVREVLPDPIYGNKVITKFINSLMYDGKKSTATTIMYGA FT LEAIDKKGGEKKGIDIFNDAIENIKPLLEVKSRRVGGATYQVPVEVRPARQQALAIRWI FT ISFARKRSERTMIDKLAAELLDAANSKGASFKKKEDTYKMAEANKAFAHYRW" FT misc_feature 457683..458129 FT /note="HMMPfam hit to PF00177, Ribosomal protein FT S7p/S5e,score 4.1e-74" FT /inference="protein motif:Pfam:PF00177" FT misc_feature 457737..457817 FT /note="PS00052 Ribosomal protein S7 signature" FT /inference="protein motif:Prosite:PS00052" FT CDS 458166..460241 FT /transl_table=11 FT /gene="fusA" FT /locus_tag="Cj0493" FT /product="elongation factor G" FT /note="Original (2000) note: Cj0493, fusA, elongation FT factor G, len: 691 aa; highly similar to many e.g. FT EFG_ECOLI elongation factor G (EF-G) (703 aa), fasta FT scores; opt: 2979 z-score: 3278.1 E(): 0, 65.1% identity in FT 702 aa overlap. 80.3% identity to HP1195. Contains PS00017 FT ATP/GTP-binding site motif A (P-loop), PS00301 GTP-binding FT elongation factors signature and Pfam matches to entry FT PF00009 GTP_EFTU, Elongation factor Tu family (contains FT ATP/GTP binding P-loop), score 704.00, E-value 6.9e-208, FT and to entry PF00679 EFG_C, Elongation factor G C-terminus, FT score 387.40, E-value 1.4e-112" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Literature search identified FT paper linking protein to glycoprotein (PMID:12186869). FT Functional classification - Protein translation and FT modification" FT /note="PMID:8282687, PMID:12186869" FT /db_xref="GOA:Q9PI16" FT /db_xref="InterPro:IPR000640" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR004161" FT /db_xref="InterPro:IPR004540" FT /db_xref="InterPro:IPR005225" FT /db_xref="InterPro:IPR005517" FT /db_xref="InterPro:IPR009000" FT /db_xref="InterPro:IPR009022" FT /db_xref="InterPro:IPR014721" FT /db_xref="InterPro:IPR020568" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI16" FT /inference="protein motif:Pfam:PF00679" FT /inference="protein motif:Pfam:PF00009" FT /inference="protein motif:Prosite:PS00301" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34641.1" FT /translation="MSRSTPLKKVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHD FT GAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVA FT VFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVEDQIRNRLKANPVPLQ FT IPIGAEDNFKGVIDLVTMKALVWEDDTKPTDYVEKEIPAELKEKAEEYRTKMIEAVSET FT SDELMEKYLGGEELSLEEIKTGIKAGCLSLSIVPMLCGTAFKNKGVQPLLDAVVAYLPA FT PDEVANIKGEYEDGTEVSVKSTDDGEFAGLAFKIMTDPFVGQLTFVRVYRGCLESGSYA FT YNSTKDKKERIGRLLKMHSNKREEIKVLYAGEIGAVVGLKDTLTGDTLASEKDKVILER FT MDFPDPVISVAVEPKTKADQEKMSIALNKLAQEDPSFRVSTDEESGQTIISGMGELHLE FT IIVDRMLREFKVEAEVGQPQVAYRETIRKTVEQEYKYAKQSGGRGQYGHVFLRLEPLEP FT GSGYEFVNDIKGGVIPKEYIPAVDKGVQEALQNGVLAGYPVEDVKVTVYDGSYHEVDSS FT EMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEDYMGDVIGDLNKRRGQVNSMDER FT GGNKIITAFCPLAEMFGYSTDLRSQTQGRATYSMEFDHYDEVPKNVADEIIKKRNG" FT misc_feature 458187..459014 FT /note="HMMPfam hit to PF00009, Elongation factor Tu GTP FT binding domain, score 5.8e-118" FT /inference="protein motif:Pfam:PF00009" FT misc_feature 458214..458237 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 458316..458363 FT /note="PS00301 GTP-binding elongation factors signature" FT /inference="protein motif:Prosite:PS00301" FT misc_feature 459129..459332 FT /note="HMMPfam hit to PF03144, Elongation factor Tu domain, FT score 1.2e-17" FT /inference="protein motif:Pfam:PF03144" FT misc_feature 459594..459953 FT /note="HMMPfam hit to PF03764, Elongation factor G, domain FT IV, score 1.6e-75" FT /inference="protein motif:Pfam:PF03764" FT misc_feature 459957..460220 FT /note="HMMPfam hit to PF00679, Elongation factor G FT C-terminus, score 1.1e-53" FT /inference="protein motif:Pfam:PF00679" FT tRNA 460270..460346 FT /gene="tRNA-Arg" FT /note="tRNA Arg anticodon CCT, Cove score 69.48" FT CDS 460364..460513 FT /transl_table=11 FT /locus_tag="Cj0494" FT /product="putative exporting protein" FT /note="Original (2000) note: Cj0494, small hydrophobic FT protein, len: 49 aa; no Hp match" FT /note="Updated (2006) note: Product function modified to FT more specific family member based on SignalP 2.0 HMM FT results. Putative kept within product function. Functional FT classification - Transport/binding proteins - Other" FT /db_xref="UniProtKB/TrEMBL:Q0PB19" FT /protein_id="CAL34642.1" FT /translation="MIKIAFFITFVISFLAAQSPVNFKEDNNITKERNIFKEQLPKRIK FT IPTH" FT sig_peptide 460364..460435 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000228_460364_460513 by SignalP 2.0 FT HMM (Signal peptide probability 0.970) with cleavage site FT probability 0.433 between residues 24 and 25" FT CDS 460519..461220 FT /transl_table=11 FT /locus_tag="Cj0495" FT /product="putative methyltransferase domain protein" FT /note="Original (2000) note: Cj0495, unknown, len: 233 aa; FT some simillarity to hypothetical proteins e.g. YABB_BACSU FT (247 aa), fasta scores; opt: 295 z-score: 352.0 E(): FT 2.6e-12, 23.9% identity in 230 aa overlap. 36.9% identity FT to HP1504. Contains PS00092 N-6 Adenine-specific DNA FT methylases signature" FT /note="Updated (2006) note: Pfam domain PF05175 FT methyltransferase small domain and PF08242 FT Methyltransferase domain identified within CDS. Members of FT this family are SAM dependent methyltransferases. Prosite FT domain PS50193 SAM_BIND, SAM (and some other nucleotide) FT binding motif also identified within CDS. Product modified FT to more specific family member due to motif match. No FT specific characterisation with acceptable identity score FT has been carried out yet. Putative kept within product FT function. Functional classification - Misc" FT /note="PMID:9873033" FT /db_xref="GOA:Q0PB18" FT /db_xref="InterPro:IPR002052" FT /db_xref="InterPro:IPR007848" FT /db_xref="UniProtKB/TrEMBL:Q0PB18" FT /inference="protein motif:Pfam:PF08242" FT /inference="protein motif:Pfam:PF05175" FT /inference="protein motif:Prosite:PS00092" FT /inference="protein motif:Prosite:PS50193" FT /protein_id="CAL34643.1" FT /translation="MSDLITLAQLSQGYRYNSDSLILADFILKQGIKGAVFDVGAGCGI FT IGILLKKNIANLSLSLIDIQKENIELIEKNLKSNKIQGDIFHDDFNQFQIIKKFDFIVC FT NPPFYRQGAYKSEDQHKAISKFQEFLPLHSFLAKTNSMLKPNGTLYFCYEALALDEICF FT ILKDMKMKITKLCFVHTHQSKKARLVLIQVKKGSKSPCEILPPFFVYENEILSKQMQEI FT HLRFRLKSYDI" FT misc_feature 460822..460842 FT /note="PS00092 N-6 Adenine-specific DNA methylases FT signature" FT /inference="protein motif:Prosite:PS00092" FT CDS 461210..461584 FT /transl_table=11 FT /locus_tag="Cj0496" FT /product="conserved hypothetical protein Cj0496" FT /note="Original (2000) note: Cj0496, unknown, len: 124 aa; FT similar to hypothetical proteins e.g. TR:O59308 FT (EMBL:AB009522) Pyrococcus horikoshii PHAV002 (141 FT aa),fasta scores; opt: 154 z-score: 270.6 E(): FT 8.8e-08,30.1% identity in 113 aa overlap. 47.5% identity to FT HP0274" FT /note="Updated (2006) note: Pfam domain PF03692 FT Uncharacterised protein family (UPF0153) identified within FT CDS. Conserved added to product function. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="InterPro:IPR005358" FT /db_xref="UniProtKB/TrEMBL:Q0PB17" FT /inference="protein motif:Pfam:PF03692" FT /protein_id="CAL34644.1" FT /translation="MIFDKNFSYAFDENACEKCGGKCCTGESGNIFASKEELEVLRKHL FT NLESKEFAEKYLRKVGFKMSFKEVECEDGFACIFFDTQKRNCSIYDFRPKQCRTFPFWE FT YFKTHQKELEKECIGICYLS" FT misc_feature 461249..461575 FT /note="HMMPfam hit to PF03692, Uncharacterised protein FT family (UPF0153), score 1.4e-32" FT /inference="protein motif:Pfam:PF03692" FT CDS 461557..462834 FT /transl_table=11 FT /locus_tag="Cj0497" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0497, probable FT lipoprotein,len: 425 aa; some similarity to hypothetical FT prteins e.g. TR:O67021 (EMBL:AE000710) Aquifex aeolicus FT AQ_854 (545 aa), fasta scores; opt: 266 z-score: 326.7 E(): FT 6.7e-11,29.1% identity in 412 aa overlap. 26.7% identity to FT HP0275 (misannotated as ATP-dependent nuclease (addB)). FT Contains N-terminal signal sequence and PS00013 Prokaryotic FT membrane lipoprotein lipid attachment site. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PB16" FT /db_xref="InterPro:IPR011990" FT /db_xref="UniProtKB/TrEMBL:Q0PB16" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34645.1" FT /translation="MYRYLLFVLAAFFLAACGSSKINVVYPDYTKYKSNDFDLRVMKAY FT NYEYYKQYKEARDEFLSLYQDYNNTNFLENAFLLTLANNLDKQAELDNLAKPYLNQNDN FT LKRLSALYALNSNDINNAQKLMKELLTKKDSDPRNLELYGDILVKKNDLKNATKYYRSA FT YNQVQNEEILFKLIGIYAILNDTLNIKNVLEFSRKTNGCTLKTCVLLAKIYFDEKNIEA FT LKSIYKELYQLTKNKSFVLALVELLNSQGKTEEALKISLQYDLDDDIKLALYQNLKRFD FT DAKKMSLALYHKTKNKEYLLRAAVFEFEAANEAKKITPKVIDSVKEKFEQAIDKDSNAL FT YLNYYGYLLIDYDLDVKKGIELVKLALEKDPQNLYYLDSLAWGYYKLGDCKQAWEILKQ FT TLDDKEFANSDESKAHIKAIKACIKP" FT sig_peptide 461557..461628 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000231_461557_462834 by SignalP 2.0 FT HMM (Signal peptide probability 0.983) with cleavage site FT probability 0.440 between residues 24 and 25" FT misc_feature 461569..461637 FT /note="1 probable transmembrane helix predicted for Cj0497 FT by TMHMM2.0 at aa 5-27" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 461570..461581 FT /note="PS00294 Prenyl group binding site (CAAX box)" FT /inference="protein motif:Prosite:PS00294" FT misc_feature 461575..461607 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 461965..462066 FT /note="HMMPfam hit to PF07719, Tetratricopeptide FT repeat,score 2.3" FT /inference="protein motif:Pfam:PF07719" FT CDS 462831..463607 FT /transl_table=11 FT /gene="trpC" FT /locus_tag="Cj0498" FT /product="indole-3-glycerol phosphate synthase" FT /EC_number="4.1.1.48" FT /note="Original (2000) note: Cj0498, trpC, probable FT indole-3-glycerol phosphate synthase, len: 258 aa; similar FT to many e.g. TRPC_PSEAE indole-3-glycerol phosphate FT synthase (EC 4.1.1.48) (278 aa), fasta scores; opt: 603 FT z-score: 921.4 E(): 0, 40.8% identity in 260 aa overlap. FT 37.6% identity to N-terminus of HP1279. Contains PS00614 FT Indole-3-glycerol phosphate synthase signature and Pfam FT match to entry PF00218 IGPS, Indole-3-glycerol phosphate FT synthases, score 360.30, E-value 2.1e-104" FT /note="Updated (2006) note: Characterised within FT Pseudomonas aeruginosa with acceptable identity score. FT Putative not added to product function. Functional FT classification - Amino acid biosynthesis - Aromatic amino FT acid family" FT /note="PMID:2105306" FT /db_xref="GOA:Q9PI11" FT /db_xref="InterPro:IPR001468" FT /db_xref="InterPro:IPR011060" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR013798" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI11" FT /inference="protein motif:Pfam:PF00218" FT /inference="protein motif:Prosite:PS00614" FT /protein_id="CAL34646.1" FT /translation="MILDKIFEKTKEDLKERKLKLPYDMLGRSLASNPFFPKDVIKALK FT RVEKEVKIIAEVKKASPSKGVIREDFDPLSIALNYEKNKAAAISVLTEPHFFKGSLEYL FT SLIRRYTQIPLLRKDFIFDEYQILEALVYGADFVLLIAKMLSMKELKKLLEFARHLGLE FT ALVEIHDKEDLSKAIFAGADIIGINHRNLEDFTMDMSLCEKLIPQIPNSKIIIAESGLE FT NKEFLEHLQNLGVDAFLIGEYFMREKDEGKALKALL" FT misc_feature 462834..463601 FT /note="HMMPfam hit to PF00218, Indole-3-glycerol phosphate FT synthase, score 2.7e-106" FT /inference="protein motif:Pfam:PF00218" FT misc_feature 462987..463031 FT /note="PS00614 Indole-3-glycerol phosphate synthase FT signature" FT /inference="protein motif:Prosite:PS00614" FT CDS 463617..464102 FT /transl_table=11 FT /locus_tag="Cj0499" FT /product="putative histidine triad (HIT) family protein" FT /note="Original (2000) note: Cj0499, unknown, len: 161 aa; FT similar to many members of the HIT family e.g. HIT_BACSU FT HIT protein (145 aa), fasta scores; opt: 176 z-score: 274.7 FT E(): 5.2e-08, 26.1% identity in 111 aa overlap. 42.6% FT identity to HP0741. Contains Pfam match to entry PF01230 FT HIT, HIT family, score 19.90, E-value 3.6e-06" FT /note="Updated (2006) note: Product modified to more FT specific family member due to motif match. No specific FT characterisation has been carried out yet. Putative kept FT within product function. Functional classification - Misc" FT /db_xref="GOA:Q0PB14" FT /db_xref="InterPro:IPR001310" FT /db_xref="InterPro:IPR011146" FT /db_xref="InterPro:IPR011151" FT /db_xref="UniProtKB/TrEMBL:Q0PB14" FT /inference="protein motif:Pfam:PF01230" FT /protein_id="CAL34647.1" FT /translation="MQYLYAPWRSEYFEKVKSICPFCDCANKIKSDEELGVIFRAKHCF FT GVMNRYPYSAGHFMVIPYIHEEHIENLSDEIWQEMSYFVRLGVKILKEQIHANGVNIGM FT NLSKDAGAGIAFHCHYHLVPRWSGDTNFITTIGETRVCGTNIEQVYQKLVLAFKNAQ" FT misc_feature 463674..464000 FT /note="HMMPfam hit to PF01230, HIT domain, score 7.1e-06" FT /inference="protein motif:Pfam:PF01230" FT CDS 464092..465090 FT /transl_table=11 FT /locus_tag="Cj0500" FT /product="putative rhodanese-like domain protein" FT /note="Original (2000) note: Cj0500, probable ATP/GTP FT binding protein, len: 332 aa; similar to e.g. YBBB_ECOLI FT (364 aa), fasta scores; opt: 348 z-score: 507.3 E(): FT 5.8e-21, 31.3% identity in 243 aa overlap. No Hp match. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Prosite domain PS50206 FT RHODANESE_3, Rhodanese domain profile also identified FT within CDS. Rhodanese, a sulphurtransferase involved in FT cyanide detoxification shares evolutionary relationship FT with a large family of proteins. This domain is found as a FT single copy in other proteins, including phosphatases and FT ubiquitin C-terminal hydrolases. Product modified to new FT function based on motif identification. No specific FT characterisation has been carried out yet, so putative kept FT within product function. Functional classification -Misc" FT /db_xref="GOA:Q0PB13" FT /db_xref="InterPro:IPR001763" FT /db_xref="InterPro:IPR017582" FT /db_xref="UniProtKB/TrEMBL:Q0PB13" FT /inference="protein motif:Prosite:PS00017" FT /inference="protein motif:Prosite:PS50206" FT /protein_id="CAL34648.1" FT /translation="MLSEVEFVEFQKENFSLLIDARSPREFLHSHLIGALNFYALNDEE FT YQEIGTIYKKNQALAKAMGASYICQNTTKHILEITQNFRIGEKVGIYCSRGGLRSKSIA FT VILSELGFRVVRLKGGFKAYRTFVTHYFENEINFDFFALCGNTGCGKTELLEQLPQAIN FT LEKMANHLGSSFGDILGKQPTQKAFEAELFHNIQNLENFAFIESESRKIGDIILPLKFY FT EKMQKAFKIYCFCSLENRVRRIQKIYQEKMTPLKFQQCVQKISPYISLNLRQDLLQSYE FT RKEWQKLIVMLLEYYDKTYKKPDKIDLELNTDDILKAKEELLDHFKVQLLF" FT misc_feature 464524..464547 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS join(465376..465453,465453..466124,466123..466269, FT 466273..466393,466395..466495,466497..466598) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0501" FT /product="pseudogene (ammonium transporter)" FT /note="Original (2000) note: Cj0501, probable ammonium FT transporter pseudogene; len: 1114 bp; similar to amny e.g. FT NRGA_BACSU probable ammonium transporter (404 aa).There is FT at least one frameshift and one stop codon in this FT pseudogene. No Hp match. Contains PS01219 Ammonium FT transporters signature and Pfam match to entry PF00909 FT Ammonium_transp, Ammonium Transporter Family, score FT 29.60,E-value 7.1e-12" FT /note="Updated (2006) note: Nine probable transmembrane FT helices predicted by TMHMM2.0. Further support given to FT product function. Characterised within Escherichia coli and FT Bacillus subtilis with acceptable identity scores. Thus, FT putative not added to product function. Coding sequence has FT been updated to reflect the complete amino acid sequence FT for the encoded protein regardless of its expression. This FT will cause differences from the amino acid sequence of the FT previous annotation. Functional classification - FT Transport/binding proteins - Other" FT /note="PMID:12023896, PMID:10931328, FT PMID:15361618,PMID:14600241" FT /db_xref="PSEUDO:CAL34649.1" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00909" FT /inference="protein motif:Prosite:PS01219" FT misc_feature order(465388..465453,465453..465455,465492..465560, FT 465654..465722,465735..465803,465846..465914, FT 465951..466010,466038..466106,466192..466260, FT 466439..466495,466497..466508) FT /note="9 probable transmembrane helices predicted for FT Cj0501 by TMHMM2.0 at aa 5-27, 40-62, 94-116, FT 121-143,158-180, 193-212, 222-244, 274-296 and 355-377" FT /inference="protein motif:TMHMM:2.0" FT misc_feature order(465394..465453,465453..466123,466124..466269, FT 466273..466393,466395..466495,466497..466586) FT /note="HMMPfam hit to PF00909, Ammonium Transporter Family, FT score 7.1e-121" FT /inference="protein motif:Pfam:PF00909" FT CDS complement(466660..467571) FT /transl_table=11 FT /gene="hemH" FT /locus_tag="Cj0503c" FT /product="putative ferrochelatase" FT /EC_number="4.99.1.1" FT /note="Original (2000) note: Cj0503c, hemH, probable FT ferrochelatase, len: 303 aa; similar to e.g. HEMZ_SYNY3 FT probable ferrochelatase (EC 4.99.1.1) (387 aa), fasta FT scores; opt: 299 z-score: 794.5 E(): 0,31.4% identity in FT 318 aa overlap, and to the eukaryotic ferrochelatases e.g. FT HEMZ_BOVIN ferrochelatase precursor (EC 4.99.1.1) (416 aa), FT fasta scores; opt: 348 z-score: 683.2 E(): 9.2e-31,30.8% FT identity in 292 aa overlap. 40.2% identity to HP0376. FT Contains PS00534 Ferrochelatase signature and Pfam match to FT entry PF00762 Ferrochelatase, Ferrochelatase,score 257.40, FT E-value 1.9e-73" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity score has been carried out yet. FT Putative kept within product function. Functional FT classification - Biosynthesis of cofactors, prosthetic FT groups and carriers - Heme" FT /note="PMID:8056770" FT /db_xref="GOA:Q9PI08" FT /db_xref="InterPro:IPR001015" FT /db_xref="InterPro:IPR019772" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI08" FT /inference="protein motif:Pfam:PF00762" FT /inference="protein motif:Prosite:PS00534" FT /protein_id="CAL34650.1" FT /translation="MKLVLFLNMGGATNLQDCEVFLKNMFNDPYILGIKNRFLRKFVAW FT IITKARVKAMQENYKKMGGKSPLNELTQSLCDKLNLKQDEFKFDFVNLYVPPFATEILQ FT KYTLNASDEIILFPLYPHHSCTTVTSSLEVLQNEISKQKIQAKVKTIDIFYKNELYNEM FT IVSHILAKKSKFDAKILIFSAHSLPQSIIDKGDLYEKHVNDHVEILKEKLKDHFDEFIL FT AYQSKLGPVKWLEPNTSDVLANLNDKALIYPISFCIDCSETIFELGMEYKHLSKYNYDL FT ISCPNDSDEFMEFILKYLSDLN" FT misc_feature complement(466663..467562) FT /note="HMMPfam hit to PF00762, Ferrochelatase, score 3e-72" FT /inference="protein motif:Pfam:PF00762" FT misc_feature complement(466978..467034) FT /note="PS00534 Ferrochelatase signature" FT /inference="protein motif:Prosite:PS00534" FT CDS complement(467568..468434) FT /transl_table=11 FT /locus_tag="Cj0504c" FT /product="putative oxidoreductase" FT /note="Original (2000) note: Cj0504c, unknown, len: 288 aa; FT similar to hypothetical proteins e.g. YISS_BACSU 342 aa), FT fasta scores; opt: 224 z-score: 359.9 E(): 9.4e-13,28.1% FT identity in 192 aa overlap. 26.4% identity to HP0679" FT /note="Updated (2006) note: Pfam domain PF01408 FT Oxidoreductase family, NAD-binding Rossmann fold identified FT within CDS. Product function modified due to motif match. FT No specific characterisation has been carried out yet. FT Putative kept within product function. Functional FT classification - Misc" FT /db_xref="GOA:Q0PB11" FT /db_xref="InterPro:IPR000683" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:Q0PB11" FT /inference="protein motif:Pfam:PF01408" FT /protein_id="CAL34651.1" FT /translation="MKIGIIGLGKMGQNHLNELSKNSHFKLNALFDLCKNPNLNIFDDI FT FYDDLDKFLNQNNDIIIIATPTNSHLTIAKKVFKQCKCVLIEKPLALNLKEIDEISNLA FT KEYSIKVGVGFCERFNPAVLALKKELENEEIISINIQRFSPYPQRISDVGILQDLAVHD FT LDLLCFLSKQEITKTNLLKKYTQDQTRESESIILCGLEKCIASIHQSWNSTQKLRKIHL FT ITKNHFYEANLNDFSLLKDGNFIELTQQSPLFSEHEALLKLIDNQPNHLASTSDAYKVQ FT EILERFA" FT misc_feature complement(468090..468434) FT /note="HMMPfam hit to PF01408, Oxidoreductase FT family,NAD-binding Rossm, score 1.2e-20" FT /inference="protein motif:Pfam:PF01408" FT CDS complement(468439..469512) FT /transl_table=11 FT /locus_tag="Cj0505c" FT /product="putative aminotransferase (degT family). FT Functional classification-Misc" FT /note="Updated (2006) note: Some characterisation work FT carried out within Bacillus stearothermophilus with FT acceptable identity score. Putative kept within product FT function" FT /note="Original (2000) note: Cj0505c, possible FT aminotransferase, len: 357 aa; similar to members of the FT degT family e.g. DEGT_BACST (372 aa), fasta scores; opt: FT 857 z-score: 1253.3 E(): 0, 38.8% identity in 356 aa FT overlap. No Hp ortholog. Contains Pfam match to entry FT PF01041 DegT_DnrJ_EryC1, DegT/DnrJ/EryC1/StrS family,score FT 441.40, E-value 7.9e-129" FT /note="PMID:2104607" FT /db_xref="GOA:Q0PB10" FT /db_xref="InterPro:IPR000653" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:Q0PB10" FT /inference="protein motif:Pfam:PF01041" FT /protein_id="CAL34652.1" FT /translation="MNFINLQAQYLAYKDEINAEIESVLSSSSFIGGAKLNEFEQNLAH FT FLGVKHAIGCSSGTSALYLALRVLDIGKDDEVIVPSFTFIATAEVVALVGAKPVFADIN FT LSNYNLDFKAVQKAITSKTKAVIAVSMFGQMSDLRALEEILKDKNITLIEDGAQSFGAS FT FKGEKSCSIAKISCTSFFPSKPLGAYGDGGAIFCHDDEIAKKIRILLNHGQTQRYKHEF FT IGINGRLDTLQAAILNVKLKYLEKELDKRQKLAQIYNANLKNCQIPQINPNAFSAYAQY FT SVLVEDRASVLRKFEKANIPYAIHYPTPLHKQPCFSEFSNLELKNSEYASEHILSLPFS FT PFLSEEEQEQVICIFKD" FT misc_feature complement(468445..469482) FT /note="HMMPfam hit to PF01041, DegT/DnrJ/EryC1/StrS FT aminotransferase, score 4.8e-130" FT /inference="protein motif:Pfam:PF01041" FT CDS 469627..472155 FT /transl_table=11 FT /gene="alaS" FT /locus_tag="Cj0506" FT /product="alanyl-tRNA synthetase" FT /EC_number="6.1.1.7" FT /note="Original (2000) note: Cj0506, alaS, alanyl-tRNA FT synthetase, len: 842 aa; similar to many e.g. SYA_ECOLI FT alanyl-tRNA synthetase (EC 6.1.1.7) (876 aa), fasta scores; FT opt: 1793 z-score: 2324.1 E(): 0, 47.9% identity in 870 aa FT overlap. 58.9% identity to HP1241. Contains PS00339 FT Aminoacyl-transfer RNA synthetases class-II signature 2" FT /note="Updated (2006) note: Pfam domains PF01411 tRNA FT synthetases class II (A) identified, PF07973 Threonyl and FT Alanyl tRNA synthetase second additional domain and PF02272 FT DHHA1 domain all within CDS. Further support given to FT product function. Characterised within Escherichia coli FT with acceptable identity score. Putative not added to FT product function. Functional classification - Aminoacyl FT tRNA synthetases and their modification" FT /note="PMID:6256345" FT /db_xref="GOA:Q9PI05" FT /db_xref="InterPro:IPR002318" FT /db_xref="InterPro:IPR003156" FT /db_xref="InterPro:IPR012947" FT /db_xref="InterPro:IPR018162" FT /db_xref="InterPro:IPR018163" FT /db_xref="InterPro:IPR018164" FT /db_xref="InterPro:IPR018165" FT /db_xref="InterPro:IPR023033" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI05" FT /inference="protein motif:Pfam:PF02272" FT /inference="protein motif:Pfam:PF07973" FT /inference="protein motif:Pfam:PF01411" FT /inference="protein motif:Prosite:PS00339" FT /protein_id="CAL34653.1" FT /translation="MDIRKAYLDFFASKGHEITPSSPLVPDDATLLFTNAGMVPFKSIF FT TGEIPRPNPPRKTSCQTCIRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEQAIA FT YAWEFVTEVLKLPKDRLYVTVHENDDEAFNLWQKHIQKERIYKFGDKDNFWQMGDTGPC FT GPCSEIFYDQGQEHFNSSEDYMGGDGDRFLEIWNLVFMQYERSADGVLSPLPKPSIDTG FT MGLERVTAIKEGKFSNFDSSLFMPIINEISKLCNKTYVYESGASFRVIADHIRSSVFLL FT AQGVSFDKEGRGYVLRRILRRALRHGYLLGFKQAFMYKLVDVVCDLMGGHYTYLNEKKD FT FIKEQIRLEEERFLSTIENGIEIFNEELKNTKEIFSGEVAFKLYDTYGFPLDLTADMLR FT EKNLKVDEEKFELFMNEQKARAKASWKGSGDKTASGDFKNLLEKFGENHFVGYEKAECE FT SKILALLDEDFKEVSTLKDAGWVMLENTPFYATSGGQSADSGFIAKREVLDTQKFFNLN FT LSFIKAGEELKVNDIVHARIDTEKREQIARHHSATHLLHHALREILGSHVSQAGSLVES FT NKLRFDFTHHKALNKEELESIEKRVNKMIINSSEAILENMPLEEAKKSGAIALFNEKYQ FT GNVRVLTLGESKELCGGTHVKNTAQIGSFYIVKESGVSAGVRRIEAVVSKAALEFVKNQ FT LEELSKVKDELKNNDILSGIKKLKNEILSLKNELKNSSKTELDSKNIQGVEICVKRIDN FT GDIKAMIDDFKNKFAKAVILLIQVKDEKITLAAGVKDVPLKAGALVKEAAQILGGNGGG FT RDDFATAGGKDLSKINEALKQSLETIEKAL" FT misc_feature 469630..471693 FT /note="HMMPfam hit to PF01411, tRNA synthetases class II FT (A), score 0" FT /inference="protein motif:Pfam:PF01411" FT misc_feature 470290..470319 FT /note="PS00339 Aminoacyl-transfer RNA synthetases class-II FT signature 2" FT /inference="protein motif:Prosite:PS00339" FT misc_feature 471928..472134 FT /note="HMMPfam hit to PF02272, DHHA1 domain, score 1.6e-16" FT /inference="protein motif:Pfam:PF02272" FT CDS 472155..472706 FT /transl_table=11 FT /gene="maf" FT /locus_tag="Cj0507" FT /product="Maf-like protein" FT /note="Original (2000) note: Cj0507, maf, maf homolog,len: FT 183 aa; similar to B. subtilis MAF_BACSU MAF protein FT (possibly involved in septum formation) (189 aa), fasta FT scores; opt: 236 z-score: 428.7 E(): 1.4e-16, 28.4% FT identity in 183 aa overlap. 36.5% identity to HP1240" FT /note="Updated (2006) note: Pfam domains PF02545 Maf-like FT protein all within CDS. Further support given to product FT function. No specific characterisation with acceptable FT identity score has been carried out yet. Product function FT changed from MAF homolog to Maf-like protein. Functional FT classification - Cell division" FT /note="PMID:8387996" FT /db_xref="GOA:Q9PI04" FT /db_xref="InterPro:IPR003697" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI04" FT /inference="protein motif:Pfam:PF02545" FT /protein_id="CAL34654.1" FT /translation="MLILASSSISRANLLKTAKIDFRQVSFDYDENLNKNISPFLYVQK FT IVLEKERQFLSTLGKDFQNQNLLFADSIVCIDEKILTKAKDKKEAYEMLALQNGKYASI FT LSAFLLVKPEKRVFSLSKTTLYFKNFDENALRDYVENDLYKGKAGCIMCEGFHQNFITQ FT QVGNLSTALGLDIQTLKAYL" FT misc_feature 472155..472703 FT /note="HMMPfam hit to PF02545, Maf-like protein, score FT 6e-22" FT /inference="protein motif:Pfam:PF02545" FT CDS 472703..474634 FT /transl_table=11 FT /gene="pbpA" FT /locus_tag="Cj0508" FT /product="penicillin-binding protein" FT /note="Original (2000) note: Cj0508, pbpA, probable FT penicillin-binding protein, len: 643 aa; similar to many FT e.g. PBPB_ECOLI penicillin-binding protein 1B (PBP-1B) (844 FT aa), fasta scores; opt: 774 z-score: 915.8 E(): 0,32.5% FT identity in 616 aa overlap. 48.0% identity to HP0597. Also FT similar to Cj0525c (22.9% identity in 407 aa overlap). FT Contains Pfam matches to entry PF00912 Transglycosyl, FT Transglycosylase, score 299.40, E-value 4.5e-86 and Pfam FT match to entry PF00905 Transpeptidase,Penicillin binding FT protein transpeptidase domain, score 103.80, E-value FT 3.3e-27" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity score. Putative not FT added to product function. Functional classification FT -Murein sacculus and peptidoglycan" FT /note="PMID:11181392, PMID:9841666, PMID:8335642" FT /db_xref="GOA:Q0PB07" FT /db_xref="InterPro:IPR001264" FT /db_xref="InterPro:IPR001460" FT /db_xref="InterPro:IPR011816" FT /db_xref="InterPro:IPR012338" FT /db_xref="UniProtKB/TrEMBL:Q0PB07" FT /inference="protein motif:Pfam:PF00905" FT /inference="protein motif:Pfam:PF00912" FT /protein_id="CAL34655.1" FT /translation="MKILKYIFSFFTLLFITGFIYVAYLFTSADTEGYTFKEYKPPLTT FT QIYDRNGKLVANIFEQHRFYAPYEELPPRLIEALVAIEDTSFFEHNGVNIDAIFRAAVK FT IIKSGGKTMEGASTLTQQFIKNTELTPERTIARKIREALLAYKMETILTKEQILERYLN FT FIFFGHGYYGVKTAALGYFHKNLNELSLKEIAMLVGMPKAPSSYDPTKHLDLSISRANN FT VISRMYNLGWISKADYDTAIKEIPQVYDDTLTQNAAPYVVDEVIKQLSPNIKDLKTGGY FT KIILNIDLDVQNMAQNALKFGYDEIVKRDKDANLSTLNGAMVVVNHQSGDVLALVGGVD FT YEKSNYNRATQSMRQPGSSFKPFVYQVAINLGYSPMSEIADISRIFEGGAGNNEDWKPK FT NEGGKFLGLITLKEALTRSRNLATINLALDMGLDVLYSKLMEFGFKDIPPNLSIVLGSF FT GISPLEYSKFYTMFGNYGTIKDPQIIRQVQDKTGKTIMEFNSNERKVSDEAQSFLVLDM FT MRNVVEKGTGRNARVKDIEIAGKTGTTNKSVDAWFCGLTPEIEAIIWYGNDNNKPMRYT FT EGGARTAAPVFREFLTQYIEKFPDTTRKFSIPNGVYRGNYKGESAYYTTKSPLPKANMK FT FNESEIIF" FT sig_peptide 472703..472789 FT /note="Signal peptide predicted for pbpA by SignalP 2.0 HMM FT (Signal peptide probability 0.979) with cleavage site FT probability 0.840 between residues 29 and 30" FT misc_feature 472721..472789 FT /note="1 probable transmembrane helix predicted for Cj0508 FT by TMHMM2.0 at aa 7-29" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 472835..473341 FT /note="HMMPfam hit to PF00912, Transglycosylase, score FT 2.2e-82" FT /inference="protein motif:Pfam:PF00912" FT misc_feature 473660..474478 FT /note="HMMPfam hit to PF00905, Penicillin binding protein FT transpeptid, score 1.1e-33" FT /inference="protein motif:Pfam:PF00905" FT CDS complement(474662..477235) FT /transl_table=11 FT /gene="clpB" FT /locus_tag="Cj0509c" FT /product="ATP-dependent Clp protease ATP-binding subunit" FT /note="Original (2000) note: Cj0509c, clpB, ATP-dependent FT CLP protease ATP-binding subunit, len: 857 aa; 98.9% FT identical to C. jejuni TR:O69287 (EMBL:Y13333) and similar FT to many e.g. CLAA_LYCES ATP-dependent CLP protease FT ATP-binding subunit (926 aa), fasta scores; opt: 1130 FT z-score: 2439.8 E(): 0, 45.0% identity in 845 aa overlap. FT 61.2% identity to HP0264. Also simlar to C. jejuni clpA FT (Cj1108); 36.6% identity in 836 aa overlap. Contains 2x FT PS00017 ATP/GTP-binding site motif A (P-loop), PS00870 and FT PS00871 Chaperonins clpA/B signatures 1 and 2, and Pfam FT match to entry PF00495 clpA_B, Chaperonins clpA/B, score FT 1257.60, E-value 0" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Putative not added to product FT function. Functional classification - FT Chaperones,chaperonins, heat shock" FT /note="PMID:10196475" FT /db_xref="GOA:Q9PI02" FT /db_xref="InterPro:IPR001270" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR003959" FT /db_xref="InterPro:IPR004176" FT /db_xref="InterPro:IPR013093" FT /db_xref="InterPro:IPR018368" FT /db_xref="InterPro:IPR019489" FT /db_xref="InterPro:IPR023150" FT /db_xref="UniProtKB/Swiss-Prot:Q9PI02" FT /inference="protein motif:Pfam:PF00495" FT /inference="protein motif:Prosite:PS00871" FT /inference="protein motif:Prosite:PS00870" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34656.1" FT /translation="MANIQDFLTDNMLSNLESAASLAIHSKNNEVVPLHLLWALSVDST FT SILNQILNKLNISKEALELEIKSRISKLATSSNVNRENIRFSNELINSLENAKGLMSAN FT GDSYLSVDTWLISESQKSPIKEILAQFLDLREFQKELESLRAGRKMDSKTSDETLDSLN FT KFGIDLTLKASEGKLDPVIGREEEIERLMQILIRKTKNNPILLGEPGVGKTAIVEALAQ FT RIIKKDVPKSLQNKKVIALDMSALIAGAKYRGEFEDRLKAVVNEVIKSENIILFIDEIH FT TIVGAGASEGSMDAANILKPALARGELHTIGATTLKEYRKYFEKDAALQRRFQPVNVGE FT PSVNEALAMLRGIKEKLEIHHNVTINDSALVAAAKLSKRYIADRFLPDKAIDLIDEAAA FT ELKMQIESEPSSLRKVRKDIETLEVENEALKMENDEKNQKRLDEIAKELANLKEKQNAL FT NSQFENEKSVFDGISAKKKEIDLLKNEASLAKARGEFQKAAELEYGKIPSLEKEVEILE FT DKWKKMSENGVLLKNQVDEDLVAGILSKWTGISVQKMLTSEKQKFLEVEKHLKESVIGQ FT DKALSALARAIKRNKAGLNADNKPIGSFLFLGPTGVGKTQSAKALAKFLFDDEKAMIRF FT DMSEFMEKHSVSRLLGAPPGYIGHEEGGELTEAVRRKPYSVLLFDEVEKAHKDVFNVLL FT GILDDGRATDSKGVTVDFKNTIIILTSNIASNAIMNLSGKEQEDAVKNELKNFFKPEFL FT NRLDDIITFNPLGKDEAYEIVKLLFKDLQMSLENKGIKASLSENAALLIAKDGFDPDFG FT ARPLRRAIYDLIEDKLSDMILADELHENDSIIIDAKDDEIIIKKA" FT misc_feature complement(474785..475429) FT /note="HMMPfam hit to PF00004, ATPase family associated FT with various cellul, score 5.2e-05" FT /inference="protein motif:Pfam:PF00004" FT misc_feature complement(474959..475441) FT /note="HMMPfam hit to PF07724, ATPase family associated FT with various cellul, score 3.2e-102" FT /inference="protein motif:Pfam:PF07724" FT misc_feature complement(475280..475336) FT /note="PS00871 Chaperonins clpA/B signature 2" FT /inference="protein motif:Prosite:PS00871" FT misc_feature complement(475391..475414) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature complement(476051..476632) FT /note="HMMPfam hit to PF00004, ATPase family associated FT with various cellul, score 7.4e-21" FT /inference="protein motif:Pfam:PF00004" FT misc_feature complement(476318..476356) FT /note="PS00870 Chaperonins clpA/B signature 1" FT /inference="protein motif:Prosite:PS00870" FT misc_feature complement(476594..476617) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature complement(476798..476947) FT /note="HMMPfam hit to PF02861, Clp amino terminal FT domain,score 0.0056" FT /inference="protein motif:Pfam:PF02861" FT misc_feature complement(477023..477181) FT /note="HMMPfam hit to PF02861, Clp amino terminal FT domain,score 6.5e-11" FT /inference="protein motif:Pfam:PF02861" FT CDS complement(477347..477637) FT /transl_table=11 FT /locus_tag="Cj0510c" FT /product="conserved hypothetical protein Cj0510c" FT /note="Original (2000) note: Cj0510c, unknown, len: 96 aa; FT similar to hypothetical proteins e.g. TR:O32222 FT (EMBL:Z99121) B. subtilis YVGZ protein (101 aa), fasta FT scores; opt: 212 z-score: 338.9 E(): 1.4e-11, 40.0% FT identity in 95 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF02583 FT Uncharacterised BCR, COG1937 identified within CDS. FT Conserved added to product function. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="InterPro:IPR003735" FT /db_xref="UniProtKB/TrEMBL:Q0PB05" FT /inference="protein motif:Pfam:PF02583" FT /protein_id="CAL34657.1" FT /translation="MCQEKHTHTHSQKHLKAVCNRLSRTIGHLSAIKRMVENDKDCSEI FT LIQLAAVKAEVNNTAKVVLKEHLAHCMVHAVEENDIQSIEELNKAIDMFMK" FT misc_feature complement(477353..477535) FT /note="HMMPfam hit to PF02583, Uncharacterised BCR,COG1937, FT score 2.1e-17" FT /inference="protein motif:Pfam:PF02583" FT CDS 477755..479089 FT /transl_table=11 FT /locus_tag="Cj0511" FT /product="putative secreted protease" FT /note="Original (2000) note: Cj0511, probable secreted FT protease, len: 444 aa; similar to many e.g. PRC_ECOLI FT tail-specific protease precursor (682 aa), fasta scores; FT opt: 357 z-score: 500.2 E(): 1.4e-20, 29.9% identity in 388 FT aa overlap. 54.3% identity to HP1350. Contains possible FT N-terminal signal sequence and Pfam match to entry PF00595 FT PDZ, PDZ domain (Also known as DHR or GLGF)., score 52.00, FT E-value 1.3e-11" FT /note="Updated (2006) note: Pfam domain PF03572 Peptidase FT family S41 identified within CDS. Further support given to FT product function. Characterised within Escherichia coli FT with marginal identity score. Putative kept within product FT function. Paper identified linking protein to glycoprotein FT (PMID:12186869). Functional classification - Protein FT translation and modification" FT /note="PMID:8576225, PMID:12186869" FT /db_xref="GOA:Q0PB04" FT /db_xref="InterPro:IPR001478" FT /db_xref="InterPro:IPR004447" FT /db_xref="InterPro:IPR005151" FT /db_xref="UniProtKB/TrEMBL:Q0PB04" FT /inference="protein motif:Pfam:PF03572" FT /inference="protein motif:Pfam:PF00595" FT /protein_id="CAL34658.1" FT /translation="MMELILKTKRFFAGLAGFATTFILCLFLTSHLQAKVDQKEEQVQK FT RLEALDKLTKTLAIVEQYYVDDQNISDLVDKSLSGLLSNLDAHSSFLNEKDFNDMKIQT FT NGEFGGLGITVGMKDGALTVVSPIEGTPADKAGIKSGDIILKINDEATLGINLNDAVDK FT MRGKPKTQITLTIFRKGATKPFDVTLTREIIKIESVYAKMIENENILYLRVTNFDKNVV FT DVASKELKKYPNVKGVILDLRNNPGGLLNQAIGLVNLFVDKGVIVSQKGRIASENQEYK FT ADPKNKISNASLVVLVNGGSASASEIVSGALQDLKRGVIVGENTFGKGSVQQIIPINKT FT EALRLTIARYYLPSGRTIQAVGVKPDIEVFPGKVNTQEDGFSIKESDLKQHLESELEKI FT DKNKKEDKQENKDNKNLISQKQINDDAQLKSAIDTIKILNIKQGQ" FT sig_peptide 477755..477856 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000237_477755_479089 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.600 between residues 34 and 35" FT misc_feature 477788..477856 FT /note="1 probable transmembrane helix predicted for Cj0511 FT by TMHMM2.0 at aa 12-34" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 478049..478285 FT /note="HMMPfam hit to PF00595, PDZ domain (Also known as FT DHR or GLGF), score 1.9e-11" FT /inference="protein motif:Pfam:PF00595" FT misc_feature 478376..478861 FT /note="HMMPfam hit to PF03572, Peptidase family S41, score FT 7.9e-76" FT /inference="protein motif:Pfam:PF03572" FT CDS 479091..479801 FT /transl_table=11 FT /gene="purC" FT /locus_tag="Cj0512" FT /product="phosphoribosylaminoimidazole-succinocarboxamide FT synthase" FT /EC_number="6.3.2.6" FT /note="Original (2000) note: Cj0512, purC, probable FT phosphoribosylaminoimidazole-succinocarboxamide FT synthase,len: 236 aa; highly similar to many e.g. FT PUR7_BACSU phosphoribosylaminoimidazole-succinocarboxamide FT synthase (EC 6.3.2.6) (241 aa), fasta scores; opt: 821 FT z-score: 1330.0 E(): 0, 53.0% identity in 234 aa overlap. FT No Hp match. Contains PS01057 SAICAR synthetase signature 1 FT and Pfam match to entry PF01259 SAICAR_synt, SAICAR FT synthetase, score 311.00, E-value 1.5e-89" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Purine FT ribonucleotide biosynthesis" FT /note="PMID:2495272, PMID:10071207" FT /db_xref="GOA:Q9PHZ9" FT /db_xref="InterPro:IPR001636" FT /db_xref="InterPro:IPR013816" FT /db_xref="InterPro:IPR018236" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHZ9" FT /inference="protein motif:Pfam:PF01259" FT /inference="protein motif:Prosite:PS01057" FT /protein_id="CAL34659.1" FT /translation="MTKKEMLYEGKGKKLFKTDDENLLISEFKDDLTAFNAEKRGNESG FT KGALNCKISTEIFHLLEKNGIKTHLVEIISDTEQVVKKCKIVPIEVIVRNVATGSLTKR FT LGIKDGTVLPFALVEFCLKDDALGDPFINDEHCLILNLVQNEAQISEIKNMARKINSIL FT TPFFDNKNLRLIDFKIELGLTKDNELVLADEISPDSCRFWDKFSNEKLDKDRFRQDLGN FT VKMAYEEVLKRILN" FT misc_feature 479097..479795 FT /note="HMMPfam hit to PF01259, SAICAR synthetase, score FT 1.6e-90" FT /inference="protein motif:Pfam:PF01259" FT misc_feature 479346..479390 FT /note="PS01057 SAICAR synthetase signature 1" FT /inference="protein motif:Prosite:PS01057" FT CDS 479810..480055 FT /transl_table=11 FT /gene="purS" FT /locus_tag="Cj0513" FT /product="phosphoribosylformylglycinamidine (FGAM) FT synthase" FT /note="Original (2000) note: Cj0513, unknown, len: 81 aa; FT similar to many e.g. YEXA_BACSU hypothetical 9.7 kd protein FT in PURC-PURL intergenic region (84 aa), fasta scores; opt: FT 248 z-score: 331.6 E(): 3.6e-11, 48.1% identity in 79 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF02700 FT Phosphoribosylformylglycinamidine (FGAM) synthase FT identified within CDS. Product function modified to new FT function based on motif match. Characterisation work FT carried out within Bacillus subtilis with acceptable FT identity score. Putative not added to product function. FT Functional classification - Purine ribonucleotide FT biosynthesis" FT /note="PMID:15301532, PMID:10071207" FT /db_xref="GOA:Q0PB02" FT /db_xref="InterPro:IPR003850" FT /db_xref="UniProtKB/TrEMBL:Q0PB02" FT /inference="protein motif:Pfam:PF02700" FT /protein_id="CAL34660.1" FT /translation="MEVIVNISLKNGVLDPQGKAVEKALHSLNFNSVKEVKIAKQIKIS FT LDEKDEKLAKEQVKKMCEELLVNSVIEDYELIIEKE" FT misc_feature 479810..480049 FT /note="HMMPfam hit to FT PF02700,Phosphoribosylformylglycinamidine (FGAM) syn, score FT 1.3e-31" FT /inference="protein motif:Pfam:PF02700" FT CDS 480057..480728 FT /transl_table=11 FT /gene="purQ" FT /locus_tag="Cj0514" FT /product="phosphoribosylformylglycinamidine synthase I" FT /EC_number="6.3.5.3" FT /note="Original (2000) note: Cj0514, purQ, probable FT phosphoribosylformylglycinamidine synthase I, len: 223 aa; FT PURQ_BACSU phosphoribosylformylglycinamidine synthase I (EC FT 6.3.5.3) (227 aa), fasta scores; opt: 701 z-score: 1168.8 FT E(): 0, 47.7% identity in 216 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF07685 FT CobB/CobQ-like glutamine amidotransferase domain and FT PF01965 DJ-1/PfpI family identified within CDS. Further FT support given to product function. Characterised within FT Bacillus subtilis with acceptable identity score. Putative FT not added to product function. Functional classification FT -Purine ribonucleotide biosynthesis" FT /note="PMID:2495272, PMID:10784038, PMID:10071207" FT /db_xref="GOA:Q9PHZ7" FT /db_xref="InterPro:IPR010075" FT /db_xref="InterPro:IPR011698" FT /db_xref="InterPro:IPR017926" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHZ7" FT /inference="protein motif:Pfam:PF01965" FT /inference="protein motif:Pfam:PF07685" FT /protein_id="CAL34661.1" FT /translation="MKVAIIRFPGTNCEFDTTYAFEKLGVKTQIVWHEEKEFDADLVVL FT PGGFSYGDYLRCAAIAKLAPAMQGVFNHAKKGGYILGICNGFQILLESGLLKGAMKHNN FT NLSFISKNQSLRVVSNDNAFLKNFKKDEIINLPIAHGEGNYYADETTLKELQDKDLIIL FT KYEPNPNGSVFDIAGICDENKKIFGLMPHPERACEKVLGNDVGLKMLKGFLLENFINFN FT F" FT misc_feature 480156..480647 FT /note="HMMPfam hit to PF07685, CobB/CobQ-like glutamine FT amidotransferase do, score 0.002" FT /inference="protein motif:Pfam:PF07685" FT CDS 480700..481896 FT /transl_table=11 FT /locus_tag="Cj0515" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0515, possible periplasmic FT protein, len: 398 aa; 27.2% identity to HP1349" FT /note="Updated (2006) note: One probable transmembrane FT helices predicted by TMHMM2.0 within CDS. Functional FT classification - Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PB00" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34662.1" FT /translation="MKILLTLIFSIVVLFGRGEISVFSGQDENMQKELQKLPQEEQKIY FT QNIPPSDENNDFESNVDDPFVAKGSLVLTNDEYPSRVYVGEVFPITIYARTTENIKFDF FT NISVEKTNLSFLNPDAKWEFINNEYKTTLWFEAKNSNASLSKISIKLLRNNEAFQEADI FT NLNPIKFENTLFNKDFSHLVASSLEIKKVKASYFDDANIIMMIELNATNTNLKSFFIEG FT IQKQGIENLKGDFNASSAFYYAILPLSKTNFEFSYFNKDSKKLENINLKLKISDDEIST FT QSDLNPVNKDLNIYKQYALWFLAVLFGVLFVWRKNYIILALAVVCFALSFLVDTNTQNA FT IIKAGSRAKILPTEPSTYFYTANADEKVEVLGKRQNYIKVLFSDGKIGWVNKDDLQKN" FT sig_peptide 480700..480774 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000238_480700_481896 by SignalP 2.0 FT HMM (Signal peptide probability 0.726) with cleavage site FT probability 0.407 between residues 25 and 26" FT misc_feature 481630..481698 FT /note="1 probable transmembrane helix predicted for Cj0515 FT by TMHMM2.0 at aa 311-333" FT /inference="protein motif:TMHMM:2.0" FT CDS 481877..482569 FT /transl_table=11 FT /gene="plsC" FT /locus_tag="Cj0516" FT /product="putative 1-acyl-SN-glycerol-3-phosphate FT acyltransferase" FT /EC_number="2.3.1.51" FT /note="Original (2000) note: Cj0516, plsC, possible FT 1-acyl-SN-glycerol-3-phosphate acyltransferase, len: 230 FT aa; similar to e.g. PLCB_HUMAN FT 1-acyl-SN-glycerol-3-phosphate acyltransferase (EC FT 2.3.1.51) (278 aa), fasta scores; opt: 227 z-score: 328.0 FT E(): 5.7e-11, 25.7% identity in 210 aa overlap. 38.4% FT identity to HP1348" FT /note="Updated (2006) note: Pfam domain PF01553 FT Acyltransferase along with Prosite domains PS50239 FT GLYCEROL_ACYLTRANS, Phospholipid/glycerol acyltransferase FT and PS00989 CLAT_ADAPTOR_S, Clathrin adaptor complex,small FT chain were all identified within CDS. Further support given FT to product function. No specific characterisation with FT acceptable identity scores carried out yet. Putative kept FT within product function. Functional classification - FT Synthesis and modification of macromolecules - FT Phospholipids" FT /note="PMID:1557036" FT /db_xref="GOA:Q0PAZ9" FT /db_xref="InterPro:IPR002123" FT /db_xref="InterPro:IPR004552" FT /db_xref="UniProtKB/TrEMBL:Q0PAZ9" FT /inference="protein motif:Pfam:PF01553" FT /inference="protein motif:Prosite:PS00989" FT /inference="protein motif:Prosite:PS50239" FT /protein_id="CAL34663.1" FT /translation="MIYKKIKALYFWIFFVLSVALVIFCFCFTKSQNTLWKIRKIWAKF FT QRYTISYKQEIIGTFNPQAQMILMNHQSALDIIALEELYPKNLCWIAKKELGEIPIFKV FT AMKKPKLLCIDRKNPRDLVRVLKEAKERISEDRVLAIFPEGTRSKNEKMLKFQSGAKIL FT SEKLNLKVQPILIVDSAKILDTKSFSASSGVLKIICMDLVDTNDEKWLENTRKKMQELL FT DQERAKLC" FT misc_feature 481877..481909 FT /note="PS00989 Clathrin adaptor complexes small chain FT signature" FT /inference="protein motif:Prosite:PS00989" FT sig_peptide 481877..481969 FT /note="Signal peptide predicted for plsC by SignalP 2.0 HMM FT (Signal peptide probability 0.913) with cleavage site FT probability 0.624 between residues 31 and 32" FT misc_feature 481904..481963 FT /note="1 probable transmembrane helix predicted for Cj0516 FT by TMHMM2.0 at aa 10-29" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 482033..482407 FT /note="HMMPfam hit to PF01553, Acyltransferase, score FT 1.4e-22" FT /inference="protein motif:Pfam:PF01553" FT CDS 482563..482931 FT /transl_table=11 FT /gene="crcB" FT /locus_tag="Cj0517" FT /product="CrcB protein homolog" FT /note="Original (2000) note: Cj0517, crcB, probable FT integral membrane protein, len: 122 aa; similar to e.g. FT CRCB_ECOLI CRCB protein (127 aa), fasta scores; opt: 245 FT z-score: 278.4 E(): 3.2e-08, 37.9% identity in 124 aa FT overlap. 33.9% identity to HP1225" FT /note="Updated (2006) note: Pfam domain PF02537 CrcB-like FT protein identified within CDS. Four probable transmembrane FT helices predicted by TMHMM2.0 within CDS. Further support FT given to product function. Functional classification FT -Membranes, lipoproteins and porins" FT /note="PMID:2904550" FT /db_xref="GOA:Q9PHZ4" FT /db_xref="InterPro:IPR003691" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHZ4" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02537" FT /protein_id="CAL34664.1" FT /translation="MLNTLLVVGFGGFIGAILRMLSINLVNKFFPYSISFGTLFVNVLG FT SFIIGLLFSYAQNKGLSPLLKSFISTGFLGAFTTFSTFSYQNLLLLQSGNYLHFALNII FT LNVFLCLFAAWLGFLIFK" FT misc_feature 482575..482925 FT /note="HMMPfam hit to PF02537, CrcB-like protein, score FT 4e-29" FT /inference="protein motif:Pfam:PF02537" FT misc_feature order(482575..482631,482659..482727,482746..482814, FT 482857..482925) FT /note="4 probable transmembrane helices predicted for FT Cj0517 by TMHMM2.0 at aa 5-23, 33-55, 62-84 and 99-121" FT /inference="protein motif:TMHMM:2.0" FT CDS 483003..484829 FT /transl_table=11 FT /gene="htpG" FT /locus_tag="Cj0518" FT /product="hsp90 family heat shock protein" FT /note="Original (2000) note: Cj0518, htpG, probable hsp90 FT family heat shock protein, len: 608 aa; highly similar to FT many e.g. HTPG_ECOLI heat shock protein htpG (624 aa),fasta FT scores; opt: 1500 z-score: 1959.7 E(): 0, 44.1% identity in FT 621 aa overlap. 54.3% identity to HP0210. Contains PS00298 FT Heat shock hsp90 proteins family signature, and Pfam match FT to entry PF00183 HSP90, Heat shock hsp90 proteins, score FT 685.80, E-value 2.1e-202" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Chaperones, chaperonins, heat shock" FT /note="PMID:2647735" FT /db_xref="GOA:Q9PHZ3" FT /db_xref="InterPro:IPR001404" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR019805" FT /db_xref="InterPro:IPR020568" FT /db_xref="InterPro:IPR020575" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHZ3" FT /inference="protein motif:Pfam:PF00183" FT /inference="protein motif:Prosite:PS00298" FT /protein_id="CAL34665.1" FT /translation="MQFQTEVNQLLQLMIHSLYSNKEIFLRELISNASDALDKLNFLSV FT SDDKYKSLKFEPKIEIKIDKDKKTLSISDNGIGMDKDDLINNLGTIAKSGTKSFLENLS FT GDAKKDSQLIGQFGVGFYSAFMVASKIEVLSKKALDDKAYLWSSDANGYEIDDANKEEQ FT GTSITLYLKDDEFANAYKIESIIEKYSNHIQFPIFMEKEEFTPAKEGEEEGKTELKISQ FT INKANALWRMQKSSLKAEDYERFYEQNFHDSNKPLLYLHTKSEGKLEYNSLFFIPQNAP FT FDLFRVDYQSGLKLYVKRVFISDDDKELLPTYLRFVRGIIDVEDLPLNVSREILQENQI FT LKGIKEASVKKILGELEKLKNNDKEKYLSFFKTFGKVLKEGLYGFGGEKDSLLKLMLYK FT STKGENLRSLEEYKNDLQGEQKEIFYIAGNNESLLRTSPLLEEYKQKNIEVLLMDDEID FT SLVTPMLEFEGLKFVSINQVEDKNELSDEEKNTFAPLVAKFKELLKDQVEDVRLTSRLK FT DSPSCIVYDKNKPDFAMQQLLKQMGQEQNFKPILEINPKHAIFTGLKNNESFSADIATL FT VLNMAKLSEGMGVDNPAEFNASLTKIINKAFS" FT misc_feature 483057..483086 FT /note="PS00298 Heat shock hsp90 proteins family signature" FT /inference="protein motif:Prosite:PS00298" FT misc_feature 483063..483524 FT /note="HMMPfam hit to PF02518, Histidine kinase-, DNA FT gyrase B-, and HSP90, score 6.5e-13" FT /inference="protein motif:Pfam:PF02518" FT misc_feature 483525..484826 FT /note="HMMPfam hit to PF00183, Hsp90 protein, score FT 2.7e-29" FT /inference="protein motif:Pfam:PF00183" FT CDS 484826..485143 FT /transl_table=11 FT /locus_tag="Cj0519" FT /product="putative rhodanese-like domain protein" FT /note="Original (2000) note: Cj0519, unknown, len: 105 aa; FT similar to hypothetical proteins e.g. TR:E1342888 FT (EMBL:AJ235272) Rickettsia prowazekii RP600 (123 aa),fasta FT scores; opt: 151 z-score: 214.9 E(): 0.00011, 41.6% FT identity in 89 aa overlap. 34.3% identity to HP1223" FT /note="Updated (2006) note: Prosite domain PS50206 FT RHODANESE_3, Rhodanese domain profile also identified FT within CDS. Rhodanese, a sulphurtransferase involved in FT cyanide detoxification shares evolutionary relationship FT with a large family of proteins. This domain is found as a FT single copy in other proteins, including phosphatases and FT ubiquitin C-terminal hydrolases. Product modified to new FT function based on motif identification. No specific FT characterisation has been carried out yet, so putative kept FT within product function. Functional classification -Misc" FT /db_xref="InterPro:IPR001763" FT /db_xref="UniProtKB/TrEMBL:Q0PAZ6" FT /inference="protein motif:Prosite:PS50206" FT /protein_id="CAL34666.1" FT /translation="MIENISASLWTKQDLNAYQIFDVRTPLEWEEGILPNAQCVALYDN FT QGLLNAKFLDEFQSKRDESKKLAFICRSGHRSMVAAEFIAEKLGLESINLDGGMLALKG FT C" FT CDS 485143..485577 FT /transl_table=11 FT /locus_tag="Cj0520" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0520, possible membrane FT protein, len: 144 aa; no Hp match. Contains one possible FT transmembrane domain at N-terminus. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PAZ5" FT /protein_id="CAL34667.1" FT /translation="MLGIYLLIAALSFLALYFAVKKLTLNIDERTLLEPIKMDIYPKFC FT DLIDEKIREFKENIQNANLTLKNSNQKDEFLEKLGDLSRELTFIQTMNLSNKNDSIWQN FT ELFSFLKELENLLLEYLEKGEEEAENLREFLMDEFEKLKG" FT misc_feature 485146..485202 FT /note="1 probable transmembrane helix predicted for Cj0520 FT by TMHMM2.0 at aa 2-20" FT /inference="protein motif:TMHMM:2.0" FT CDS 485698..486201 FT /transl_table=11 FT /locus_tag="Cj0522" FT /product="putative Na+/Pi cotransporter protein" FT /note="Original (2000) note: Cj0522, possible membrane FT protein, len: 167 aa; no Hp match. May be fragment of FT pseudogene" FT /note="Updated (2006) note: Pfam domain PF02690 FT Na+/Pi-cotransporter identified within CDS. Three probable FT transmembrane helices predicted by TMHMM2.0. Product FT modified to more specific family member due to motif match. FT No specific characterisation has been carried out yet. FT Putative kept within product function. Functional FT classification - Transport/binding proteins - Cations" FT /db_xref="GOA:Q0PAZ4" FT /db_xref="InterPro:IPR003841" FT /db_xref="UniProtKB/TrEMBL:Q0PAZ4" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02690" FT /protein_id="CAL34668.1" FT /translation="MAILLIGMTNLGIGFKVFSGDLLEKILVKSTDTKIKSILFGTLST FT LIMQFSILVSIVTISFLSAGLISLGAGIGIIFGVNLGNTASSWLIVGLTNIKILMLAIP FT LLIIGVLFFFQKDSILKGLGNIFIGIGFFFLGVDYIKSGFENFKHIIDLSRFDFAGFKG FT VFVF" FT misc_feature 485704..486186 FT /note="HMMPfam hit to PF02690, Na+/Pi-cotransporter, score FT 2.1e-06" FT /inference="protein motif:Pfam:PF02690" FT misc_feature order(485866..485934,485962..486030,486049..486117) FT /note="3 probable transmembrane helices predicted for FT Cj0522 by TMHMM2.0 at aa 57-79, 89-111 and 118-140" FT /inference="protein motif:TMHMM:2.0" FT CDS 486213..486488 FT /transl_table=11 FT /locus_tag="Cj0523" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0523, possible membrane FT protein, len: 91 aa; no Hp match. May be fragment of FT pseudogene" FT /note="Updated (2006) note: Three probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PAZ3" FT /db_xref="InterPro:IPR003841" FT /db_xref="UniProtKB/TrEMBL:Q0PAZ3" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34669.1" FT /translation="MLTGVIQSSTVIMAIIVAALLAQQISLENSLAATLGTSVGGVVTA FT VLASLSTNIEGKKLAFANCIFNFGIAFLIVLIFPYFIHFLIFYPLR" FT sig_peptide 486213..486308 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000242_486213_486488 by SignalP 2.0 FT HMM (Signal peptide probability 0.993) with cleavage site FT probability 0.706 between residues 32 and 33" FT misc_feature order(486225..486293,486303..486371,486405..486473) FT /note="3 probable transmembrane helices predicted for FT Cj0523 by TMHMM2.0 at aa 5-27, 31-53 and 65-87" FT /inference="protein motif:TMHMM:2.0" FT CDS 486642..487343 FT /transl_table=11 FT /locus_tag="Cj0524" FT /product="hypothetical protein Cj0524" FT /note="Original (2000) note: Cj0524, unknown, len: 233 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins and cotransporter family proteins from other FT bacteria. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAZ2" FT /protein_id="CAL34670.1" FT /translation="MISLVKFSDTAIEALRKESEHLYNNTYAVVAHAIGFSRKDIQSDK FT SFKEILENKKWFSKNVDLDYLYQTRIKVLFEAIIDFSTKAQVYINDETKNHKIFTFKMA FT AKNLAETTKNLKIIQANIKKYSSSSNEFLALEYNKIRSNLGELLRSIEELRVVEDREKL FT YLIIKNLQKGKEILKEIDTLTLSNVEHLISVRKITTAEGISILNDTTFAAKIAEELIGA FT VEVIFSKDISN" FT CDS complement(487340..489148) FT /transl_table=11 FT /gene="pbpB" FT /locus_tag="Cj0525c" FT /product="putative penicillin-binding protein" FT /note="Original (2000) note: Cj0525c, pbpB, probable FT penicillin-binding protein, len: 602 aa; similar to many FT e.g. PBP2_NEIME penicillin-binding protein 2 (581 aa),fasta FT scores; opt: 184 z-score: 511.3 E(): 3.5e-21. 28.9% FT identity in 443 aa overlap. 35.8% identity to HP1556 FT (misannotated as cell division protein (ftsI)). Also FT similar to Cj0508 (22.6% identity in 407 aa overlap). FT Contains PS00017 ATP/GTP-binding site motif A (P-loop),Pfam FT match to entry PF00905 Transpeptidase, Penicillin binding FT protein transpeptidase domain, score 259.30,E-value 5.2e-74 FT and N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF03717 FT Penicillin-binding Protein dimerisation domain identified FT within CDS. Further support given to product function. FT Characterised in Bacillus subtilis with marginal identity FT score. Putative kept within product function. Functional FT classification - Murein sacculus and peptidoglycan" FT /note="PMID:8244929, PMID:8289242" FT /db_xref="GOA:Q0PAZ1" FT /db_xref="InterPro:IPR001460" FT /db_xref="InterPro:IPR005311" FT /db_xref="InterPro:IPR012338" FT /db_xref="UniProtKB/TrEMBL:Q0PAZ1" FT /inference="protein motif:Pfam:PF03717" FT /inference="protein motif:Pfam:PF00905" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34671.1" FT /translation="MQEYKKNRVSKVAFAYCMALLFMIIFISSTFFLTSKRHIPNTEKD FT QYALALRGSIITKDNFTITSSKQIYRAEIDLRSINKDKFDLFLKLFQIYSGISNDQVAD FT IKKRMQNQKKRSYNFVLLQNLDSKQASYLKDLAKKLYIQGFFKAFTNNSGRVETRGLNI FT IEHEEDRIYMSKDSFTPIIGYTKMILDPESGILKNIGVKGLEKYYDACLSPVQNEKIQG FT LKDIGGNIILNLNSLQQKKINGCDLYLNLSLKLQKSIEKAIDQRNEDLKANEIIVGVME FT SKTGRILALASSRRYDPQNRGKDLSVLNASAIEYGYEAGSVIKPFIFTTALRLGKIKMD FT EVINTYGGSYKLGRFTIKDDHKMDKMTMEEVIRYSSNIGMIQIAKRLNNIEIVSGLKIF FT KFGEKSGIDLPYEQKGEIPNPKRLRDIEKSVLSYGYGLKTTFIQLLAAYNVFNNDGFYI FT TPRLAEKFYQNGRFTNLDDDVKKEKILSSEAAKTMQNVLINVIEKGTGKKAITQGIIAG FT GKTGTARIAERQGYTSNRYNASFFGFANDLNHAYTIGVLVRHPTKPYSYYAAQSALPMF FT KDVVDILINEEFLTPIQDNNQTSTNN" FT misc_feature complement(487406..488326) FT /note="HMMPfam hit to PF00905, Penicillin binding protein FT transpeptid, score 2e-66" FT /inference="protein motif:Pfam:PF00905" FT misc_feature complement(487589..487612) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature complement(488444..489010) FT /note="HMMPfam hit to PF03717, Penicillin-binding Protein FT dimerisatio, score 6.6e-30" FT /inference="protein motif:Pfam:PF03717" FT misc_feature complement(489047..489115) FT /note="1 probable transmembrane helix predicted for Cj0525c FT by TMHMM2.0 at aa 12-34" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(489050..489148) FT /note="Signal peptide predicted for pbpB by SignalP 2.0 HMM FT (Signal peptide probability 0.882) with cleavage site FT probability 0.560 between residues 33 and 34" FT CDS complement(489155..489451) FT /transl_table=11 FT /gene="fliE" FT /locus_tag="Cj0526c" FT /product="flagellar hook-basal body complex protein" FT /note="Original (2000) note: Cj0526c, fliE, probable FT flagellar hook-basal body complex protein, len: 98 aa; FT similar to e.g. FLIE_BACSU flagellar hook-basal body FT complex protein (106 aa), fasta scores; opt: 182 z-score: FT 262.0 E(): 2.7e-07 34.0% identity in 97 aa overlap. 60.9% FT identity to HP1557" FT /note="Updated (2006) note: Pfam domain PF02049 Flagellar FT hook-basal body complex protein FliE identified within CDS. FT These genes form proteins that are thought be involved in FT bacterial flagellar assembly. FliE is said to form part of FT the hook-basal body complex of bacterial flagellar. The FT FlgB, FlgC and FlgG proteins are components of the proximal FT and distal rods; FliF forms the M-ring that anchors the rod FT assembly to the membrane. Characterised within Bacillus FT subtilis with marginal identity score. Putative was removed FT from product function. Functional classification - Surface FT structures" FT /note="PMID:1905667, PMID:1551848" FT /db_xref="GOA:Q9PHY8" FT /db_xref="InterPro:IPR001624" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHY8" FT /inference="protein motif:Pfam:PF02049" FT /protein_id="CAL34672.1" FT /translation="MNNINDLRLNNNISNTNKSQNSTGIGDEFAKMLKNEINDLNKAQE FT SGEAAMTDIATGQVKDLHQAAIAITKAESSMKFMLEVRNKAISAYKEITRTQI" FT misc_feature complement(489158..489439) FT /note="HMMPfam hit to PF02049, Flagellar hook-basal body FT complex protein Fl, score 4.3e-22" FT /inference="protein motif:Pfam:PF02049" FT CDS complement(489458..489952) FT /transl_table=11 FT /gene="flgC" FT /locus_tag="Cj0527c" FT /product="flagellar basal-body rod protein" FT /note="Original (2000) note: Cj0527c, flgC, probable FT flagellar basal-body rod protein, len: 164 aa; similar to FT many e.g. FLGC_BACSU flagellar basal-body rod protein (150 FT aa), fasta scores; opt: 259 z-score: 521.0 E(): 1e-21,39.5% FT identity in 167 aa overlap. 67.1% identity to HP1558. FT Contains PS00588 Flagella basal body rod proteins signature FT and Pfam match to entry PF00460 flg_bb_rod,Flagella basal FT body rod proteins score 34.50, E-value 3e-07" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Surface FT structures" FT /note="PMID:1905667" FT /db_xref="GOA:Q0PAY9" FT /db_xref="InterPro:IPR001444" FT /db_xref="InterPro:IPR006299" FT /db_xref="InterPro:IPR010930" FT /db_xref="InterPro:IPR019776" FT /db_xref="UniProtKB/TrEMBL:Q0PAY9" FT /inference="protein motif:Pfam:PF00460" FT /inference="protein motif:Prosite:PS00588" FT /protein_id="CAL34673.1" FT /translation="MAYLSDFDISGYGLSAQRFRMNVISSNIANANTTRTAEGGPYRRR FT EVIFKATDFDKLLNEQINKDNNFLKYENPLNDPSSPEEAKPAIQSVVVDKVVRDDKDFR FT MKYDPSHPDANAEGYVAYPNVNPVIEMADLIEATRAYQANVSAFTSAKTISQSAIDLLR FT G" FT misc_feature complement(489470..489586) FT /note="HMMPfam hit to PF06429, Domain of unknown function FT (DUF1078), score 2.2e-06" FT /inference="protein motif:Pfam:PF06429" FT misc_feature complement(489842..489934) FT /note="HMMPfam hit to PF00460, Flagella basal body rod FT protein, score 8.5e-07" FT /inference="protein motif:Pfam:PF00460" FT misc_feature complement(489854..489916) FT /note="PS00588 Flagella basal body rod proteins signature" FT /inference="protein motif:Prosite:PS00588" FT CDS complement(489962..490393) FT /transl_table=11 FT /gene="flgB" FT /locus_tag="Cj0528c" FT /product="flagellar basal-body rod protein" FT /note="Original (2000) note: Cj0528c, flgB, probable FT flagellar basal-body rod protein, len: 143 aa; similar to FT e.g. FLGB_BACSU flagellar basal-body rod protein (129 FT aa),fasta scores; opt: 107 z-score: 279.3 E(): 2.9e-08, FT 27.6% identity in 123 aa overlap. 43.0% identity to HP1559" FT /note="Updated (2006) note: Pfam domain PF00460 Flagella FT basal body rod protein identified within CDS by carrying FT out own Pfam search. Further support given to product FT function. These sequences represent FlgB, one of several FT components of bacterial flagella. FlgB is part of the basal FT body structure. Characterised within Bacillus subtilis with FT marginal identity scores. Putative was removed from product FT function. Functional classification -Surface structures" FT /note="PMID:1905667" FT /db_xref="GOA:Q0PAY8" FT /db_xref="InterPro:IPR006300" FT /db_xref="UniProtKB/TrEMBL:Q0PAY8" FT /inference="protein motif:Pfam:PF00460" FT /protein_id="CAL34674.1" FT /translation="MINPFKSKELVTGALAGRNLRNQLINANLANVDTPFYKARDIEFE FT TALVNRANEIFKKNDNKELQLAVTEEEHQKPWKFPDPSKSTIYLRDGHLARNDANTVDL FT DVETTEMSKNTVMITALDGVLRRQSNIFSSILDASSKLS" FT CDS complement(490474..491475) FT /transl_table=11 FT /locus_tag="Cj0529c" FT /product="putative aminodeoxychorismate lyase family FT protein" FT /note="Original (2000) note: Cj0529c, unknown, len: 333 aa; FT similar to hypothetical proteins e.g.YCEG_ECOLI FT hypothetical 38.2 kd protein in PABC-HOLB intergenic region FT (340 aa), fasta scores; opt: 326 z-score: 408.1 E(): FT 1.9e-15, 31.3% identity in 252 aa overlap. 43.0% identity FT to HP0587 (misannotated as aminodeoxychorismate lyase FT (pabC))" FT /note="Updated (2006) note: Pfam domain PF02618 FT Aminodeoxychorismate lyase identified within CDS. Two FT probable transmembrane helices predicted by TMHMM2.0 within FT CDS. This family contains several aminodeoxychorismate FT lyase proteins. Aminodeoxychorismate lyase is a pyridoxal FT 5'-phosphate-dependent enzyme that converts FT 4-aminodeoxychorismate to pyruvate and p-aminobenzoate, a FT precursor of folic acid in bacteria (PMID:11011151). FT Product modified to more specific family member based on FT motif match. No specific characterisation with acceptable FT identity scores carried out yet. Putative kept within FT product function. Functional classification -Misc" FT /note="PMID:11011151" FT /db_xref="GOA:Q0PAY7" FT /db_xref="InterPro:IPR003770" FT /db_xref="UniProtKB/TrEMBL:Q0PAY7" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02618" FT /protein_id="CAL34675.1" FT /translation="MTIPFLSTINKANISTTKNTTIYKIFFFIRNFFLIFILGIFYYLT FT QPLKSNSVVFIPQGSISQIITYLKQNKYQMSNIDKYILFFLGHPQSGWINIGTKDLNRA FT EFLHKLTIAKAALQTITLIPGETSVIFLEQAAKQLGLDKDILLKEFQAQAPYDEGVFLP FT ETYKIPKGITENLLIQMLLNHAEISNKKTSEKIFGDYNPKKWHQYIIIASVIQKEAAND FT NEMPIVASVIYNRLKKGMKLQMDGTLNYGIYSHVKVTPQRIRQDNSSYNTYKFTGLPKE FT AVCNVSLAAIRAAIFPLKTDYLYFVRDKNTGVHIFSTNIDDHNKAINLQKGK" FT misc_feature complement(490477..491322) FT /note="HMMPfam hit to PF02618, Aminodeoxychorismate FT lyase,score 4.8e-109" FT /inference="protein motif:Pfam:PF02618" FT misc_feature complement(491347..491415) FT /note="1 probable transmembrane helix predicted for Cj0529c FT by TMHMM2.0 at aa 21-43" FT /inference="protein motif:TMHMM:2.0" FT CDS 491390..493960 FT /transl_table=11 FT /locus_tag="Cj0530" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0530, probable periplasmic FT protein, len: 856 aa; 22.7% identity to HP0586. Contains FT N-terminal signal sequence. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAY6" FT /protein_id="CAL34676.1" FT /translation="MKKKILYIVVFFVVLILALFIVLKNGIVISSIQFDFLKLEQLYIK FT LDKKLIVRAKNITINETQNSEISSQTHSSDNASTEILKITKNLKYLYTFVKEIDIQNLN FT IKDNHVRILFKDNEFFIDNDLLFLKLTLQRQNKELIADIKKLLLKDYDLSIDGNLSINT FT KSEFYYFQGRASGELLDFNASISYKDKNLAYKIEDLNIRNITEIFKRVNKRIELPQSLN FT LWVAYRAKGEFYHLDYLQGFIDFTKDNYYLDNISASGYVNNVKVRLDDKMNAIEIPKLD FT LNLNKQKLDFVFNKAFYNGADLSSSKVYLYDLFDEKKVGIYLRIKSDNLKFDEKLAKAL FT EDYHFSLPFYQKSGKIKSDLELKIDFHDKGEISYSGILALENASISLADFNITKAFVKL FT NQNDLNIENASVKNGFLEADFNAKFDLQKQQGNFNTQISRLYFDNAELLDLKNQNVEVK FT LDYSQNVNISIPQWNLILNFKDGLEANLNNPKILFSFSPLLKKLGFINAKNVYYKTLNF FT EDFNASVNDAYFKNNLLINGQTPYENDSFDIVKNKGIMEIHTQSDTASAKISSDNKEIH FT LKNLSYIYRKHSNSSNSTFDIATNTQNISFGGANVALILADSNKTLAFDRVEADLKGNA FT LDLKGSRGNAKFDLYYSSNDLNLNVSNIDDNYLNEFLQKQAVQDGVFNLSIKGSGLEYF FT DGQIDFKNTYVKDLKGINQLISFIDTVPSLLMFKSPTFNQKGLSLHDGKIIFNRKKDLL FT SVSAINLNGDSVDIYGLGSANLRLNTVDFSLELKTLKSASEAISKVPILNYVILGKNQE FT ISTNLKIDGSIDDPKFHTEILTDTLKTPFNLIKNIIQLPANLLN" FT sig_peptide 491390..491479 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000245_491390_493960 by SignalP 2.0 FT HMM (Signal peptide probability 0.995) with cleavage site FT probability 0.487 between residues 30 and 31" FT misc_feature 491408..491476 FT /note="1 probable transmembrane helix predicted for Cj0530 FT by TMHMM2.0 at aa 7-29" FT /inference="protein motif:TMHMM:2.0" FT CDS 494077..496281 FT /transl_table=11 FT /gene="icd" FT /locus_tag="Cj0531" FT /product="isocitrate dehydrogenase" FT /EC_number="1.1.1.42" FT /note="Original (2000) note: Cj0531, icd, probable FT isocitrate dehydrogenase, len: 734 aa; highly similar to FT e.g. IDH2_VIBA1 isocitrate dehydrogenase (NADP) 2 (EC FT 1.1.1.42) (741 aa), fasta scores; opt: 2534 z-score: 3250.7 FT E(): 0, 53.3% identity in 733 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF03971 Monomeric FT isocitrate dehydrogenase identified within CDS. Further FT support given to product function. Characterised within FT Vibrio sp. strain ABE-1 with acceptable identity score. FT Putative not added to product function. Functional FT classification - Energy metabolism - Tricarboxylic acid FT cycle" FT /note="PMID:8226630, PMID:14702320" FT /db_xref="GOA:Q0PAY5" FT /db_xref="InterPro:IPR004436" FT /db_xref="InterPro:IPR024084" FT /db_xref="UniProtKB/TrEMBL:Q0PAY5" FT /inference="protein motif:Pfam:PF03971" FT /protein_id="CAL34677.1" FT /translation="MQITYTLTDESPALATYSFLPIVKAFLSRAHIGVKTSDISLSGRI FT LATFSEYLKEEQRCEDALELLGELVKRSDANLIKTPNISASIPQLKAAIKELQDKGYML FT PNYPDEPKNDEELQIKTKYQKVLGSAVNPVLRQGNSDRRSTKAVKDYAKNNPYRVVEFN FT PNSKTRVSYMKEGDFFSNEKAVLIDQDCVANIEFTSVDGKKEILKEGLKLEKNEILDAT FT FMDVQKLQEFYAKEIKASKDDDVLFSLHLKATMMKVSDPILFGYAVKVFFKELFIEFQD FT EFEKLGINPNNGLSELLSKIENSSKKDEILKKYSEILAKSADISMVNSDKGITNLHVPS FT DVIVDASMPAMLKNGARLWDKEGKEKDTNAVIPDQTYATIYEAVIEDLHKNGTLNPSKL FT GSVSNVGLMAKKAQEYGSHDKTFVAKEEGTFKIVSNGKVLLEHKVRKGDIYRANQAKFD FT AVLNWIDLGIERSELSGAEAIFWLDSKRASNKIMITLVQNRLKEKGKNVAILTPKEACL FT RSLELIREGKDVISITGNVLRDYLTDLFPILELGTSAKMLSVVPMLNGGAMFETGAGGS FT APKQVEQLVEENHLRWDSLGEFLALQASLEFYANKCGNHKAKVLAECLDEAIGEWLENN FT KAPSRKVKEDDNRTSHFYLAMYFANHLARQASDMELQSFFKDIALELSSNEEKIRAEFN FT DAQGVKVDLGGYYKFDDEKANKIMRPSATFNAILEKIGQR" FT misc_feature 494080..496266 FT /note="HMMPfam hit to PF03971, Monomeric isocitrate FT dehydrogenase, score 0" FT /inference="protein motif:Pfam:PF03971" FT CDS 496278..497180 FT /transl_table=11 FT /gene="mdh" FT /locus_tag="Cj0532" FT /product="malate dehydrogenase" FT /EC_number="1.1.1.37" FT /note="Original (2000) note: Cj0532, mdh, probable malate FT dehydrogenase, len: 300 aa; MDH_CHLTE malate dehydrogenase FT (EC 1.1.1.37) (310 aa), fasta scores; opt: 652 z-score: FT 1151.6 E(): 0, 35.4% identity in 294 aa overlap. No Hp FT match. Also similar toCj1167 ldh (25.4% identity in 311 aa FT overlap). Contains Pfam match to entry PF00056 FT ldh,L-lactate dehydrogenases, score 153.00, E-value 1e-42" FT /note="Updated (2006) note: Pfam domain PF02866 FT lactate/malate dehydrogenase, alpha/beta C-terminal domain FT identified within CDS. Further support given to product FT function. Characterised within Chlorobium tepidum and FT Bacillus subtilis with acceptable identity scores. Putative FT not added to product function. Functional classification - FT Energy metabolism - Tricarboxylic acid cycle" FT /note="PMID:1735722, PMID:8550482, PMID:14702320" FT /db_xref="GOA:Q9PHY2" FT /db_xref="InterPro:IPR001236" FT /db_xref="InterPro:IPR001557" FT /db_xref="InterPro:IPR015955" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR022383" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHY2" FT /inference="protein motif:Pfam:PF02866" FT /inference="protein motif:Pfam:PF00056" FT /protein_id="CAL34678.1" FT /translation="MKITVIGAGNVGSSVAYALILREIANEIVLVDINEDLLYAKELEL FT TQSIAALNLNIDLLCTKDYTHTKNSDIVLFSAGFARKDGQSREELLQLNTSIMLDCAKK FT IKDFTEDPLFIILTNPVDFLLNTLYESGIFSSKKIIAMAGVLDNARFKYELAKKLNVKM FT SRVDTRLIGFHNDDMVLVKSYASVKNKNISEFLNEEEFEDLENEVKTGGAKVIKHLKTS FT AYLAPASACIRMLESIRSGEFLPMSVILHGEFGVQNKALGVMARLGLEGVIEIMKMDLS FT LQEKDKLEKSLIKYQYKGE" FT misc_feature 496278..496700 FT /note="HMMPfam hit to PF00056, lactate/malate FT dehydrogenase, NAD binding do, score 2.4e-28" FT /inference="protein motif:Pfam:PF00056" FT misc_feature 496707..497174 FT /note="HMMPfam hit to PF02866, lactate/malate FT dehydrogenase, alpha/beta C-t, score 4.6e-09" FT /inference="protein motif:Pfam:PF02866" FT CDS 497181..498344 FT /transl_table=11 FT /gene="sucC" FT /locus_tag="Cj0533" FT /product="succinyl-coA synthetase beta chain" FT /EC_number="6.2.1.5" FT /note="Original (2000) note: Cj0533, sucC, probable FT succinyl-coA synthetase beta chain, len: 387 aa; similar to FT e.g. SUCC_BACSU succinyl-coA synthetase beta chain (EC FT 6.2.1.5) (385 aa), fasta scores; opt: 1362 z-score: 2032.3 FT E(): 0, 53.4% identity in 386 aa overlap. No Hp match. FT Contains Pfam match to entry PF00549 FT ligase-CoA,CoA-ligases, score 204.90, E-value 1.2e-57" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis and Escherichia coli with acceptable identity FT score. Putative not added to product function. Functional FT classification - Energy metabolism - Tricarboxylic acid FT cycle" FT /note="PMID:2548486, PMID:14702320" FT /db_xref="GOA:Q9PHY1" FT /db_xref="InterPro:IPR005809" FT /db_xref="InterPro:IPR005811" FT /db_xref="InterPro:IPR013650" FT /db_xref="InterPro:IPR013815" FT /db_xref="InterPro:IPR013816" FT /db_xref="InterPro:IPR016102" FT /db_xref="InterPro:IPR017866" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHY1" FT /inference="protein motif:Pfam:PF00549" FT /protein_id="CAL34679.1" FT /translation="MNIHEYQAKAIFVDNGIPTLKGKVAFSVDEAVANAKELGGSVWAV FT KAQIHAGGRGLGGGVKIAKNLDEVKDYASKILGMNLVTHQTGPEGKLVQKLYIESGANI FT VKEYYLAILFNRMAEQITIIASSEGGMDIEKVAKESPEKIAKVGIDPQIGFKMFHGLEV FT ARVLGLDKDEGKKLISMIAKLYKLYMDKDMNMLEINPLIKTAEGDFYALDAKCSFDDSA FT LYRHPEIAELRDTTEENPAEREAAEFGLSYVKLDGDVACMVNGAGLAMATMDIINYSGA FT KPANFLDVGGGASPETVAKAFEIILRDKNVKVIFINIFGGIVRCDRIANGILEATKNVE FT VNIPIVVRLDGTNAAEAKTILDNSNLKNIKAATNLKNGAELVKSLVG" FT misc_feature 497265..497774 FT /note="HMMPfam hit to PF02222, ATP-grasp domain, score FT 5e-19" FT /inference="protein motif:Pfam:PF02222" FT misc_feature 497916..498329 FT /note="HMMPfam hit to PF00549, CoA-ligase, score 1.4e-59" FT /inference="protein motif:Pfam:PF00549" FT misc_feature 497949..498023 FT /note="PS01217 ATP-citrate lyase / succinyl-CoA ligases FT family signature 3" FT /inference="protein motif:Prosite:PS01217" FT CDS 498354..499223 FT /transl_table=11 FT /gene="sucD" FT /locus_tag="Cj0534" FT /product="succinyl-coA synthetase alpha chain" FT /EC_number="6.2.1.5" FT /note="Original (2000) note: Cj0534, sucD, probable FT succinyl-coA synthetase alpha chain, len: 289 aa; highly FT similar to many e.g. SUCD_ECOLI succinyl-coA synthetase FT alpha chain (EC 6.2.1.5) (288 aa), fasta scores; opt: 1101 FT z-score: 1532.0 E(): 0, 58.5% identity in 287 aa overlap. FT No Hp match. Contains PS01216 ATP-citrate lyase / FT succinyl-CoA ligases family signature 1, PS00399 FT ATP-citrate lyase / succinyl-CoA ligases family active FT site, and Pfam match to entry PF00549 FT ligase-CoA,CoA-ligases, score 142.30, E-value 8.6e-39" FT /note="Updated (2006) note: Pfam domain PF02629 CoA binding FT domain domain identified within CDS. Further support given FT to product function. Characterised within Bacillus subtilis FT and Escherichia coli with acceptable identity scores. FT Putative not added to product function. Functional FT classification - Energy metabolism -Tricarboxylic acid FT cycle" FT /note="PMID:3543212, PMID:14702320" FT /db_xref="GOA:Q0PAY2" FT /db_xref="InterPro:IPR003781" FT /db_xref="InterPro:IPR005810" FT /db_xref="InterPro:IPR005811" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR016102" FT /db_xref="InterPro:IPR017440" FT /db_xref="UniProtKB/TrEMBL:Q0PAY2" FT /inference="protein motif:Pfam:PF02629" FT /inference="protein motif:Pfam:PF00549" FT /inference="protein motif:Prosite:PS00399" FT /inference="protein motif:Prosite:PS01216" FT /protein_id="CAL34680.1" FT /translation="MSILVNKNTKVIVQGFTGKEATFHAEQCMAYGTNIVGGITPHKGG FT QTHLGKPVFDTVADAVKATKADVSLIFVPAFAVGDSVIEAADAGIKLAVVITEHTPVKD FT MMFAKQYANKKGMKIIGPNCPGIITSEECKLGIMPGFIFKKGCVGLISKSGTLTYEAAN FT QVVQGGYGISTAVGIGGDPIIGLAYKELLSEFQKDDETKAIVMIGEIGGSLEVEAAKFI FT KENISKPVVAFIAGATAPKGKRMGHAGAIVGSADESAAAKKEALKSYGIHVVDSPALIG FT EEIQKILG" FT misc_feature 498363..498698 FT /note="HMMPfam hit to PF02629, CoA binding domain, score FT 2.2e-59" FT /inference="protein motif:Pfam:PF02629" FT misc_feature 498750..499175 FT /note="HMMPfam hit to PF00549, CoA-ligase, score 2.3e-39" FT /inference="protein motif:Pfam:PF00549" FT misc_feature 498807..498896 FT /note="PS01216 ATP-citrate lyase / succinyl-CoA ligases FT family signature 1" FT /inference="protein motif:Prosite:PS01216" FT misc_feature 499059..499100 FT /note="PS00399 ATP-citrate lyase / succinyl-CoA ligases FT family active site" FT /inference="protein motif:Prosite:PS00399" FT CDS 499238..499549 FT /transl_table=11 FT /gene="oorD" FT /locus_tag="Cj0535" FT /product="OORD subunit of 2-oxoglutarate:acceptor FT oxidoreductase" FT /note="Original (2000) note: Cj0535, oorD, probable OORD FT subunit of 2-oxoglutarate:acceptor oxidoreductase, len: 103 FT aa; similar to TR:O68227 (EMBL:AF021094) H. pylori OORD FT subunit of 2-oxoglutarate:acceptor oxidoreductase (113 aa), FT fasta scores; opt: 436 z-score: 768.9 E(): 0,59.8% identity FT in 97 aa overlap. 59.8% identity to HP0588. Contains 2x FT PS00198 4Fe-4S ferredoxins, iron-sulfur binding region FT signature and Pfam match to entry PF00037 fer4, 4Fe-4S FT ferredoxins and related iron-sulfur cluster binding FT domains., score 17.40, E-value 0.00091" FT /note="Updated (2006) note: Characterised within FT Helicobacter pylori with acceptable identity score. FT Putative not added to product function. Functional FT classification - Energy metabolism - Electron transport" FT /note="PMID:9495749, PMID:7608066, PMID:14702320" FT /db_xref="GOA:Q0PAY1" FT /db_xref="InterPro:IPR001450" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR017900" FT /db_xref="UniProtKB/TrEMBL:Q0PAY1" FT /inference="protein motif:Pfam:PF00037" FT /inference="protein motif:Prosite:PS00198" FT /protein_id="CAL34681.1" FT /translation="MSMTAPKDTPVWVDEHRCKACNICVSYCPAGVLAMRDDVHAVLGQ FT MIEVVHPESCIGCTECEIHCPDFAIMVAKRDEFKFAKLTAEAKDRAVAVKNNKYKKLA" FT misc_feature 499268..499339 FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 2.5e-05" FT /inference="protein motif:Pfam:PF00037" FT misc_feature 499289..499324 FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT misc_feature 499379..499450 FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 5.8e-05" FT /inference="protein motif:Pfam:PF00037" FT misc_feature 499400..499435 FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT CDS 499558..500682 FT /transl_table=11 FT /gene="oorA" FT /locus_tag="Cj0536" FT /product="OORA subunit of 2-oxoglutarate:acceptor FT oxidoreductase" FT /note="Original (2000) note: Cj0536, oorA, probable OORA FT subunit of 2-oxoglutarate:acceptor oxidoreductase, len: 374 FT aa; similar to TR:O68228 (EMBL:AF021094) H. pylori OORA FT subunit of 2-oxoglutarate:acceptor oxidoreductase (371 aa), FT fasta scores; opt: 1447 z-score: 2256.7 E(): 0,62.7% FT identity in 351 aa overlap. 63.2% identity to HP0589" FT /note="Updated (2006) note: Pfam domain PF01855 Pyruvate FT flavodoxin/ferredoxin oxidoreductase identified within CDS. FT Further support given to product function. Characterised FT within Helicobacter pylori with acceptable identity score. FT Putative not added to product function. Functional FT classification - Energy metabolism - Electron transport" FT /note="PMID:9495749, PMID:7608066, PMID:14702320" FT /db_xref="GOA:Q0PAY0" FT /db_xref="InterPro:IPR002880" FT /db_xref="InterPro:IPR005476" FT /db_xref="InterPro:IPR009014" FT /db_xref="InterPro:IPR015941" FT /db_xref="UniProtKB/TrEMBL:Q0PAY0" FT /inference="protein motif:Pfam:PF01855" FT /protein_id="CAL34682.1" FT /translation="MREVIATGNVLIAKAAIDCGCKFFGGYPITPSSEIAHELSHMLPA FT NDGTFIQMEDEISGISVAIGAAMSGVKSMTASSGPGISLKAEQIGLAFIAEIPLVIVNV FT MRGGPSTGLPTRVAQGDLFQAKAPTHGDFASIAIAPASLEEAYTETIRAFNLAEKYMTP FT VFLLMDETVGHMNGKAVLPDLKDIKVYNRKKFEGDKKDYKPYAAGENEPATLNPFFTGY FT RYHVTGLHHGDIGFPTEDGVIVKKNMERLIGKIKNNQEDICTYEEYMLDDAEFLIIAYG FT SVSRSAKEAIQRLREQGIKVGLFRPITLYPVAEKKIAEVVSKFKKVMVSELNMGQYLEE FT IERVTSRRDFISLHRANGRPITPSEIIAKVKENI" FT misc_feature 499597..500304 FT /note="HMMPfam hit to PF01855, Pyruvate FT flavodoxin/ferredoxin oxidoreductas, score 5e-93" FT /inference="protein motif:Pfam:PF01855" FT CDS 500683..501528 FT /transl_table=11 FT /gene="oorB" FT /locus_tag="Cj0537" FT /product="OORB subunit of 2-oxoglutarate:acceptor FT oxidoreductase" FT /note="Original (2000) note: Cj0537, oorB, probable OORB FT subunit of 2-oxoglutarate:acceptor oxidoreductase, len: 281 FT aa; similar to TR:O68229 (EMBL:AF021094) H. pylori OORB FT subunit of 2-oxoglutarate:acceptor oxidoreductase (274 aa), FT fasta scores; opt: 1356 z-score: 2118.6 E(): 0,69.7% FT identity in 274 aa overlap. 72.9% identity to HP0590" FT /note="Updated (2006) note: Pfam domain PF02775 Thiamine FT pyrophosphate enzyme, C-terminal identified within CDS. FT Further support given to product function. Characterised FT within Helicobacter pylori with acceptable identity score. FT Putative not added to product function. Functional FT classification - Energy metabolism - Electron transport" FT /note="PMID:9495749, PMID:7608066, PMID:14702320" FT /db_xref="GOA:Q0PAX9" FT /db_xref="InterPro:IPR011766" FT /db_xref="UniProtKB/TrEMBL:Q0PAX9" FT /inference="protein motif:Pfam:PF02775" FT /protein_id="CAL34683.1" FT /translation="MAFNYDEYLRVDKMPTQWCWGCGDGVVLKCIIRAIEKLGWNMDDV FT CLVSGIGCSGRMSSYVNCNTVHTTHGRAIAYATGIKLANPSKHVIVVSGDGDTLAIGGN FT HTIHGCRRNIDLTHIVINNFIYGLTNSQTSPTTPKGFYTVTAQFGNIDPNFDACELTKA FT AGASFVARGNVIEANKLENLIYKALAHKGYSFVDVFSNCHINLGRKNKMGEAVAMLDWI FT KNRVVDKAKFESMDFEERKDKFPTGILHEDNSQPEYCHAYEEVRRAAKEKRMVDLGALK FT " FT misc_feature 500731..501297 FT /note="HMMPfam hit to PF02775, Thiamine pyrophosphate FT enzyme, C-termina, score 3.8e-87" FT /inference="protein motif:Pfam:PF02775" FT CDS 501525..502082 FT /transl_table=11 FT /gene="oorC" FT /locus_tag="Cj0538" FT /product="OORC subunit of 2-oxoglutarate:acceptor FT oxidoreductase" FT /note="Original (2000) note: Cj0538, oorC, probable OORC FT subunit of 2-oxoglutarate:acceptor oxidoreductase, len: 185 FT aa; similar to TR:O68230 (EMBL:AF021094) H. pylori OORC FT subunit of 2-oxoglutarate:acceptor oxidoreductase (184 aa), FT fasta scores; opt: 714 z-score: 1191.4 E(): 0,59.7% FT identity in 181 aa overlap. 60.8% identity to HP0591" FT /note="Updated (2006) note: Pfam domain PF01558 Pyruvate FT ferredoxin/flavodoxin oxidoreductase identified within CDS. FT Further support given to product function. Characterised FT within Helicobacter pylori with acceptable identity score. FT Putative not added to product function. Functional FT classification - Energy metabolism - Electron transport" FT /note="PMID:9495749, PMID:7608066, PMID:14702320" FT /db_xref="GOA:Q0PAX8" FT /db_xref="InterPro:IPR002869" FT /db_xref="InterPro:IPR019752" FT /db_xref="PDB:3G2E" FT /db_xref="UniProtKB/TrEMBL:Q0PAX8" FT /inference="protein motif:Pfam:PF01558" FT /protein_id="CAL34684.1" FT /translation="MKYQLRFGGEGGQGVITAGEILAEAAIKEGRQAFKASTYTSQVRG FT GPTKVDIIIDDKEILFPYAVEGEVDFMLSTADKGYKGFRGGVKEGGIIVVEPNLVHPES FT EDYKKWQIFEIPIITIAKDEVGNVATQSVVALAIAAYMSKCIDLDVLKETMLHMVPAKT FT RDANAKAFDLGVKYATQAKPHS" FT misc_feature 501555..502052 FT /note="HMMPfam hit to PF01558, Pyruvate FT ferredoxin/flavodoxin oxidoreductas, score 3.8e-35" FT /inference="protein motif:Pfam:PF01558" FT CDS 502221..502484 FT /transl_table=11 FT /locus_tag="Cj0539" FT /product="hypothetical protein Cj0539" FT /note="Original (2000) note: Cj0539, unknown, len: 87 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="InterPro:IPR018563" FT /db_xref="InterPro:IPR023126" FT /db_xref="UniProtKB/TrEMBL:Q0PAX7" FT /protein_id="CAL34685.1" FT /translation="MDFFDEMFNKTPKEKFIEIIQNGNLGALEKVFEEFFADHIAMVEL FT LEKQGLTEMDVKNFILENGDFIEERQNDIYIELGAKILGHEG" FT CDS 502487..503023 FT /transl_table=11 FT /locus_tag="Cj0540" FT /product="putative exporting protein" FT /note="Original (2000) note: Cj0540, unknown, len: 178 aa; FT 30.6% identity in 72 aa overlap (N-terminus) to HP0241" FT /note="Updated (2006) note: Product function modified to FT more specific family member based on SignalP 2.0 HMM FT results. Putative kept within product function. Functional FT classification - Protein and peptide secretion" FT /db_xref="UniProtKB/TrEMBL:Q0PAX6" FT /protein_id="CAL34686.1" FT /translation="MFKISPYLICIFFIFSNVLASEPTFDYTYKFILKKDERASVQIKE FT IGYEDKVQNFDFYWTLFDNTNIIVHSKFRKYPRQFVMSLRRNLDWVTQTLIPDYTNPHI FT DRARLILEFSGYNKGLATFTVYIEDKESRLMVEFLDPRKKALQNPPQNNQVVPMINFNE FT PQVKPLTSKENNNSN" FT sig_peptide 502487..502546 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000247_502487_503023 by SignalP 2.0 FT HMM (Signal peptide probability 0.611) with cleavage site FT probability 0.463 between residues 20 and 21" FT CDS 503037..503930 FT /transl_table=11 FT /locus_tag="Cj0541" FT /product="polyprenyl synthetase" FT /EC_number="2.5.1.-" FT /note="Original (2000) note: Cj0541, probable polyprenyl FT synthetase, len: 297 aa; similar to many e.g. ISPB_ECOLI FT octaprenyl-diphosphate synthase (EC 2.5.1.-) (323 aa),fasta FT scores; opt: 514 z-score: 753.9 E(): 0, 35.2% identity in FT 281 aa overlap, IDSA_METTM bifunctional short chain FT isoprenyl diphosphate synthase (324 aa), fasta scores; opt: FT 549 z-score: 676.0 E(): 2.3e-30, 36.5% identity in 277 aa FT overlap, and GGPP_SULAC geranylgeranyl pyrophosphate FT synthetase (330 aa), fasta scores; opt: 330 z-score: 653.2 FT E(): 4.4e-29, 32.9% identity in 292 aa overlap. 44.6% FT identity to HP0240. Also similar to Cj1644 (27.6% identity FT in 268 aa overlap). Contains PS00723 and PS00444 Polyprenyl FT synthetases signatures 1 and 2, and Pfam match to entry FT PF00348 polyprenyl_synt, Polyprenyl synthetases, score FT 153.40, E-value 3.8e-42" FT /note="Updated (2006) note: Similarity to more than one FT characterised genus with acceptable identity scores. FT Putative not added to product function. Functional FT classification - Biosynthesis of cofactors, prosthetic FT groups and carriers - Menaquinone and ubiquinine" FT /note="PMID:8037730" FT /db_xref="GOA:Q0PAX5" FT /db_xref="InterPro:IPR000092" FT /db_xref="InterPro:IPR008949" FT /db_xref="InterPro:IPR017446" FT /db_xref="UniProtKB/TrEMBL:Q0PAX5" FT /inference="protein motif:Pfam:PF00348" FT /inference="protein motif:Prosite:PS00444" FT /inference="protein motif:Prosite:PS00723" FT /protein_id="CAL34687.1" FT /translation="MQKIDELIKQFLQELGYEPILNMLSNVKSGKKLRSKLLLAIADES FT EIAFKICAAIELIHLASLLHDDIIDESELRRGARSVNAEFGTKNALMLGDILYSKAFYE FT LSKMDARFASIISDAVVKLAIGELMDVDLGEKFNINKEAYLKMIYNKTAVLIEASARCG FT AILAGLYEKDFAEYGKNLGLAFQMIDDILDIKSDEKILGKPAMNDFKEGKTTLPYIYLY FT ENLQEQDRIYLQTLFKKDLNENEKEWLKTKFEEQKALEKAILEAKTYAKKARKAIEKYD FT NNKLNDIIKAMIDREF" FT misc_feature 503094..503825 FT /note="HMMPfam hit to PF00348, Polyprenyl synthetase,score FT 1.4e-43" FT /inference="protein motif:Pfam:PF00348" FT misc_feature 503223..503267 FT /note="PS00723 Polyprenyl synthetases signature 1" FT /inference="protein motif:Prosite:PS00723" FT misc_feature 503577..503615 FT /note="PS00444 Polyprenyl synthetases signature 2" FT /inference="protein motif:Prosite:PS00444" FT CDS 503930..505228 FT /transl_table=11 FT /gene="hemA" FT /locus_tag="Cj0542" FT /product="glutamyl-tRNA reductase" FT /EC_number="1.2.1.70" FT /note="Original (2000) note: Cj0542, hemA, probable FT glutamyl-tRNA reductase, len: 432 aa; simlar to many e.g. FT HEM1_ECOLI glutamyl-tRNA reductase (EC 1.2.1.-) (418 FT aa),fasta scores; opt: 591 z-score: 745.1 E(): 0, 31.3% FT identity in 422 aa overlap. 42.1% identity to HP0239. FT Contains Pfam match to entry PF00745 GlutR,Glutaminyl-tRNA FT reductase, score 237.10, E-value 2.4e-67" FT /note="Updated (2006) note: Pfam domains PF05201 FT Glutamyl-tRNAGlu reductase, N-terminal and PF05200 FT Glutamyl-tRNAGlu reductase, NAD(P) binding were identified FT within CDS. Further support given to product function. EC FT number has also been updated. Characterised within FT Escherichia coli with marginal identity score. Putative not FT added to product function. Functional classification FT -Biosynthesis of cofactors, prosthetic groups and carriers FT - Heme" FT /note="PMID:1569081" FT /db_xref="GOA:Q9PHX2" FT /db_xref="InterPro:IPR000343" FT /db_xref="InterPro:IPR006151" FT /db_xref="InterPro:IPR015895" FT /db_xref="InterPro:IPR015896" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR018214" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHX2" FT /inference="protein motif:Pfam:PF05200" FT /inference="protein motif:Pfam:PF05201" FT /inference="protein motif:Pfam:PF00745" FT /protein_id="CAL34688.1" FT /translation="MYYCISFTHKNTDIALREKLSFSNEAKKGEFLKIISTHENIEECL FT VISTCNRVEIVAFVKMACAEFIVKSLALLCDVDKDILLEKADIFEDSGAIHHLFSVASS FT LDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRAVHSAFKCAAKVRNETQISKNSISV FT ASVAVAKAKELADLTQKKAVVIGAGEMGELAAKHLIAAGAKVIILNRDLQKAKDLCERL FT GVLSEYDSLENLKKYLNQYEFFFSATNAPNAIITNSLIEELSYKRYFFDIAVPRDIDIN FT ENENISVFAVDDLEIVVQKNLALREQEARMAYGIIGRETSEFFRYLNDLALMPIIKAIR FT LQAKEYADKQLEIALKKGYLKKSDKEEARKLIHQVFKAFLHTPTVNLKHLQGKMQSDTV FT INAMRYVFDLQNNLEGLNQYKCEFDMENNDEIY" FT misc_feature 503942..504394 FT /note="HMMPfam hit to PF05201, Glutamyl-tRNAGlu FT reductase,N-terminal, score 4.3e-44" FT /inference="protein motif:Pfam:PF05201" FT misc_feature 504404..504847 FT /note="HMMPfam hit to PF05200, Glutamyl-tRNAGlu FT reductase,NAD(P) bin, score 2e-66" FT /inference="protein motif:Pfam:PF05200" FT misc_feature 504857..505159 FT /note="HMMPfam hit to PF00745, Glutamyl-tRNAGlu FT reductase,dimerisati, score 2.9e-30" FT /inference="protein motif:Pfam:PF00745" FT CDS 505212..506921 FT /transl_table=11 FT /gene="proS" FT /locus_tag="Cj0543" FT /product="prolyl-tRNA synthetase" FT /EC_number="6.1.1.15" FT /note="Original (2000) note: Cj0543, proS, probable FT prolyl-tRNA synthetase, len: 369 aa; highly similar to many FT e.g. SYP_ECOLI prolyl-tRNA synthetase (EC 6.1.1.15) (572 FT aa), fasta scores; opt: 1611 z-score: 1967.2 E(): 0,45.8% FT identity in 578 aa overlap. 53.4% identity to HP0238. FT Contains PS00179 Aminoacyl-transfer RNA synthetases FT class-II signature 1 and Pfam match to entry PF00587 FT tRNA-synt_2b, tRNA synthetases class II (Gly, His,Pro and FT Ser), score 27.10, E-value 2.7e-05" FT /note="Updated (2006) note: Pfam domains PF00587 tRNA FT synthetase class II core domain (G,H,P,S and T), PF04073 FT YbaK / prolyl-tRNA synthetases associated domain and FT PF03129 Anticodon binding domain, were identified within FT CDS. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Putative not added to product function. FT Functional classification - Aminoacyl tRNA synthetases and FT their modification" FT /note="PMID:1688424" FT /db_xref="GOA:Q9PHX1" FT /db_xref="InterPro:IPR002314" FT /db_xref="InterPro:IPR002316" FT /db_xref="InterPro:IPR004154" FT /db_xref="InterPro:IPR004500" FT /db_xref="InterPro:IPR006195" FT /db_xref="InterPro:IPR007214" FT /db_xref="InterPro:IPR023717" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHX1" FT /inference="protein motif:Pfam:PF03129" FT /inference="protein motif:Pfam:PF04073" FT /inference="protein motif:Pfam:PF00587" FT /inference="protein motif:Prosite:PS00179" FT /protein_id="CAL34689.1" FT /translation="MMRFTKFYAPSLKEAPKDASLPSHIFLTRAGFVEQIGSGLYNFLP FT LGKRVLDKIKNIVKEEMDKAGAQEVNLSFITPASLWQESGRYNVFGKELLRFKDRKENE FT FVLGPTHEEAMLSLVKNKITSYKQLPLHLYQIGLKFRDEARPRFGLLRCREFLMKDGYS FT FHANEEDLGREFELMYKTYSQILQRMGLDFRAVEADSGAIGGSGSKEFMVLAKNGEDDI FT LICENCDYAANVEAAKRAKKTCQDERPEANYASKFHTPNIKTIDSLAQFFKINAFYTIK FT AVVKKAIYENESKLVVFFIRGSDDLQEVKAQNTCSALELVDASEEELKKAGLVAGFIGF FT VGLKDIDFYIDFELENEKQMIMGANEKDYHLIGIDVVNLNKDRFKDLIEVKEGDCCVKC FT GAKLKQSKGIEVGHIFKLGQKYSKAMNANFLDENGKSQPFYMGCYGIGVSRLLAVAIEA FT NHDEKGCIWNKTLAPFVLEIIVSNLKDEKALEFANKLYRDLTNLGLEVLLDDRNERFGV FT KMNDFELMGFPYALVIGKGLENNEIELIQREGLVKELIKTDELMEILKKKVL" FT misc_feature 505326..505790 FT /note="HMMPfam hit to PF00587, tRNA synthetase class II FT core domain (, score 6.1e-53" FT /inference="protein motif:Pfam:PF00587" FT misc_feature 505629..505691 FT /note="PS00179 Aminoacyl-transfer RNA synthetases class-II FT signature 1" FT /inference="protein motif:Prosite:PS00179" FT misc_feature 505971..506372 FT /note="HMMPfam hit to PF04073, YbaK / prolyl-tRNA FT synthetases associa, score 4.8e-06" FT /inference="protein motif:Pfam:PF04073" FT misc_feature 506640..506912 FT /note="HMMPfam hit to PF03129, Anticodon binding FT domain,score 7.4e-20" FT /inference="protein motif:Pfam:PF03129" FT CDS 506918..507307 FT /transl_table=11 FT /locus_tag="Cj0544" FT /product="putative integral memnbrane protein" FT /note="Original (2000) note: Cj0544, probable integral FT membrane protein, len: 129 aa; no Hp match" FT /note="Updated (2006) note: Three probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PAX2" FT /db_xref="InterPro:IPR007313" FT /db_xref="UniProtKB/TrEMBL:Q0PAX2" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34690.1" FT /translation="MNYKLSLSPLFVLEIIASVLFIVFFGFGNFLFFILLSMIFGAVLL FT GIFWKNMLEFQMGGLKDMLTQFSFVIAGFLLIFPGIITSVFGIFVFFFGIALKLITKSK FT YQYTKQEYQNSNEEIIDVEIIEDRK" FT sig_peptide 506918..507040 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000249_506918_507307 by SignalP 2.0 FT HMM (Signal peptide probability 0.753) with cleavage site FT probability 0.727 between residues 41 and 42" FT misc_feature order(506945..507001,507005..507064,507122..507217) FT /note="3 probable transmembrane helices predicted for FT Cj0544 by TMHMM2.0 at aa 10-28, 30-49 and 69-100" FT /inference="protein motif:TMHMM:2.0" FT CDS 507304..508227 FT /transl_table=11 FT /gene="hemC" FT /locus_tag="Cj0545" FT /product="porphobilinogen deaminase" FT /EC_number="2.5.1.61" FT /note="Original (2000) note: Cj0545, hemC, probable FT porphobilinogen deaminase, len: 307 aa; highly similar to FT many e.g. HEM3_ECOLI porphobilinogen deaminase (EC 4.3.1.8) FT (313 aa), fasta scores; opt: 883 z-score: 1517.1 E(): 0, FT 49.0% identity in 300 aa overlap. 51.5% identity to HP0237. FT Contains PS00533 Porphobilinogen deaminase cofactor-binding FT site" FT /note="Updated (2006) note: Pfam domains PF01379 FT Porphobilinogen deaminase, dipyromethane cofactor binding FT domain and PF03900 Porphobilinogen deaminase, C-terminal FT domain were identified within CDS. Further support given to FT product function. Characterised within Escherichia coli FT with acceptable identity score. Putative not added to FT product function. Functional classification - Biosynthesis FT of cofactors, prosthetic groups and carriers - Heme" FT /note="PMID:1747120" FT /db_xref="GOA:Q9PHW9" FT /db_xref="InterPro:IPR000860" FT /db_xref="InterPro:IPR022417" FT /db_xref="InterPro:IPR022418" FT /db_xref="InterPro:IPR022419" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHW9" FT /inference="protein motif:Pfam:PF03900" FT /inference="protein motif:Pfam:PF01379" FT /inference="protein motif:Prosite:PS00533" FT /protein_id="CAL34691.1" FT /translation="MKLIIATRKSQLALWQSEHVAQILKNTHQIEVLLEGFKTKGDVLL FT DSPLAKIGGKGLFTKELEESMLRKEAHLAVHSLKDVPSFFPQGLVLAAVSKREQSNDAM FT LSQNYKDFLSLPKGAKIGTTSLRRKMQLLLLRPDLEIISLRGNVNSRIEKLKNNDFDAI FT ILAMAGIKRLNLDKQVNFVYEFSKDELIPAASQGALGIESINDEKILELLKCLNDENAL FT IETSIEREFIATLEGGCQVPIGINAELLGDEICVRAVLGLPDGSEILKDKRMIKKNDFK FT GFGESLAKEFIAKGAKELLKKAESMI" FT misc_feature 507307..507945 FT /note="HMMPfam hit to PF01379, Porphobilinogen FT deaminase,dipyrometh, score 5.7e-107" FT /inference="protein motif:Pfam:PF01379" FT misc_feature 507967..508188 FT /note="HMMPfam hit to PF03900, Porphobilinogen FT deaminase,C-terminal, score 7.3e-15" FT /inference="protein motif:Pfam:PF03900" FT misc_feature 507985..508035 FT /note="PS00533 Porphobilinogen deaminase cofactor-binding FT site" FT /inference="protein motif:Prosite:PS00533" FT CDS 508224..510026 FT /transl_table=11 FT /gene="ubiD" FT /locus_tag="Cj0546" FT /product="putative 3-octaprenyl-4-hydroxybenzoate FT carboxy-lyase" FT /EC_number="4.1.1.-" FT /note="Original (2000) note: Cj0546, unknown, len: 600 aa; FT similar to many hypothetical proteins e.g. YIGC_ECOLI (497 FT aa), fasta scores; opt: 837 z-score: 852.4 E(): 0, 32.7% FT identity in 459 aa overlap. 51.6% identity to HP0396" FT /note="Updated (2006) note: Pfam domain PF01977 FT 3-octaprenyl-4-hydroxybenzoate carboxy-lyase identified FT within CDS. Product modified to more specific family member FT due to motif match. Characterised within Escherichia coli FT with marginal identity scores. Sequence alignment was FT partial. Putative kept within product function. Functional FT classification - Misc" FT /note="PMID:782527, PMID:11029449" FT /db_xref="GOA:Q0PAX0" FT /db_xref="InterPro:IPR002830" FT /db_xref="InterPro:IPR009002" FT /db_xref="InterPro:IPR022390" FT /db_xref="UniProtKB/TrEMBL:Q0PAX0" FT /inference="protein motif:Pfam:PF01977" FT /protein_id="CAL34692.1" FT /translation="MKEFIQILKENDLLRVIEEPVDVDLEIAHLAYIEAKKGEKGKALL FT FKNPIDKKLNKQYKFPVLMNTFCNKKALNLAFGRDYKEVAEEISKLIKLHIPTSFKAKM FT DFFMNLLSFKNIPPKRLKKNKALYDYEILNSLEELPILKTWEDDAGKFITMGQVYTQNL FT DKTQNNLGMYRLQMSDKNELLIHWQIHKDGANFYHEYKNAGFKKMPVSIAIGGDPLYIW FT CSQAPLPKGIFELLLYGFIKKTPAKITPCENGIFVPYDSDVVIEGYVDLEEFKIEGPFG FT DHTGFYTPAELFPVMKVEKIYAKKDAIYQATVVGKPPLEDKIMGLGTERIFLPLLQTSV FT PDLIDYNMPENGVFHNLILAKIDAKYPAHAQQIMHAFWGVGQMSFVKHAIFVDKNAPSL FT KDYDALIPYMLDRFNTKKILISEGICDQLDHASPNSCFGGKAGLDACEEIQVEELEILE FT DEKLLELFKTKVELLNLKQFYKESKSPIVCILLDKKEKIEQSFDKLLEFKKYFRILVFL FT DAENKLENSYMLVWRVVNNIDAKRDIFIKEERLGVDASAKGEAEGYLRAWPKQTDCTKS FT VIEDLILRNILENNPDLFNKFEIF" FT misc_feature 508236..509504 FT /note="HMMPfam hit to FT PF01977,3-octaprenyl-4-hydroxybenzoate carboxy-lyase, score FT 4.7e-139" FT /inference="protein motif:Pfam:PF01977" FT CDS 510184..510549 FT /transl_table=11 FT /gene="flaG" FT /locus_tag="Cj0547" FT /product="flagellar protein" FT /note="Original (2000) note: Cj0547, flaG, possible FT flagellar protein, len: 121 aa; some similarity to e.g. FT TR:O33420 (EMBL:L81176) Pseudomonas aeruginosa FLAG (128 FT aa), fasta scores; opt: 169 z-score: 197.2 E(): FT 0.0011,31.4% identity in 102 aa overlap. 43.5% identity to FT HP0751" FT /note="Updated (2006) note: Pfam domain PF03646 FlaG FT protein was identified within CDS. Further support given to FT product function. The FlgB, FlgC and FlgG proteins are FT components of the proximal and distal rods; FliF forms the FT M-ring that anchors the rod assembly to the membrane. FT Characterised within Pseudomonas aeruginosa with marginal FT identity score. Using this extra information and also FT taking into account the appropriate motif match, putative FT was removed from the product function. Functional FT classification - Surface structures" FT /note="PMID:9488388, PMID:10559162, PMID:2646286" FT /db_xref="GOA:Q0PAW9" FT /db_xref="InterPro:IPR005186" FT /db_xref="UniProtKB/TrEMBL:Q0PAW9" FT /inference="protein motif:Pfam:PF03646" FT /protein_id="CAL34693.1" FT /translation="MEISKANGQMDTALANISQRTSETQASLNIQTDRSQGQEGDDGQQ FT RGVSEKLADITKKLNEQMDSLDTNVRFGYSDKIGSMYISVTEKSTGREIRQIPSEEAMR FT LAEYFRDVIGMIFDKES" FT misc_feature 510220..510543 FT /note="HMMPfam hit to PF03646, FlaG protein, score 4.7e-42" FT /inference="protein motif:Pfam:PF03646" FT CDS 510552..512480 FT /transl_table=11 FT /gene="fliD" FT /locus_tag="Cj0548" FT /product="flagellar hook-associated protein" FT /note="Original (2000) note: Cj0548, fliD, probable FT flagellar hook-associated protein, len: 642 aa; similar to FT e.g. FLID_ECOLI flagellar hook-associated protein 2 (467 FT aa), fasta scores; opt: 217 z-score: 274.0 E(): FT 5.8e-08,26.0% identity in 511 aa overlap. 25.5% identity to FT HP0752" FT /note="Updated (2006) note: Pfam domain PF02465 Flagellar FT hook-associated protein 2 C-terminus, PF07196 Flagellin FT hook IN motif and PF07195 Flagellar hook-associated protein FT 2 were all identified within CDS. Further support given to FT product function. Characterised within Helicobacter pylori FT with acceptable identity score. Putative not added to FT product function. Functional classification - Surface FT structures" FT /note="PMID:10559162" FT /db_xref="GOA:Q9PHW6" FT /db_xref="InterPro:IPR003481" FT /db_xref="InterPro:IPR010809" FT /db_xref="InterPro:IPR010810" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHW6" FT /inference="protein motif:Pfam:PF07195" FT /inference="protein motif:Pfam:PF07196" FT /inference="protein motif:Pfam:PF02465" FT /protein_id="CAL34694.1" FT /translation="MAFGSLSSLGFGSGVLTQDTIDKLKEAEQKARIDPYTKKIEENTT FT KQKDLTEIKTKLLSFQTAVSSLADATVFAKRKVVGSISDNPPASLTVNSGVALQSMNIN FT VTQLAQKDVYQSKGLANDGGFVNAQLNGTADLTFFSNGKEYTVTVDKNTTYRDLADKIN FT EASGGEIVAKIVNTGEKGTPYRLTLTSKETGEDSAISFYAGKKDSNGKYQKDINAEKIF FT DDLGWGLDVSASIDPDKDKKGYGIKDASLHIQTAQNAEFTLDGIKMFRSSNTVTDLGVG FT MTLTLNKTGEINFDVQQDFEGVTKAMQDLVDAYNDLVTNLNAATDYNSETGTKGTLQGI FT SEVNSIRSSILADLFDSQVVDGTTEDANGNKVNTKVMLSMQDFGLSLNDAGTLSFDSSK FT FEQKVKEDPDSTESFFSNITKYEDINHTGEVIKTGSLSKYLNSNGGNTNGLEFKPGDFT FT IVFNNQTYDLSKNSDGTNFKLTGKTEEELLQNLANHINSKGIEGLKVKVESYNQNNVTG FT FRLNFSGDGSSDFSIKGDANILKELGLSDVNITSKPIEGKGIFSKLKATLQEMTGKDGS FT ITKYDESLTNDIKSLNTSKDSTQAMIDTRYDTMANQWLQYESILNKLNQQLNTVTNMIN FT AANNSNN" FT misc_feature 510585..510890 FT /note="HMMPfam hit to PF02465, Flagellar hook-associated FT protein, score 2.3e-33" FT /inference="protein motif:Pfam:PF02465" FT misc_feature 510954..511127 FT /note="HMMPfam hit to PF07196, Flagellin hook IN FT motif,score 2.1e-10" FT /inference="protein motif:Pfam:PF07196" FT misc_feature 511317..512042 FT /note="HMMPfam hit to PF07195, Flagellar hook-associated FT protein, score 4e-75" FT /inference="protein motif:Pfam:PF07195" FT CDS 512492..512878 FT /transl_table=11 FT /gene="fliS" FT /locus_tag="Cj0549" FT /product="flagellar protein" FT /note="Original (2000) note: Cj0549, fliS, probable FT flagellar protein, len: 128 aa; similar to e.g. FLIS_SALTY FT flagellar protein FLIS (135 aa), fasta scores; opt: 190 FT z-score: 343.0 E(): 8.2e-12, 34.2% identity in 117 aa FT overlap. 60.5% identity to HP0753" FT /note="Updated (2006) note: Pfam domain PF02561 Flagellar FT protein FliS was identified within CDS. Further support FT given to product function. Characterised within Bacillus FT subtilis and others with marginal identity scores. Putative FT not added to product function. Functional classification - FT Surface structures" FT /note="PMID:8195064, PMID:1527488, PMID:10559162" FT /db_xref="GOA:Q0PAW7" FT /db_xref="InterPro:IPR003713" FT /db_xref="UniProtKB/TrEMBL:Q0PAW7" FT /inference="protein motif:Pfam:PF02561" FT /protein_id="CAL34695.1" FT /translation="MQNNLAYNAYSQNQVGIESPQKLIEMLYEGILRFCARAKVAIRNE FT DIEQRVYFVKRTTAIFIELINTLNYEKGGEVAHYLSGLYTREIQLLSLANLENNEDRIN FT EVINVTKGLLEAWREVHNNETVAQ" FT misc_feature 512495..512863 FT /note="HMMPfam hit to PF02561, Flagellar protein FliS,score FT 7.5e-35" FT /inference="protein motif:Pfam:PF02561" FT CDS 512859..513134 FT /transl_table=11 FT /locus_tag="Cj0550" FT /product="hypothetical protein Cj0550" FT /note="Original (2000) note: Cj0550, unknown, len: 91 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAW6" FT /protein_id="CAL34696.1" FT /translation="MKQWLSDFKLALIQEDVNKLENLLDELDMKAFIKNLAKESPSEDF FT LKENANDVFYQVQALLQEAVILIEQKKKTKAVEIQKFQKALTYFKS" FT misc_RNA complement(513138..513451) FT /gene="rnpB" FT /product="RNA component of RNase P" FT /note="Updated (2006) note: Rfam RF00010, Bacterial RNase P FT class A has now been identified within CDS. Further support FT given to product function" FT /note="rnpB, RNA component of RNase P, similar to many e.g. FT EMBL:BBRNASEP Z30953 B.burgdorferi (B31) RNase P RNA gene, FT wublastn score; E = 9.3e-14, 69% identity in 204 bp overlap FT and 74% identity in 71 bp overlap" FT CDS 513566..514135 FT /transl_table=11 FT /gene="efp" FT /locus_tag="Cj0551" FT /product="elongation factor P" FT /note="Original (2000) note: Cj0551, efp, probable FT elongation factor P, len: 189 aa; highly similar to many FT e.g. EFP_BACSU elongation factor P (EF-P) (185 aa), fasta FT scores; opt: 586 z-score: 959.7 E(): 0, 45.9% identity in FT 183 aa overlap. 73.5% identity to HP0177. Contains Pfam FT match to entry PF01132 EFP, Elongation factor P FT (EF-P),score 373.00, E-value 3e-108" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Protein translation and modification" FT /note="PMID:9195040" FT /db_xref="GOA:Q9PHW3" FT /db_xref="InterPro:IPR001059" FT /db_xref="InterPro:IPR008991" FT /db_xref="InterPro:IPR011768" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR013185" FT /db_xref="InterPro:IPR014722" FT /db_xref="InterPro:IPR015365" FT /db_xref="InterPro:IPR016027" FT /db_xref="InterPro:IPR020599" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHW3" FT /inference="protein motif:Pfam:PF01132" FT /protein_id="CAL34697.1" FT /translation="MASYSMGDLKKGLKIEIDGIPFKIVEYQHVKPGKGPAFVRIKIKS FT FIDGKVLEKTFHAGDKCEAPNLEDKTMQYLYDDGENCQFMDTQTYEQVAISDDDVGEAK FT KWMLDGMMVDVLFHNGKAIGVEVPQVVELKIIETAPNFKGDTQGSNKKPATLETGAVVQ FT IPFHVLEGEVIRVDTVRGEYIERANK" FT misc_feature 513572..514126 FT /note="HMMPfam hit to PF01132, Elongation factor P FT (EF-P),score 1.7e-109" FT /inference="protein motif:Pfam:PF01132" FT CDS 514295..514987 FT /transl_table=11 FT /locus_tag="Cj0552" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0552, unknown, len: 230 aa; FT no Hp match. Hydrophobic" FT /note="Updated (2006) note: Pfam domain PF06149 Protein of FT unknown function (DUF969) identified within CDS. This is a FT family of uncharacterised bacterial membrane proteins. Also FT identified were four probable transmembrane helices FT predicted by TMHMM2.0. Product function has been changed FT due to these results. Functional classification -Membranes, FT lipoproteins and porins" FT /db_xref="InterPro:IPR010374" FT /db_xref="UniProtKB/TrEMBL:Q0PAW4" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF06149" FT /protein_id="CAL34698.1" FT /translation="MEWLLLASIPLIVLGFALKINPFLVVTSVGIYAGLVSGFDFVKVV FT SDIGKSFVDNRYVAIIWLILPLLAVLERKGLREQAKNLISKIKVASTGRILMCYFVFRQ FT VTAALGLLSLGGHAQMIRPLIAPMAEAAAKLKFKNLTHKDSQKIKAFSAGTDNVAVFFG FT EDIFIAVHSILFIKAFYESNGIIVEPLHLSVWAIPTGILALIIHCSRLYLFDKRLEKTY FT KGLSDDKS" FT misc_feature 514295..514960 FT /note="HMMPfam hit to PF06149, Protein of unknown function FT (DUF969), score 3.4e-157" FT /inference="protein motif:Pfam:PF06149" FT misc_feature order(514352..514420,514448..514507,514589..514657, FT 514868..514936) FT /note="4 probable transmembrane helices predicted for FT Cj0552 by TMHMM2.0 at aa 20-42, 52-71, 99-121 and 192-214" FT /inference="protein motif:TMHMM:2.0" FT CDS 514974..515927 FT /transl_table=11 FT /locus_tag="Cj0553" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0553, probable integral FT membrane protein, len: 317 aa; no Hp match" FT /note="Updated (2006) note: Pfam domain PF06166 Protein of FT unknown function (DUF979) identified within CDS. This FT family consists of several putative bacterial membrane FT proteins. The function of this family is unclear. Also FT identified were nine probable transmembrane helices FT predicted by TMHMM2.0. Further support for product FT function. Functional classification - FT Membranes,lipoproteins and porins" FT /db_xref="InterPro:IPR009323" FT /db_xref="UniProtKB/TrEMBL:Q0PAW3" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF06166" FT /protein_id="CAL34699.1" FT /translation="MISLDLLYYIVGILFLVFGILSFSNQAKDIKSRISGGVFWISYSF FT TFLLAGVLPHFVMGCIVILLALIAGFNLLKPAKIEVSKEEKEYEIKHANIYKNKLFIPA FT LMVPLITLIGTFLFPYLSFFENKNATLMALIIGIIISSVVACFMFKASPKRAVKDAAHT FT MDHISWAALLPQILATLGVVFVSTGMGDQVSKLLSSYISLDNAFIAVAVYCIAMALFTI FT VMGNAFAAFPVITAAIALPILIIQMHANPAIIGAIGMLSGFCGTLMTPMAANFNIVPAA FT LLNLDDKNGVIKAQFMSGLVLLVANIFLMYFLAFRF" FT misc_feature 514983..515918 FT /note="HMMPfam hit to PF06166, Protein of unknown function FT (DUF979), score 4.2e-214" FT /inference="protein motif:Pfam:PF06166" FT misc_feature order(514989..515048,515109..515177,515271..515339, FT 515358..515426,515469..515537,515574..515642, FT 515655..515708,515727..515795,515853..515918) FT /note="9 probable transmembrane helices predicted for FT Cj0553 by TMHMM2.0 at aa 6-25, 46-68, 100-122, FT 129-151,166-188, 201-223, 228-245, 252-274 and 294-315" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 515121..515153 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 515379..515411 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 515937..516941 FT /transl_table=11 FT /locus_tag="Cj0554" FT /product="hypothetical protein Cj0554" FT /note="Original (2000) note: Cj0554, unknown, len: 334 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="InterPro:IPR021365" FT /db_xref="UniProtKB/TrEMBL:Q0PAW2" FT /protein_id="CAL34700.1" FT /translation="MEKFIKQFSFIALENIFRELPNKITHSFNDINDIKPPKLMYPIFY FT GSYDWHSSVHSHWLLVKILKDFSHFAPKDEIIKALDSQFSKEKAEGELKYLQNPAHKGF FT ERPYGWGWFLKLTLEINLLAKENDKAEIWAKNLEGIADFFVKEFKEFLPKMDYPIRVGT FT HFNSSFALYFALEYARFKKDQELEYCIIQSAKKWFLNDKNMQALEPCGDEFLSPVLMEA FT VLLSAVLHKNDFVKFFKAYLPNLEAKEPATLFTPVSVSDRSDGKIAHLDGLNLSRAWCF FT KILSNFCDENLKILLRNNATEHFDKAIAHIEDDYLGSHWLGSFALLALDVDIL" FT CDS 517060..518352 FT /transl_table=11 FT /locus_tag="Cj0555" FT /product="putative dicarboxylate carrier protein MatC" FT /note="Original (2000) note: Cj0555, probable integral FT membrane protein, len: 430 aa; similar in N-terminus to an FT ORF within the Streptococcus pneumoniae cps3E and rpt FT pseudogene region TR:P72556 (EMBL:U66846) orf5 (197 FT aa),fasta scores; opt: 493 z-score: 726.3 E(): 3.7e-33, FT 47.4% identity in 152 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF07158 FT Dicarboxylate carrier protein MatC N-terminus identified FT within CDS. This family represents the N-terminal region of FT the bacterial dicarboxylate carrier protein MatC. MatC FT protein is an integral membrane protein that can function FT as a malonate carrier (PMID:9826185). Also identified were FT eleven probable transmembrane helices predicted by FT TMHMM2.0. Product modified to more specific family member FT due to motif match. No specific characterisation has been FT carried out, so putative kept within product function. FT Functional classification - Carbohydrates, organic acids FT and alcohols" FT /note="PMID:9826185" FT /db_xref="InterPro:IPR009827" FT /db_xref="UniProtKB/TrEMBL:Q0PAW1" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF07158" FT /protein_id="CAL34701.1" FT /translation="MIMVFLIISSIIVAIILGYITRHNVGIFAMIFAYIIGAFFMDLAP FT KKIIAFWPISIFFVIFAVSLFYNFATVNGTLEKLAGHLMYRFANHPYLLPFVIFVVSAI FT IAALGAGFYTVLAFMAPLTFLLCDKIGLSKIAGAMAINYGALGGANFITSQSGIIFRGL FT MENSGIEANEAFANSSIIFAFTIILPIVVLSFFVFNAFKNNIKISVISKPDPFDYKQKT FT TLILMFMMIVVVLIFPVLNIIFPHNETISYFNKKIDIAMIAMIFVAIALFLKLADEKQV FT VALIPWGTLIMICGVGMLISIAVEAGAIKLFSDLVENEINVIFIPLIMCAIAAFMSLFS FT STLGVVTPALFPIVPSIAASSGLSEALLFSCIVVGAQASAISPFSSGGSLILGSCPDKY FT KEKLFKDLLIKAVPIGFIAAILATIIMSFIL" FT misc_feature 517060..517506 FT /note="HMMPfam hit to PF07158, Dicarboxylate carrier FT protein MatC N-terminu, score 5e-36" FT /inference="protein motif:Pfam:PF07158" FT misc_feature order(517063..517119,517129..517182,517201..517269, FT 517339..517407,517468..517536,517594..517662, FT 517723..517791,517834..517887,517900..517968, FT 518026..518094,518278..518346) FT /note="11 probable transmembrane helices predicted for FT Cj0555 by TMHMM2.0 at aa 2-20, 24-41, 48-70, FT 94-116,137-159, 179-201, 222-244, 259-276, 281-303, 323-345 FT and 407-429" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 518212..518244 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 518363..519160 FT /transl_table=11 FT /locus_tag="Cj0556" FT /product="putative amidohydrolase family protein" FT /note="Original (2000) note: Cj0556, unknown, len: 265 aa; FT no Hp match" FT /note="Updated (2006) note: Pfam domain PF04909 FT Amidohydrolase identified within CDS. Product modified to FT more specific family member due to motif match. No specific FT characterisation has been carried out yet. Putative kept FT within product function. Functional classification - Misc" FT /db_xref="GOA:Q0PAW0" FT /db_xref="InterPro:IPR006992" FT /db_xref="UniProtKB/TrEMBL:Q0PAW0" FT /inference="protein motif:Pfam:PF04909" FT /protein_id="CAL34702.1" FT /translation="MKIDTHAHIFLKKLNTVANARYKPDYDASFKDYKANLDHYDFNKG FT VLVQPSFLGIDNEFLLQSIEKDENIKAIVVVDENIKFDELKKLKERKACGVRLNLIGKE FT LPNFKSMVWTQFFENLSKLKMQIEIQRDLDNNLVDIVENLIPYGCNIVIDHLARANANL FT TNLEDLICLKNSRIFFKISGFYRAKIDYANNEQAVKFAKKIYEILKEHFPLSNFVFGSD FT WPHTNFEANINFSSALVAFNEVVVSKKEQEQILGDNACALFGF" FT misc_feature 518369..519157 FT /note="HMMPfam hit to PF04909, Amidohydrolase, score FT 9.5e-37" FT /inference="protein motif:Pfam:PF04909" FT CDS complement(519157..520242) FT /transl_table=11 FT /locus_tag="Cj0557c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0557c, probable integral FT membrane protein, len: 361 aa; similar in C terminus to FT hypothetical proteins from B. subtilis and E. coli: FT TR:O32225 (EMBL:O32225) YVAC (631 aa), fasta scores; opt: FT 271 z-score: 562.0 E(): 5.2e-24, 29.9% identity in 187 aa FT overlap, and YHFK_ECOLI (696 aa), fasta scores; opt: 182 FT z-score: 212.9 E(): 0.00015, 27.8% identity in 133 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Nine probable transmembrane FT helices predicted by TMHMM2.0. Further support added to FT product function. Functional classification - FT Membranes,lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PAV9" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34703.1" FT /translation="MNKIEILKQHFKEIAKLNSSEQVWQMPFFAALGVGIVLGLSVFFG FT KLNYGLIAMIGALSFLYVPSTPLYHRMAVVMCCSFGIVSSFFLGILTHFLPAIFAFIPI FT GIMAMGSSILIRYYNIGAPGYFFFVFSCVLGAYSPFEAKDFIFLVGLVFLGAMVANLMA FT LLYSIVVIYGFKNALPSEIPPREYIGFDAVFVDSLIMGSFVAFSIFIGTFLELERSYWI FT AISCTAIMQGVTLNSIWIKQIQRIIGTALGVCFAWWLLSKQFHDIELILLMMSLFFIGQ FT FLVNRNYALAMIFFTPYATYLSEAANFMSENADKLILARLIDVVIGSILGLLGGFVIYK FT PYLRVHFERIAKYIFRIKQKA" FT misc_feature complement(join(520108..520176,520045..520104, FT 519919..519987,519832..519900,519721..519789, FT 519616..519684,519523..519588,519337..519396, FT 519226..519294)) FT /note="9 probable transmembrane helices predicted for FT Cj0557c by TMHMM2.0 at aa 23-45, 47-66, 86-108, FT 115-137,152-174, 187-209, 219-240, 283-302 and 317-339" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(519847..519879) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(520239..521471) FT /transl_table=11 FT /gene="proA" FT /locus_tag="Cj0558c" FT /product="gamma-glutamyl phosphate reductase" FT /EC_number="1.2.1.41" FT /note="Original (2000) note: Cj0558c, proA, gamma-glutamyl FT phosphate reductase, len: 410 aa; 98.8% identical to FT PROA_CAMJE gamma-glutamyl phosphate reductase (EC 1.2.1.41) FT (410 aa), and similar to e.g. PROA_ECOLI (417 aa), fasta FT scores; opt: 985 z-score: 1513.2 E(): 0, 38.6% identity in FT 407 aa overlap. No Hp match. Contains PS01223 FT Gamma-glutamyl phosphate reductase signature and Pfam match FT to entry PF00696 aakinase, Aspartate kinases,Glutamate FT kinases and Gamma glutamate phospho-reductases,score FT 219.50, E-value 5.1e-62" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Functional classification - Amino FT acid biosynthesis - Glutamate family" FT /note="PMID:8341262" FT /db_xref="GOA:P53000" FT /db_xref="InterPro:IPR000965" FT /db_xref="InterPro:IPR012134" FT /db_xref="InterPro:IPR015590" FT /db_xref="InterPro:IPR016161" FT /db_xref="InterPro:IPR016162" FT /db_xref="InterPro:IPR016163" FT /db_xref="InterPro:IPR020593" FT /db_xref="UniProtKB/Swiss-Prot:P53000" FT /inference="protein motif:Pfam:PF00696" FT /inference="protein motif:Prosite:PS01223" FT /protein_id="CAL34704.1" FT /translation="MRNLLENIKKNSQKLLNLTPKDKEKIILKLAQILRENFKIILEAN FT KKDMANFTKSGAMKDRLLLDEKRILALCEGLEKIAYIEDPIGKISKGWKNYAGLSIQKM FT SIPLGLICVIYEARPSLSAEIAALMIKSSNACVFKGGSEAKFTNEAIFTLVNKVLKEFD FT LQDCFAMFTQRDEILQILAFDDLIDVIIPRGSSNMIQEIANNTKIPLIKQNKGLCHAFV FT DQSANLDMALKIILNAKCQRVSVCNALETLLIHEKIAKNFISLLIPEFEKFKVKIHAHE FT NALAYFNNSNLKIFKANENTFDTEWLDFALSVKLVKDCDEAIEHINKHSSLHSETIISN FT DASNIAKFQRLINSSCIYANASTRFSDGGEFGFGGEVGISTSKLHARGPMGIEDICTYK FT YIINGEGQIRE" FT misc_feature complement(520461..520526) FT /note="PS01223 Gamma-glutamyl phosphate reductase FT signature" FT /inference="protein motif:Prosite:PS01223" FT CDS 521542..522477 FT /transl_table=11 FT /locus_tag="Cj0559" FT /product="putative pyridine nucleotide-disulphide FT oxidoreductase" FT /note="Original (2000) note: Cj0559, probable FT oxidoreductase, len: 311 aa; similar to members of the FT pyridine nucleotide-disulfide oxidoreductases class-II FT family e.g. R34K_CLOPA 34.2 KD protein in rubredoxin operon FT (308 aa), fasta scores; opt: 217 z-score: 335.8 E(): FT 2.1e-11, 23.2% identity in 314 aa overlap, and TRXB_BACSU FT thioredoxin reductase (315 aa), fasta scores; opt: 192 FT z-score: 279.9 E(): 2.7e-08, 25.9% identity in 313 aa FT overlap. 46.3% identity to HP1164. Contains possible FT N-terminal signal sequence and PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site" FT /note="Updated (2006) note: Pfam domain PF00070 Pyridine FT nucleotide-disulfide oxidoreductase identified within CDS. FT Product modified to more specific family member due to FT motif match. No specific characterisation with acceptable FT identity score has been carried out yet. Putative kept FT within product function. Functional classification - Misc" FT /db_xref="GOA:Q0PAV7" FT /db_xref="InterPro:IPR000103" FT /db_xref="InterPro:IPR001327" FT /db_xref="InterPro:IPR013027" FT /db_xref="InterPro:IPR023753" FT /db_xref="UniProtKB/TrEMBL:Q0PAV7" FT /inference="protein motif:Pfam:PF00070" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34705.1" FT /translation="MKKIDLIVVGAGPTGIGCAVEAKLKNKEVLILEKSNNICQTLMQF FT YKDGKRVDKAYKGCEGTNHGHVPFEDGTKESTIETFQNALKEHNIEVEFGSEVESVKNE FT NGVFLVSTAKGVYECKNIIVAIGRMGKPNKPDYKLPMTLTKIINFNANSVLGNEKILVV FT GGGNSAAEYAVDLANSNQVSLCYRKKEFTRLNDINLKDIHEAGNSGKVELKLGIDINEV FT EDDNGKAKVNFTDGTSDIYDRIIYAIGGSTPLDFLQKCGINVDDKGVPLMDENKQSNVK FT GIFVAGDIATKNGASIVTGLNDAVKILSVL" FT misc_feature 521554..522423 FT /note="HMMPfam hit to PF00070, Pyridine FT nucleotide-disulphide oxidoreducta, score 1.7e-25" FT /inference="protein motif:Pfam:PF00070" FT misc_feature 521563..521595 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 522658..523986 FT /transl_table=11 FT /locus_tag="Cj0560" FT /product="putative MATE family transport protein" FT /note="Original (2000) note: Cj0560, probable integral FT membrane protein, len: 442 aa; similar to many hypothetical FT proteins e.g. Y709_METJA MJ0709 (450 aa),fasta scores; opt: FT 402 z-score: 324.8 E(): 8.5e-11, 21.0% identity in 429 aa FT overlap. 26.3% identity to HP1184" FT /note="Updated (2006) note: Pfam domain PF01554 MatE FT identified within CDS. Prosite domain PS00589 FT PTS_HPR_SER,Phosphotransferase system, HPr serine FT phosphorylation site also identified. Twelve probable FT transmembrane helices predicted by TMHMM2.0. Characterised FT members of the Multi Antimicrobial Extrusion (MATE) family FT function as drug/sodium antiporters. These proteins mediate FT resistance to a wide range of cationic dyes, FT fluroquinolones,aminoglycosides and other structurally FT diverse antibodies and drugs. MATE proteins are found in FT bacteria, archaea and eukaryotes. These proteins are FT predicted to have 12 alpha-helical transmembrane regions FT (which this one does). Product modified to more specific FT family member due to motif match. No specific FT characterisation with acceptable identity scores has been FT carried out yet. Putative kept within product function. FT Literature search identified paper giving further clues to FT product function. Functional classification - Central FT intermediary metabolism -General" FT /note="PMID:16048946" FT /db_xref="GOA:Q0PAV6" FT /db_xref="InterPro:IPR002528" FT /db_xref="InterPro:IPR015522" FT /db_xref="UniProtKB/TrEMBL:Q0PAV6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01554" FT /inference="protein motif:Prosite:PS00589" FT /protein_id="CAL34706.1" FT /translation="MSSIFSTLSPFRLFVKYAVPNVISMAFISFYYIVDGIFVGKYLGS FT DALAALALIIPFIMMSFALADMIAIGSAVQISMHLGLGKKNLARKIFSSSMLIIFIISC FT FIGILEYFLGPVLIDCLNVSDEIKTMTKECMFVFALFAPFTMLSFALDNYLRICGKTAY FT SMVMNVIIALSNIVLDYIFIVELGWGLFSAALATCLGLVLGGIFGIFPFLFQNLELKIS FT SLYMNLKIFKNILYNGSSEFFGNISGSLYSIFANFVLLKISDTQAVAAFSIVLYIDSFI FT IMLIIAIGDAMQPALSYNYAKKDFSRIKAIIKVVFFAGGFLSLFSIVLILIFGENLITL FT FTKENNQEFKTFAYTALMLFAFNYFFAWFNVLSGSFLTAFNKASFSLVLSLAQNLFIPL FT FFLLFLSCFMGLNGVWLSPFFAEFCVLILAWIFLKRIFKDLSL" FT misc_feature order(522694..522759,522802..522870,522928..522996, FT 523060..523128,523153..523221,523231..523299, FT 523360..523428,523456..523524,523585..523653, FT 523711..523779,523816..523884,523897..523956) FT /note="12 probable transmembrane helices predicted for FT Cj0560 by TMHMM2.0 at aa 13-34, 49-71, 91-113, FT 135-157,166-188, 192-214, 235-257, 267-289, 310-332, FT 352-374,387-409 and 414-433" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 522715..523200 FT /note="HMMPfam hit to PF01554, MatE, score 9.6e-25" FT /inference="protein motif:Pfam:PF01554" FT misc_feature 522937..522969 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 523339..523386 FT /note="PS00225 Crystallins beta and gamma 'Greek key' motif FT signature" FT /inference="protein motif:Prosite:PS00225" FT misc_feature 523846..523878 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(524034..524963) FT /transl_table=11 FT /locus_tag="Cj0561c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0561c, possible periplasmic FT protein, len: 309 aa; no Hp match" FT /note="Updated (2006) note: possible changed to putative. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /db_xref="InterPro:IPR016896" FT /db_xref="UniProtKB/TrEMBL:Q0PAV5" FT /protein_id="CAL34707.1" FT /translation="MKKYLFSCVLASILTQSATAVEFQEGFSGNLSIGVGARDIKSNIS FT TLANSDYLSSHNADNSDSSFIPFIGAELYYGNLIDNDRIFIKNYNGRDISGIALGYERA FT YLERFSTSFSVISSLREKAYANPYAIGNREETDVDRYGFKISQLYESDFGKFTTSYLFS FT KNKYDKDTIAQSSLKREGYYHEIELNYNYSLLNLGLNYDYNDADGKAQSYSRYGFSIGT FT NLAFANDYIFTPNLNLSKYEAVGTDPIFHKKQDGNIVKLNLKVVKNQFLGYNGLYGFAN FT YGIEKRNSDIGFYDETYQIVLTGIGYKF" FT sig_peptide complement(524853..524963) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000259_524034_524963 by SignalP 2.0 FT HMM (Signal peptide probability 0.944) with cleavage site FT probability 0.398 between residues 37 and 38" FT CDS 525117..526493 FT /transl_table=11 FT /gene="dnaB" FT /locus_tag="Cj0562" FT /product="replicative DNA helicase" FT /EC_number="3.6.1.-" FT /note="Original (2000) note: Cj0562, dnaB, probable FT replicative DNA helicase, len: 458 aa; similar to many e.g. FT DNAB_ECOLI replicative DNA helicase (EC 3.6.1.-) (471 aa), FT fasta scores; opt: 779 z-score: 1038.7 E(): 0,35.8% FT identity in 458 aa overlap. 38.1% identity to HP1362. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop) and FT Pfam match to entry PF00772 DnaB, DnaB-like helicase, score FT 348.90, E-value 5.6e-101" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -DNA replication, restriction/modification, recombination FT and repair" FT /note="PMID:6323420" FT /db_xref="GOA:Q0PAV4" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR007692" FT /db_xref="InterPro:IPR007693" FT /db_xref="InterPro:IPR007694" FT /db_xref="InterPro:IPR016136" FT /db_xref="UniProtKB/TrEMBL:Q0PAV4" FT /inference="protein motif:Pfam:PF00772" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34708.1" FT /translation="MQQEYYDLDLERAILSSCIMSEEAYASIAGDISPKDFSLKAHQDI FT FKAVIACSNNKEPISVSFLRKHKKIDEQILAEILATPSMIDLPAYVNELHEKSVKRQLL FT SFAHLLPTRINEDRAVSEIADEIGKEIFSITNRVNSRDIKDVDMVISELFEEFKKQKTL FT ENKGIIGLDTGFEGLNKMTKGFKGGELIIIAARPGMGKTTLCLNFIDKVLRQKKGVALF FT SLEMPATQIMQRMLSSKTSIPLQKILTADLNDDEWERLGDACNDYSQKKLYIYDSGYAT FT IADVRAILRRLKSQDESIGLCVIDYIGLMMSNSNFNDRHLQVSEISRGLKLLARELDMP FT IIALSQLNRGLEQRANKRPLMSDLRESGAIEQDADAILFVYRDEVYREQEEKERENKAK FT AEGKAYQRLFIPNPMQENAEIIVGKNRNGPVGTIEVVFLKEKSCFVDKPIGYETTEFTG FT " FT misc_feature 525123..525404 FT /note="HMMPfam hit to PF00772, DnaB-like helicase N FT terminal domain, score 1.2e-24" FT /inference="protein motif:Pfam:PF00772" FT misc_feature 525615..526208 FT /note="HMMPfam hit to PF03796, DnaB-like helicase C FT terminal domain, score 5.7e-117" FT /inference="protein motif:Pfam:PF03796" FT misc_feature 525699..525722 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 526556..527158 FT /transl_table=11 FT /locus_tag="Cj0563" FT /product="hypothetical protein Cj0563" FT /note="Original (2000) note: Cj0563, unknown, len: 200 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAV3" FT /protein_id="CAL34709.1" FT /translation="MFYTFFVILKQGEKMLKQIAFGSIALTATGYGIKKLYEKLSKPER FT KFDTHAIVPSCKDVINTEEYKLKRELEIEQKKNQIQEFLCECMECYSGFSKYFNSKEFL FT EFEQNFTSKNNHKTEFLLSSYKDQMIKVIDYAKKFKCLSAFLETQSEKNDLAVVKMISE FT SMERKTQRFYLQTKFQTFPQYIFPSVWSSPMWDKQWE" FT CDS 527149..527355 FT /transl_table=11 FT /locus_tag="Cj0564" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0564, probable integral FT membrane protein, len: 68 aa; no Hp match" FT /note="Updated (2006) note: Two probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PAV2" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34710.1" FT /translation="MGIILGILSLIAGFVAIVLMCGLYFIAFMVFVGIAILIFLSMQPY FT PYNIIFCAIYLITILALVLWRKT" FT sig_peptide 527149..527244 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000261_527149_527355 by SignalP 2.0 FT HMM (Signal peptide probability 0.604) with cleavage site FT probability 0.420 between residues 32 and 33" FT misc_feature order(527167..527262,527275..527343) FT /note="2 probable transmembrane helices predicted for FT Cj0564 by TMHMM2.0 at aa 7-38 and 43-65" FT /inference="protein motif:TMHMM:2.0" FT repeat_region 527378..527389 FT /note="G(12)" FT CDS join(527436..527714,527714..528163) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0565" FT /product="pseudogene (conserved hypothetical protein)" FT /note="Original (2000) note: Cj0565, probable FT pseudogene,len: 725 bp; similar to three consecutive genes FT in Hp; HP1587, HP1588 and HP1589" FT /note="Updated (2006) note: Pfam domain PF03667 FT Uncharacterised protein family (UPF0174) identified within FT CDS. Conserved introduced to product function as motif FT identified. Coding sequence has been updated to reflect the FT complete amino acid sequence for the encoded protein FT regardless of its expression. This will cause differences FT from the amino acid sequence of the previous annotation. FT Functional classification - Conserved hypothetical FT proteins" FT /inference="protein motif:Pfam:PF03667" FT misc_feature order(527541..527714,527714..528154) FT /note="HMMPfam hit to PF03667, Uncharacterised protein FT family (UPF0174), score 3.1e-51" FT /inference="protein motif:Pfam:PF03667" FT CDS 528182..529648 FT /transl_table=11 FT /locus_tag="Cj0566" FT /product="hypothetical protein Cj0566" FT /note="Original (2000) note: Cj0566, unknown, len: 488 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAV1" FT /protein_id="CAL34712.1" FT /translation="MENICQFIIENIDKNSLNTKKIKLVFNMQEQEITTISKIFKVSSE FT HIIAFYDTSTSFNYFSKTTGICFTGKEVIFKRKEDEVLMKINYEDFKEANKSLPEKTTT FT LQDIKFPISFHNLGTSYLSFDDFKKKNYIEENDELIINFLHILTSKNNIESFKNESMFP FT QALEKTNESIKENYIKVIIKIILDQYGFLDEKRSIKIFALMNKINVASETRYKIQDFLH FT NKHSSFEDLLNIIKQESRFMQFKYILISLIKDLIDIDFEDNKIYNFLYENKDIFKIKDL FT KEIYWVKEIIKKEYQIILDDNKEIQQIFNFISETATKNNISLNGLHLSGMTIGMSVSIM FT ELLGFGELIKLPLIDSSKKYHNKNKQQLRLFIIQEILKENQKTITQIIDIINNLIEQCN FT TNTQNLQELIKLLKLASKNNETFKEREKLLYCPETLSLITINNHLKEDDIQFIEQYYTY FT NQNTHKYERNDNLSSSDLEKLSNFFKLKNL" FT CDS 529659..529772 FT /transl_table=11 FT /locus_tag="Cj0567" FT /product="hypothetical protein Cj0567" FT /note="Original (2000) note: Cj0567, unknown, len: 37 aa; FT no Hp match" FT /note="Updated (2006) note: Paper identified linking FT product function to iron transport or metabolism. FT Functional classification - Unknown" FT /note="PMID:15632442" FT /db_xref="UniProtKB/TrEMBL:Q0PAV0" FT /protein_id="CAL34713.1" FT /translation="MDKIQENTKIEKAILAEKQQIFLIQNKLSEIEKNIKE" FT CDS 529974..530255 FT /transl_table=11 FT /locus_tag="Cj0568" FT /product="hypothetical protein Cj0568" FT /note="Original (2000) note: Cj0568, unknown, len: 93 aa; FT no Hp match" FT /note="Updated (2006) note: One probable transmembrane FT helices predicted by TMHMM2.0. Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAU9" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34714.1" FT /translation="MITYSNLSDVKKRIEDEFTHRNAECDKYDYLIAITCGAIAGIMDI FT FLVGNPKDSYLGKKVDKTVEKMTQKFAQLCGWDKQKALDKNKDLTKSV" FT misc_feature 530061..530120 FT /note="1 probable transmembrane helix predicted for Cj0568 FT by TMHMM2.0 at aa 30-49" FT /inference="protein motif:TMHMM:2.0" FT CDS 530261..531130 FT /transl_table=11 FT /locus_tag="Cj0569" FT /product="hypothetical protein Cj0569" FT /note="Original (2000) note: Cj0569, unknown, len: 289 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAU8" FT /protein_id="CAL34715.1" FT /translation="MENKFKINYDQTTTNGRNGTNGKVDNLSMKNHHLKSIGHSPDIFG FT LFVSIVNQFTNTSTFVSNGKIITIDTNTFELQGGNFIAKIFCGFFNWFGHLASDWCGSS FT GGKERGAGIPMPFYNLFLLCDFGNFGQHRQTLAQIATQVFEQGYDLRHGVTMSIPVMIN FT KMLIRFMYIIKAKFYHKKEWKECIPKDNIPELNKMLLIGSGTFLLIDTGGAWIKSKNPI FT TNPVVFLSEINLINVIRFSTLILKEIYILYNNGKIDNKKLEKYLDDTCKILLIEAHNKS FT KPFKEILK" FT CDS 531139..532206 FT /transl_table=11 FT /locus_tag="Cj0570" FT /product="putative ATP/GTP binding protein" FT /note="Original (2000) note: Cj0570, probable ATP/GTP FT binding protein, len: 355 aa; 85.1% identity to HP0729. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop). FT Functional classification - Conserved hypothetical FT proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAU7" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34716.1" FT /translation="MNHLLILYNPYYQEDVIKQHLSILQEKSQVAFGKIKSKLNDQEKQ FT NSLEEIYQSTNEENFLQLFLSDYANLFVAKVVKISKNVDESLIPSYYKEKNLEVEDFFI FT ISDLRELVREDFSRLRDKFLANFITPNDHTYAIYGNHYTYPLPVRLKEECSYFLGDEKH FT YLSVYKSKEYLAMQENFIRFVFGKRIFYLLHSDSISNIIHAELELLQSENDLLNDFTSI FT IVKYSKTLEYEIYAFAKKVLLKACMKDPSLYDLAYNVQGKSFILKDFFTQKPNLGSIKF FT LLRHENIQCHLGKSLTQFINYPFSKSLTIIQEIRNEAVHAKAPSLNEVKKLRNEILGIE FT GVSLLKRILTHKEIS" FT misc_feature 531904..531927 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 532203..533075 FT /transl_table=11 FT /locus_tag="Cj0571" FT /product="putative transcriptional regulator" FT /note="Original (2000) note: Cj0571, possible FT transcriptional regulator; len: 290 aa; similar in FT C-terminus to two hypothetical deoR family transcriptional FT regulators from E. coli; YFJR_ECOLI (233 aa), fasta scores; FT opt: 279 z-score: 374.9 E(): 1.4e-13, 27.7% identity in 202 FT aa overlap, and YAFY_ECOLI (285 aa), fasta scores; opt: 167 FT z-score: 203.3 E(): 0.0005, 40.4% identity in 57 aa FT overlap. No Hp match, Contains probable helix-turn-helix FT motif at aa 25-46 (Score 1541, +4.44 SD)" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores carried out yet. Putative FT kept within product function. Literature search identified FT paper linking product function to be involved in the FT stringent and heat shock responses within gut colonization. FT Functional classification - Broad regulatory functions" FT /note="PMID:15731081" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR013196" FT /db_xref="UniProtKB/TrEMBL:Q0PAU6" FT /protein_id="CAL34717.1" FT /translation="MKEYDKLSIRLVQILSKFNNGESLSAQELAQEFNVDTRTIQRDLN FT ERLTFMPIKKENGRYVLESFALGKLSFKDIQNFATLSGIAELYPKLDQGFIVDLLSHRV FT NKVLMVKNEGFQKVDYELFKDLSVAILKHNVLNFFYKEKERQIKPYKLVNYKGIWYLLG FT DENDKLKHFNLDKISKLRTKNENFIPNEKLEEQIQNDPNIWLGESKEVILKLDKNAKEY FT FFRKEILSNYQIIDKDETSYTLSTQVSYEDEILHLVKQWIPYIKILAPIELKIRLEDIL FT KSYLNNLSK" FT tRNA complement(533097..533172) FT /gene="tRNA-Met" FT /note="tRNA Met anticodon CAT, Cove score 88.22" FT tRNA complement(533206..533280) FT /gene="tRNA-Gln" FT /note="tRNA Gln anticodon TTG, Cove score 71.34" FT CDS 533373..534392 FT /transl_table=11 FT /gene="ribA" FT /locus_tag="Cj0572" FT /product="GTP cyclohydrolase II / 3,4-dihydroxy-2-butanone FT 4-phosphate synthase" FT /EC_number="3.5.4.25" FT /note="Original (2000) note: Cj0572, ribA, probable GTP FT cyclohydrolase II / 3,4-dihydroxy-2-butanone 4-phosphate FT synthase, len: 339 aa; similar to e.g. GCH2_BACSU GTP FT cyclohydrolase II (EC 3.5.4.25) / 3,4-dihydroxy-2-butanone FT 4-phosphate synthase (398 aa), fasta scores; opt: 688 FT z-score: 1219.9 E(): 0, 38.2% identity in 369 aa overlap. FT 50.0% identity to HP0804. Contains Pfam match to entry FT PF00926 DHBP_synthase, 3,4-dihydroxy-2-butanone 4-phosphate FT synthase, score 384.00, E-value 1.5e-111" FT /note="Updated (2006) note: Characterised within FT Helicobacter pylori and Bacillus subtilis with acceptable FT identity scores. Putative not added to product function. FT Functional classification - Biosynthesis of FT cofactors,prosthetic groups and carriers - Riboflavin" FT /note="PMID:11024263, PMID:1597419, PMID:8320220" FT /db_xref="GOA:Q9PHU4" FT /db_xref="InterPro:IPR000422" FT /db_xref="InterPro:IPR000926" FT /db_xref="InterPro:IPR016299" FT /db_xref="InterPro:IPR017945" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHU4" FT /inference="protein motif:Pfam:PF00926" FT /protein_id="CAL34718.1" FT /translation="MKFVSVEQAIKDLQAGKMLVMVDAEDRENEGDLIFPAQFSTQEKV FT NFMIKEARGVVCVALDETLAKKFELPLMVPKNTSNHETAFTITVDAKDATTGVSAYERN FT MTIQIFADDNAKASDFVRPGHINPLIAKKGGVLERTGHTEGTVDLCKLAGLKGACVICE FT IVKDNGDMARREDLEIFCQKHDLNMIAVSDLIEYRLKHESLIKLEEKSQSVLAGFKAEK FT FIFSDHNQTQHIAFCFKDIKKCENVKFHISGSDFELLTSDKFSKLLEQIKFLSENGGVI FT VFMQGEKSSTTQYKNYGIGAQILRYFGIEEIKLLSQSCDKDYIGLEGFGLNLKACNFN" FT misc_feature 533373..533648 FT /note="PS00430 TonB-dependent receptor proteins signature FT 1" FT /inference="protein motif:Prosite:PS00430" FT misc_feature 533388..533972 FT /note="HMMPfam hit to PF00926, 3,4-dihydroxy-2-butanone FT 4-phosphate sy, score 6.2e-114" FT /inference="protein motif:Pfam:PF00926" FT CDS 534404..534847 FT /transl_table=11 FT /locus_tag="Cj0573" FT /product="putative GatB/Yqey family protein" FT /note="Original (2000) note: Cj0573, unknown, len: 147 aa; FT similar to several hypothetical proteins e.g.YQEY_BACSU FT (148 aa), fasta scores; opt: 265 z-score: 348.7 E(): 4e-12, FT 32.9% identity in 140 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF02637 GatB/Yqey FT identified within CDS. This domain is found in GatB and FT proteins related to bacterial Yqey. Typically about 140 aa FT residues long. This domain is found at the C terminus of FT GatB which transamidates Glu-tRNA to Gln-tRNA. The function FT of this domain is uncertain. It does however suggest that FT Yqey and its relatives have a role in tRNA metabolism. FT Product modified to more specific family member due to FT motif match. Putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PAU4" FT /db_xref="InterPro:IPR003789" FT /db_xref="InterPro:IPR019004" FT /db_xref="InterPro:IPR023168" FT /db_xref="UniProtKB/TrEMBL:Q0PAU4" FT /inference="protein motif:Pfam:PF02637" FT /protein_id="CAL34719.1" FT /translation="MTLKEQILNDIKEAMKQKDDFKRDSLRTLNAAFKQIEVDERIELD FT NERIYKIIASEIKKRKDVIELYLKANREDLAQKEQNEISLFEIYLPKQLSDEELTLALK FT QLIEELGVSSLKEQGLVMKEAKIKLGASVDGKRLNLALKELLQ" FT misc_feature 534419..534841 FT /note="HMMPfam hit to PF02637, GatB/Yqey domain, score FT 2.7e-29" FT /inference="protein motif:Pfam:PF02637" FT CDS 534865..536565 FT /transl_table=11 FT /gene="ilvI" FT /locus_tag="Cj0574" FT /product="acetolactate synthase large subunit" FT /EC_number="2.2.1.6" FT /note="Original (2000) note: Cj0574, ilvI, probable FT acetolactate synthase large subunit, len: 566 aa; highly FT similar to many e.g.ILVI_ECOLI acetolactate synthase FT isozyme III large subunit (EC 4.1.3.18) (574 aa), fasta FT scores; opt: 1713 z-score: 2101.4 E(): 0, 46.5% identity in FT 572 aa overlap (also 43.4% identity to ILVB_ECOLI, and FT 42.0% identity to ILVG_ECOLI). No Hp match. Contains Pfam FT match to entry PF00205 TPP_enzymes, Thiamine pyrophosphate FT enzymes, score 769.00, E-value 6.9e-238" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. EC number updated. FT Functional classification - Amino acid biosynthesis FT -Branched chain family" FT /note="PMID:6308579" FT /db_xref="GOA:Q0PAU3" FT /db_xref="InterPro:IPR011766" FT /db_xref="InterPro:IPR012000" FT /db_xref="InterPro:IPR012001" FT /db_xref="InterPro:IPR012846" FT /db_xref="UniProtKB/TrEMBL:Q0PAU3" FT /inference="protein motif:Pfam:PF00205" FT /protein_id="CAL34720.1" FT /translation="MKELSGSAMICEALKEENVKIVFGYPGGAALNIYDEIYNQKYFKH FT ILVRHEQAALHAADAYARMSGEVGVAIVTSGPGFTNTITGLATAYSDSIPLVLISGQVA FT NSLIGTDAFQEIDAVGISRPCVKHNYLVTCIEEFPRILKEAFYIARSGRPGPVHIDVPK FT DVSATLGLWEYSKEISMKTYKPVYKGNSKQIKKFAELLKEAKRPLFYLGGGCISSNASE FT QIRELIKFTKIPAVETLMALGTLRSDDVFNLKMAGMHGSYAANMALSECDLLVSVGARF FT DDRITGKTSEFAKHATIVHVDIDPSSISKIINAHYPIVGDIKEVLKELLEELKKENFNT FT TFKEWHETLKRYNELYPLSYEDSNEILKPQWVIEECAKMAPDARIITDVGQHQMWVAQF FT YPFNYPRQLATSGGQGTMGYSLPAALGAKLAVGEEVVINFVGDGSVLMNIQELMTAYEY FT GIKAINIILNNAFLGMVRQWQSMFYKEHFSQTDLSTQPDFIKIAQGFGCEGYEISNKEE FT FIQAFSQALKSDKTSLLNVKIDRFEDVLPMVPAGGAIYNMILPKAKDRQ" FT misc_feature 534874..535386 FT /note="HMMPfam hit to PF02776, Thiamine pyrophosphate FT enzyme, N-termina, score 2.2e-89" FT /inference="protein motif:Pfam:PF02776" FT misc_feature 535441..535911 FT /note="HMMPfam hit to PF00205, Thiamine pyrophosphate FT enzyme, central d, score 2.4e-62" FT /inference="protein motif:Pfam:PF00205" FT CDS 536562..537026 FT /transl_table=11 FT /gene="ilvH" FT /locus_tag="Cj0575" FT /product="acetolactate synthase small subunit" FT /EC_number="2.2.1.6" FT /note="Original (2000) note: Cj0575, ilvH, probable FT acetolactate synthase small subunit, len 145 aa; similar to FT many e.g. ILVH_ECOLI acetolactate synthase isozyme III FT small subunit (EC 4.1.3.18) (163 aa), fasta scores; opt: FT 341 z-score: 523.3 E(): 7.5e-22, 40.0% identity in 155 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF01842 ACT domain FT identified within CDS. Further support given to product FT function. Characterised within Escherichia coli with FT acceptable identity score. Putative not added to product FT function. EC number updated. Functional classification FT -Amino acid biosynthesis - Branched chain family" FT /note="PMID:6308579" FT /db_xref="GOA:Q0PAU2" FT /db_xref="InterPro:IPR002912" FT /db_xref="InterPro:IPR004789" FT /db_xref="InterPro:IPR019455" FT /db_xref="UniProtKB/TrEMBL:Q0PAU2" FT /inference="protein motif:Pfam:PF01842" FT /protein_id="CAL34721.1" FT /translation="MRRVLSVIVLNEHGVLSRIVGLFSGRGYNIDSLTVAPLENKEFSR FT INIVTSGNERTFEQIVKQLHKLIPTYKVIESEEFIDKEMALVKIPLNENLGGLDAVLKA FT YNGTIANSNENFLFLMVADDANRIDNFLKTIKKYNPSDIVRSGSVLMEIK" FT misc_feature 536568..536789 FT /note="HMMPfam hit to PF01842, ACT domain, score 1.2e-13" FT /inference="protein motif:Pfam:PF01842" FT CDS 537023..537988 FT /transl_table=11 FT /gene="lpxD" FT /locus_tag="Cj0576" FT /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine FT N-acyltransferase" FT /EC_number="2.3.1.-" FT /note="Original (2000) note: Cj0576, lpxD, probable FT UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, FT len: 321 aa; similar to many e.g. LPXD_RICRI FT UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase FT (EC 2.3.1.-) (345 aa), fasta scores; opt: 673 z-score: FT 927.1 E(): 0, 41.1% identity in 314 aa overlap. 42.0% FT identity to HP0196. Contains PS00101 Hexapeptide-repeat FT containing-transferases signature and 3x Pfam match to FT entry PF00132 hexapep, Bacterial transferase hexapeptide FT (four repeats)" FT /note="Updated (2006) note: Pfam domain PF04613 FT UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase FT identified within CDS. Further support given to product FT function. Characterised within Escherichia coli with FT acceptable identity score. Putative not added to product FT function. Functional classification - Surface FT polysaccharides, lipopolysaccharides and antigens" FT /note="PMID:8366125, PMID:8125326" FT /db_xref="GOA:Q9PHU0" FT /db_xref="InterPro:IPR001451" FT /db_xref="InterPro:IPR007691" FT /db_xref="InterPro:IPR011004" FT /db_xref="InterPro:IPR018357" FT /db_xref="InterPro:IPR020573" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHU0" FT /inference="protein motif:Pfam:PF04613" FT /inference="protein motif:Pfam:PF00132" FT /inference="protein motif:Prosite:PS00101" FT /protein_id="CAL34722.1" FT /translation="MKLSEIAEFLSLEYKGEDIEISALNSLLKANFTELTYCDGEKNTK FT DIPHTGAAAILVSKEYENLVPKDTKALITQSPHLSFAFLSKLFAKPLISTAKEKVQNIA FT KSARIMPNVYIGDNVNIGENVIIMAGAYIGDNVSIGDESIIHPNVVIYNDTKIGKKCHL FT LANCVIGSDGFGYAHNKNGEHYKIYHNGNVVLEDFVEVGACTTIDRAVFDSTIIKAGTK FT VDNLVQIGHNCNIGQNCIIVAQTGISGSSELGRNVIMGGQSATSGHLKIGDFSTIAARG FT GVSKNLEGGRVYGGFPIMLQKDWLKLQAKIAINFKEKSQD" FT misc_feature 537023..537304 FT /note="HMMPfam hit to PF04613,UDP-3-O-[3-hydroxymyristoyl] FT glucosamine N-a, score 1e-36" FT /inference="protein motif:Pfam:PF04613" FT misc_feature 537320..537373 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 76" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 537374..537427 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 0.0021" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 537383..537469 FT /note="PS00101 Hexapeptide-repeat containing-transferases FT signature" FT /inference="protein motif:Prosite:PS00101" FT misc_feature 537428..537481 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 0.0029" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 537482..537535 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 0.12" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 537596..537649 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 17" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 537662..537715 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 7.4" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 537716..537769 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 4" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 537788..537841 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 93" FT /inference="protein motif:Pfam:PF00132" FT CDS complement(537977..539005) FT /transl_table=11 FT /gene="queA" FT /locus_tag="Cj0577c" FT /product="S-adenosylmethionine:tRNA FT ribosyltransferase-isomerase" FT /EC_number="5.-.-.-" FT /note="Original (2000) note: Cj0577c, queA, probable FT S-adenosylmethionine:tRNA ribosyltransferase-isomerase,len: FT 342 aa; highly similar to many e.g. QUEA_ECOLI FT S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC FT 5.-.-.-) (356 aa), fasta scores; opt: 580 z-score: 1196.1 FT E(): 0, 40.4% identity in 349 aa overlap. 51.9% identity to FT HP1062" FT /note="Updated (2006) note: Pfam domain PF02547 Queuosine FT biosynthesis protein identified within CDS. Further support FT given to product function. Characterised within Escherichia FT coli with acceptable identity score. Putative not added to FT product function. Functional classification -RNA synthesis, FT RNA modification and DNA transcription" FT /note="PMID:8347586" FT /db_xref="GOA:Q9PHT9" FT /db_xref="InterPro:IPR003699" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHT9" FT /inference="protein motif:Pfam:PF02547" FT /protein_id="CAL34723.1" FT /translation="MNKDLLLSSYDYTLANELIANYPTNPKEDARLLVFDRKNKEIFHT FT TFKNLQDFLPNCAIFFNDTKVIKARIYGNKASGGKIELFLHQPFLNSHNPLFLAQIKGR FT IKKDEILYFKEDLKVRVVELLNDGLRKVQFFQNDKTLDTSNLYNLLDKIGHIPLPPYIK FT REDEKSDLKDYQSIFAKNLGAVAAPTASLHFSETMLENLRKKHEIYHLTLHVGAGTFKS FT VECENIQEHKMHSEFFNIPQQACEIIDSKQAILGVGTTVTRTIEYYTRTKTKNGFCDLF FT LHPQNPPIRQNHLLTNFHLPKSTLIMLVSAFIGREQCLKLYELAIKEKYRFYSYGDAML FT IL" FT misc_feature complement(538331..538993) FT /note="HMMPfam hit to PF02547, Queuosine biosynthesis FT protein, score 1e-85" FT /inference="protein motif:Pfam:PF02547" FT CDS complement(538998..539735) FT /transl_table=11 FT /gene="tatC" FT /locus_tag="Cj0578c" FT /product="sec-independant protein translocase" FT /note="Original (2000) note: Cj0578c, mttB, probable FT sec-independant protein translocase, len: 245 aa; similar FT to e.g. TR:G3193219 (EMBL:AF067848) E. coli MTTB (258 FT aa),fasta scores; opt: 523 z-score: 804.5 E(): 0,36.2% FT identity in 246 aa overlap. 49.6% identity to HP1061. FT Contains Pfam match to entry PF00902 UPF0032, Integral FT membrane protein of unknown function" FT /note="Updated (2006) note: Pfam domain PF00902 FT Sec-independent protein translocase protein identified FT within CDS. This motif was previously annotated as UPF0032 FT with unknown function. This family of proteins are involved FT in a sec-independent translocation mechanism. They are FT involved in export of redox proteins with a twin arginine FT leader motif (S/T-R-R-X-F-L-K). The sec-independent pathway FT is termed TAT for twin-arginine translocation system. FT Transport proteins with bound cofactors that require FT folding prior to export are mainly moved. Further support FT given to product function. Characterised within Escherichia FT coli with acceptable identity score. Putative not added to FT product function. Gene name has also been updated from mttB FT to tatC. Functional classification - Protein and peptide FT secretion" FT /note="PMID:9649434, PMID:10652088, PMID:11781311" FT /db_xref="GOA:Q9PHT8" FT /db_xref="InterPro:IPR002033" FT /db_xref="InterPro:IPR019820" FT /db_xref="InterPro:IPR019822" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHT8" FT /inference="protein motif:Pfam:PF00902" FT /protein_id="CAL34724.1" FT /translation="MFEELRPHLIELRKRLFISVACIVVMFIVCFALRSYILDILKAPL FT IAVLPEVAKHVNVIEVQEALFTAMKVSFFAAFIFSLPVIFWQFWKFVAPGLYDNEKRLV FT VPFVSFASIMFAFGACFCYFVVVPLAFKFLINFGLNEDFNPVITIGTYVDFFTKVVVAF FT GLAFEMPVIAFFFAKIGLIDDSFLKRHFRIAVLVIFVFSAFMTPPDVLSQFLMAGPLCG FT LYGLSILIVQKVNPAPKDKESDE" FT misc_feature complement(539079..539696) FT /note="HMMPfam hit to PF00902, Sec-independent protein FT translocase protein, score 1.1e-85" FT /inference="protein motif:Pfam:PF00902" FT misc_feature complement(join(539622..539690,539457..539525, FT 539355..539423,539190..539258,539085..539153)) FT /note="5 probable transmembrane helices predicted for FT Cj0578c by TMHMM2.0 at aa 16-38, 71-93, 105-127, 160-182 FT and 195-217" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(539376..539408) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(539728..540144) FT /transl_table=11 FT /gene="tatB" FT /locus_tag="Cj0579c" FT /product="sec-independant protein translocase" FT /note="Original (2000) note: Cj0579c, unknown, len: 138 aa; FT 36.0% identity to HP1060" FT /note="Updated (2006) note: Pfam domain PF02416 mttA/Hcf106 FT family protein identified within CDS. This family of FT proteins are involved in a sec-independent translocation FT mechanism. This family of proteins are involved in export FT of redox proteins with a twin arginine leader motif FT (S/T-R-R-X-F-L-K) . The sec-independent pathway is termed FT TAT for twin-arginine translocation system. Transport FT proteins with bound cofactors that require folding prior to FT export are mainly moved. Product modified to more specific FT family member due to motif match. Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification - FT Protein and peptide secretion" FT /note="PMID:9649434, PMID:10652088, FT PMID:10593889,PMID:11279240" FT /db_xref="GOA:Q9PHT7" FT /db_xref="InterPro:IPR003369" FT /db_xref="InterPro:IPR018448" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHT7" FT /inference="protein motif:Pfam:PF02416" FT /protein_id="CAL34725.1" FT /translation="MSFGEIIVILVVAILVLGPDKLPEAIVQIAKILKAVKRNIDDAKS FT SIEKEIRINDLKEEAKKYKDEFSSTNENIRKKLSFEEFDDLKRDILDKTKVDLTFDSRD FT DKVKNNLSGQNLNTEEKPNLSKLETQDKNGKINV" FT misc_feature complement(539959..540144) FT /note="HMMPfam hit to PF02416, mttA/Hcf106 family, score FT 8.2e-05" FT /inference="protein motif:Pfam:PF02416" FT CDS complement(540202..541269) FT /transl_table=11 FT /gene="hemN" FT /locus_tag="Cj0580c" FT /product="putative oxygen-independent coproporphyrinogen FT III oxidase" FT /EC_number="1.3.99.22" FT /note="Original (2000) note: Cj0580c, probable FT oxidoreductase, len: 355 aa; similar to hypothetical FT proteins, e.g. YGGW_ECOLI (378 aa), fasta scores; opt: 495 FT z-score: 501.9 E(): 1.2e-20 33.5% identity in 322 aa FT overlap, and to coproporphyrinogen III oxidases e.g. FT HEMN_ECOLI oxygen-independent coproporphyrinogen III FT oxidases (457 aa), fasta scores; opt: 333 z-score: 432.8 FT E(): 8.2e-17, 26.5% identity in 302 aa overlap. 43.3% FT identity to HP1226. Also similar to C. jejuni hemN,Cj0992c FT (25.1% identity in 382 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF06969 HemN FT C-terminal region protein and PF04055 Radical SAM FT superfamily identified within CDS. Members of this family FT are all oxygen-independent coproporphyrinogen-III oxidases FT (HemN). This enzyme catalyses the oxygen-independent FT conversion of coproporphyrinogen-III to FT protoporphyrinogen-IX. Product modified to more specific FT family member based on motif matches. No specific FT characterisation with acceptable identity scores carried FT out yet. Putative kept within product function. Functional FT classification - Misc" FT /note="PMID:10498703" FT /db_xref="GOA:Q0PAT7" FT /db_xref="InterPro:IPR004559" FT /db_xref="InterPro:IPR006638" FT /db_xref="InterPro:IPR007197" FT /db_xref="InterPro:IPR010723" FT /db_xref="InterPro:IPR023404" FT /db_xref="UniProtKB/TrEMBL:Q0PAT7" FT /inference="protein motif:Pfam:PF04055" FT /inference="protein motif:Pfam:PF06969" FT /protein_id="CAL34726.1" FT /translation="MHFYIHIPFCESKCNYCAFTSLKKNDYEKAYFKALKEDIVFQLKQ FT FNIQSNQIKTLFIGGGTPSCVNAYNYEDIFKILYPLLDKNVEISCEANPNSATLNWLKN FT MKNLGVNRISFGVQSFHPKKLHFLGRIHNQEMIIKTLENANKVGFKNINLDLIYDTKLD FT NKKMLEFELLHLKQIKDLITHLSAYNLTIESNTAFAKKEHFKKNAPNLMKFFIKQLLEL FT DFFQYEISNFSKTKAQICKHNLAYWQGKNYLACGLSAVGFYENKRFYTAKNLKNYIENP FT TFRSIEQLSSKDLNLEHLFLGLRSIVGIDETKLNQWQKDKINILLKEKKLFYKNKRYFN FT PNFLISDELALYLSS" FT misc_feature complement(540253..540540) FT /note="HMMPfam hit to PF06969, HemN C-terminal region,score FT 4.5e-09" FT /inference="protein motif:Pfam:PF06969" FT misc_feature complement(540757..541260) FT /note="HMMPfam hit to PF04055, Radical SAM FT superfamily,score 3.4e-23" FT /inference="protein motif:Pfam:PF04055" FT CDS 541371..541841 FT /transl_table=11 FT /gene="nudH" FT /locus_tag="Cj0581" FT /product="putative NUDIX hydrolase family protein" FT /EC_number="3.6.1.-" FT /note="Original (2000) note: Cj0581, possible NTPase, len: FT 156 aa; similar to several proteins containing mutT domains FT e.g. YGDP_ECOLI hypothetical 20.8 kd protein (176 aa), FT fasta scores; opt: 335 z-score: 522.7 E(): 8e-22,39.0% FT identity in 154 aa overlap, and INVA_BARBA invasion FT associated protein A (170 aa), fasta scores; opt: 301 FT z-score: 406.6 E(): 2.4e-15, 32.5% identity in 160 aa FT overlap. 55.3% identity to HP1228. Contains PS00893 mutT FT domain signature and Pfam match to entry PF00293 FT mutT,Bacterial mutT protein" FT /note="Updated (2006) note: Pfam domain PF00293 FT mutT,Bacterial mutT protein has now been changed to NUDIX FT domain. Product modified to more specific family member due FT to motif match. Characterised within Escherichia coli with FT acceptable identity score, however, sequence alignment was FT only partial. Putative kept within product function. FT Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:11479323" FT /db_xref="GOA:Q9PHT5" FT /db_xref="InterPro:IPR000086" FT /db_xref="InterPro:IPR015797" FT /db_xref="InterPro:IPR020084" FT /db_xref="InterPro:IPR020476" FT /db_xref="InterPro:IPR022927" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHT5" FT /inference="protein motif:Pfam:PF00293" FT /inference="protein motif:Prosite:PS00893" FT /protein_id="CAL34727.1" FT /translation="MENEKNYRPNVAAIVLSSSYPFECKIFIARRSDMDNIWQFPQGGI FT DKGESVKNALFRELKEEIGTDEVEIIAEYPEWLSYDFPSKIVKKMYPYDGQIQKYFLVR FT LKHGATININTKHPEFDDYQFVSVKQIFEMINHFKKNIYVRVIKYFEEKGYI" FT misc_feature 541389..541817 FT /note="HMMPfam hit to PF00293, NUDIX domain, score 4.9e-17" FT /inference="protein motif:Pfam:PF00293" FT misc_feature 541497..541556 FT /note="PS00893 mutT domain signature" FT /inference="protein motif:Prosite:PS00893" FT CDS 541843..543045 FT /transl_table=11 FT /gene="lysC" FT /locus_tag="Cj0582" FT /product="aspartokinase, alpha and beta subunits" FT /EC_number="2.7.2.4" FT /note="Original (2000) note: Cj0582, lysC, probable FT aspartokinase, alpha and beta subunits, len: 400 aa; highly FT simlar to many e.g. AKAB_CORGL aspartokinase alpha and beta FT subunits (EC 2.7.2.4) (421 aa), fasta scores; opt: 1228 FT z-score: 1715.1 E(): 0, 48.9% identity in 405 aa overlap. FT 63.0% identity to HP1229. Contains PS00324 Aspartokinase FT signature and Pfam match to entry PF00696 aakinase, FT Aspartate kinases, Glutamate kinases and Gamma glutamate FT phospho-reductases" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Amino acid FT biosynthesis - Aspartate family" FT /note="PMID:2837491" FT /db_xref="GOA:Q0PAT5" FT /db_xref="InterPro:IPR001048" FT /db_xref="InterPro:IPR001341" FT /db_xref="InterPro:IPR002912" FT /db_xref="InterPro:IPR005260" FT /db_xref="InterPro:IPR018042" FT /db_xref="UniProtKB/TrEMBL:Q0PAT5" FT /inference="protein motif:Pfam:PF00696" FT /inference="protein motif:Prosite:PS00324" FT /protein_id="CAL34728.1" FT /translation="MLIVQKYGGTSVGTLERIEAVANRVIQSAQQGNQLVVVVSAMSGV FT TNTLIEQAEYFSKTPNGKDMDMLLSSGERVTSALLSIALNEKGCPAISFSGRKAGIITD FT SVFTKARIHHIDTKAIKSELQNGKIVVIAGFQGVDEEGNVTTLGRGGSDLSAVAVAGAL FT NADLCEIYTDVDGVYTTDPRIEPKAKKLDKISYEEMLELASLGAKVLQNRSVELAKKLN FT VNLVTRSSFNNNEGTMITKEDGMEQALVSGIALDKNQARVTLRNIEDKPGIAAEIFSVL FT ANENINVDMIIQNVGVDGATNLGFTVPQNELELAKNAMQKILSSKTTIESDSAVLKVSI FT VGVGMKSHSGVASKAFKALADEGINIGMISTSEIKISMIVHEKYGELAVRALHECYGLD FT K" FT misc_feature 541843..542529 FT /note="HMMPfam hit to PF00696, Amino acid kinase FT family,score 3.7e-77" FT /inference="protein motif:Pfam:PF00696" FT misc_feature 541852..541878 FT /note="PS00324 Aspartokinase signature" FT /inference="protein motif:Prosite:PS00324" FT misc_feature 541876..541905 FT /note="PS00339 Aminoacyl-transfer RNA synthetases class-II FT signature 2" FT /inference="protein motif:Prosite:PS00339" FT misc_feature 542623..542835 FT /note="HMMPfam hit to PF01842, ACT domain, score 7.1e-09" FT /inference="protein motif:Pfam:PF01842" FT misc_feature 542857..543042 FT /note="HMMPfam hit to PF01842, ACT domain, score 2.5e-08" FT /inference="protein motif:Pfam:PF01842" FT CDS 543046..543582 FT /transl_table=11 FT /locus_tag="Cj0583" FT /product="hypothetical protein Cj0583" FT /note="Original (2000) note: Cj0583, unknown, len: 178 aa; FT 30.8% identity to HP1230. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="InterPro:IPR021011" FT /db_xref="UniProtKB/TrEMBL:Q0PAT4" FT /protein_id="CAL34729.1" FT /translation="MSDFLSFTLENIRNGGAFMAWLESRRLEWAPLMAARLKYLLEGRT FT FVLMCDEQRSWYEEYFLKNINSKATRPMLPFVSLNSLCKKKVQSSEDIALLNDLLDISF FT PNGYVYFYIGSASDNKSLIAKSRDDSLLWLFDEQLQDSFYLNSKDKDLDIKLISLYQLF FT DVSLDAILFSKVQLG" FT CDS 543588..544187 FT /transl_table=11 FT /locus_tag="Cj0584" FT /product="hypothetical protein Cj0584" FT /note="Original (2000) note: Cj0584, unknown, len: 199 aa; FT 36.3% identity to HP1231 (annotated as DNA polymerase III FT delta prime subunit (holB)). No significant similarity to FT other holB proteins. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAT3" FT /protein_id="CAL34730.1" FT /translation="MFISKIIISEDFLGIKEEMINNFGIKKLRFFIPQNEFLLDDARAV FT EKESYIAETEEKIIVLMADSYRIEAQNFLLKLLEEPPKNIKFLIVIPSKNLLLPTIKSR FT LICEKRKVEKEVKKLDLDLKRMDLRMLFDFLQKNENLDKNELMDQIALLAKECVKYKDF FT NAEELEFFYESYELAKLNSKSGVLLATLLLNYYTKK" FT CDS 544189..545331 FT /transl_table=11 FT /gene="folP" FT /locus_tag="Cj0585" FT /product="dihydropteroate synthase" FT /EC_number="2.5.1.15" FT /note="Original (2000) note: Cj0585, folP, probable FT dihydropteroate synthase, len: 380 aa; simliar in FT C-terminus to e.g. DHPS_ECOLI dihydropteroate synthase (EC FT 2.5.1.15) (282 aa), fasta scores; opt: 508 z-score: 504.3 FT E(): 8.5e-21, 35.8% identity in 274 aa overlap. 41.6% FT identity to HP1232. Contains Pfam match to entry PF00809 FT DHPS, Dihydropteroate synthase" FT /note="Updated (2006) note: Pfam domain PF00809 FT DHPS,Dihydropteroate synthase has now been changed to FT Pterin binding enzyme. Characterised within Campylobacter FT jejuni and Escherichia coli with acceptable identity score. FT Putative removed from product function. Functional FT classification - Biosynthesis of cofactors, prosthetic FT groups and carriers - Folic acid" FT /note="PMID:10471557, PMID:8244950" FT /db_xref="GOA:Q0PAT2" FT /db_xref="InterPro:IPR000489" FT /db_xref="InterPro:IPR006390" FT /db_xref="InterPro:IPR011005" FT /db_xref="InterPro:IPR016227" FT /db_xref="UniProtKB/TrEMBL:Q0PAT2" FT /inference="protein motif:Pfam:PF00809" FT /protein_id="CAL34731.1" FT /translation="MKFFKINPNTDFNLLCSFINPHKMGQKIMSEKTKIHFIFIKDIST FT PAANILKQDALRVGAELITHKEVITAKITHSNALLMASKEQIQKLVVKEKLQDFGLKNL FT ALFLQKDFLKPKKAELMAVINVNEDSFNAKSRVSEEDFEKRLNDFLALKPEYIDIGAVS FT SRPGSEYCGKEEEFKRLKKVLDLIYEKNYYEQAIFSLDSFDEYCLEYALNKGFKLINDI FT TSLRNLNLAKLASKYGAKYCLMHMQNNPNNMQDNPFYEDLLDEMTLFFKEKLELLESFG FT VKESILDVGIGFGKSAGHNMILIKHLEHFLQFNKPLLIGASRKSVINAYFQSEIKDRLA FT GTLYLHLKAFENGASIIRVHDLYEHKQLFALAQAMDNIGV" FT misc_feature 544555..545181 FT /note="HMMPfam hit to PF00809, Pterin binding enzyme,score FT 1.2e-79" FT /inference="protein motif:Pfam:PF00809" FT CDS 545332..547275 FT /transl_table=11 FT /gene="ligA" FT /locus_tag="Cj0586" FT /product="DNA ligase" FT /EC_number="6.5.1.2" FT /note="Original (2000) note: Cj0586, ligA, probable DNA FT ligase, len: 647 aa; similar to many e.g. DNLJ_ECOLI DNA FT ligase (EC 6.5.1.2) (671 aa), fasta scores; opt: 1038 FT z-score: 1904.3 E(): 0, 40.7% identity in 654 aa overlap. FT 47.8% identity to HP0615. Contains PS01056 NAD-dependent FT DNA ligase signature 2 and Pfam match to entry PF00533 FT BRCT, BRCA1 C Terminus (BRCT) domain" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -DNA replication, restriction/modification, recombination FT and repair" FT /note="PMID:3018436" FT /db_xref="GOA:Q0PAT1" FT /db_xref="InterPro:IPR001357" FT /db_xref="InterPro:IPR001679" FT /db_xref="InterPro:IPR003583" FT /db_xref="InterPro:IPR004150" FT /db_xref="InterPro:IPR010994" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR013839" FT /db_xref="InterPro:IPR013840" FT /db_xref="InterPro:IPR016027" FT /db_xref="InterPro:IPR018239" FT /db_xref="UniProtKB/Swiss-Prot:Q0PAT1" FT /inference="protein motif:Pfam:PF00533" FT /inference="protein motif:Prosite:PS01056" FT /protein_id="CAL34732.1" FT /translation="MKKEEYLEKVALANLWMRAYYEKDEPLASDEEYDALIRELRVFEE FT QNKDEISKDSPTQKIAPTIQSEFKKIAHLKRMWSMEDVFDESELRAWAKRAKCEKNFFI FT EPKFDGASLNLLYENGKLVSGATRGDGEVGEDITLNVFEIENIPKNIAYKERIEIRGEV FT VILKDDFEKINEKRALLNQSLFANPRNAASGSLRQLDTSITKERNLKFYPWGVGENTLN FT FTKHSEVMQFIRELGFLKDDFVRLCANLDEVLKAYDELLALREKKPMMMDGMVVRVDDL FT ALCEELGYTVKFPKFMAAFKFPALEKTTRLIGVNLQVGRSGVITPVAVLEPVNLDGVVV FT KSATLHNFDEIARLDVKINDFVSVIRSGDVIPKITKVFKERREGLEMEISRPKLCPTCQ FT SELLDEGTLIKCQNIDCEDRLVNSIIHFVSKKCLNIDGLGENIVELLYKHKKITTLESI FT FHLKFNDFEGLEGFKEKKINNLLNAIEQARECELFRFITALGIEHIGEVAAKKLSLSFG FT KEWYKQSFEAYANLEGFGEQMALSLCEFTRVNRTRIDEFYKLLNLKIEKLEIKSDGVIF FT GKTFVITGTLSRPRDEFKALIEKLGGKVSGSVSKKTDYVLFGEEAGSKLSKAKELEVKC FT IDESAFNELVKE" FT misc_feature 545335..546246 FT /note="HMMPfam hit to PF01653, NAD-dependent DNA ligase FT adenylation, score 3.7e-121" FT /inference="protein motif:Pfam:PF01653" FT misc_feature 546250..546498 FT /note="HMMPfam hit to PF03120, NAD-dependent DNA ligase FT OB-fold doma, score 3.9e-41" FT /inference="protein motif:Pfam:PF03120" FT misc_feature 546283..546330 FT /note="PS01056 NAD-dependent DNA ligase signature 2" FT /inference="protein motif:Prosite:PS01056" FT misc_feature 547039..547266 FT /note="HMMPfam hit to PF00533, BRCA1 C Terminus (BRCT) FT domain, score 1e-15" FT /inference="protein motif:Pfam:PF00533" FT CDS 547256..548260 FT /transl_table=11 FT /locus_tag="Cj0587" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0587, probable integral FT membrane protein, len: 334 aa; no Hp match" FT /note="Updated (2006) note: Eight probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PAT0" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34733.1" FT /translation="MSLLKNSSYILTLLSLFGFLLTWQRSAFSLFFLISIFLTLFWEFF FT LFLKLRKNIIKEATLIKGSLFYRVSMGDFYLYIFSFFLAIFGLVSLFLNFLNLEKIDFV FT FIFIILPLLMIFLKKELHLQFVDNAYNDFRIVVIASFFTALFYAFYGLFFTYNELLNLE FT LFSRKIIAYKSASFVYFDFLSEFLHFVSNLKFFIFSYFGYLGFRALNFIFDFFNFFMFC FT SLLAFVFNFVLKIKIKIIVLFLCFIMVLGNYFLKEQRNNALKSEQEQILLWMNNFNFLK FT DNNLSLIQKEKDLFEKDLKDLREIFKKNAFEIGIWWFSKEKEDLEKRINESLK" FT sig_peptide 547256..547336 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000271_547256_548260 by SignalP 2.0 FT HMM (Signal peptide probability 0.709) with cleavage site FT probability 0.460 between residues 27 and 28" FT misc_feature order(547274..547327,547337..547405,547475..547543, FT 547556..547624,547658..547726,547799..547867, FT 547886..547954,547964..548020) FT /note="8 probable transmembrane helices predicted for FT Cj0587 by TMHMM2.0 at aa 7-24, 28-50, 74-96, FT 101-123,135-157, 182-204, 211-233 and 237-255" FT /inference="protein motif:TMHMM:2.0" FT CDS 548257..549018 FT /transl_table=11 FT /gene="tlyA" FT /locus_tag="Cj0588" FT /product="putative haemolysin" FT /note="Original (2000) note: Cj0588, tlyA, possible FT haemolysin, len: 253 aa; similar to e.g. HLYA_TREHY FT hemolysin A from Treponema hyodysenteriae (Serpulina FT hyodysenteriae) (240 aa), fasta scores; opt: 342 z-score: FT 596.3 E(): 6.4e-26, 33.7% identity in 261 aa overlap. 40.7% FT identity to HP1086" FT /note="Updated (2006) note: Pfam domain PF01479 S4 and FT PF01728 FtsJ-like methyltransferase domain have been FT identified within CDS. Further support given to product FT function. Characterisation work carried out within FT Treponema hyodysenteriae with marginal identity score. FT Putative kept within product function. Functional FT classification - Pathogenicity" FT /note="PMID:1730486" FT /db_xref="GOA:Q0PAS9" FT /db_xref="InterPro:IPR002877" FT /db_xref="InterPro:IPR002942" FT /db_xref="UniProtKB/TrEMBL:Q0PAS9" FT /inference="protein motif:Pfam:PF01728" FT /inference="protein motif:Pfam:PF01479" FT /protein_id="CAL34734.1" FT /translation="MRFDFFVSKRLNISRNKALELIENEEILLNGKSFKASFDVKNFLE FT NLKKTQDLNPEDILLANELKLDLLSEIYVSRAALKLKKFLEENDIEIKHKNCLDIGSST FT GGFVQILLENQALKITALDVGSNQLHPSLRVNEKIILHENTDLRAFKSEEKFELVTCDV FT SFISLINLLYYIDNLALKEIILLFKPQFEVGKNIKRDKKGVLKDDKAILKARMDFEKAC FT AKLGWLLKNTQKSSIKGKEGNVEYFYYYIKN" FT misc_feature 548257..548394 FT /note="HMMPfam hit to PF01479, S4 domain, score 0.013" FT /inference="protein motif:Pfam:PF01479" FT misc_feature 548473..549012 FT /note="HMMPfam hit to PF01728, FtsJ-like methyltransferase, FT score 3e-06" FT /inference="protein motif:Pfam:PF01728" FT CDS 548984..549838 FT /transl_table=11 FT /gene="ribF" FT /locus_tag="Cj0589" FT /product="putative riboflavin kinase/FMN FT adenylyltransferase" FT /EC_number="2.7.1.26" FT /EC_number="2.7.7.2" FT /note="Original (2000) note: Cj0589, ribF, possible FT riboflavin kinase/FMN adenylyltransferase, len: 284 aa; FT simlar to e.g. RIBF_CORAM riboflavin kinase (EC 2.7.1.26) / FT FMN adenylyltransferase (EC 2.7.7.2) (338 aa), fasta FT scores; opt: 227 z-score: 535.1 E(): 1.6e-22, 25.5% FT identity in 310 aa overlap. 43.5% identity to HP1087" FT /note="Updated (2006) note: Pfam domain PF06574 Riboflavin FT kinase (Flavokinase) and PF01687 Riboflavin kinase / FAD FT synthetase have been identified within CDS. Further support FT given to product function. No specific characterisation FT with acceptable identity score has been carried out yet. FT Putative kept within product function. Functional FT classification - Biosynthesis of cofactors,prosthetic FT groups and carriers - Riboflavin" FT /db_xref="GOA:Q0PAS8" FT /db_xref="InterPro:IPR002606" FT /db_xref="InterPro:IPR014729" FT /db_xref="InterPro:IPR015864" FT /db_xref="InterPro:IPR015865" FT /db_xref="InterPro:IPR023465" FT /db_xref="UniProtKB/TrEMBL:Q0PAS8" FT /inference="protein motif:Pfam:PF01687" FT /inference="protein motif:Pfam:PF06574" FT /protein_id="CAL34735.1" FT /translation="MLNIFTTISKINITSLAIGCFDGMHLGHLKLVKCLDENGALLVIN FT KFKGQFLCSNRQKEEISGKKVIEVDFESIKSLDGRDFLSFLKKEFVNLKFIVVGYDFSF FT GKNRAYNAKDIESLSGIKTIIVDEFSIDGIGVHASLIKDFLSKANLQKAKEFLGRDYSI FT KGKMIKGQGLGSKELFATINLDCEGYFLPQNGVYVTLLKSQRKTYKSVSFLGVRSSDEN FT FAIESHILEELGENFTQGEFFELEFISFLRENQKFQDLKKLKNQIAKDIEQARELLRKN FT DER" FT misc_feature 549017..549403 FT /note="HMMPfam hit to PF06574, Riboflavin kinase FT (Flavokinase), score 1.5e-10" FT /inference="protein motif:Pfam:PF06574" FT misc_feature 549449..549820 FT /note="HMMPfam hit to PF01687, Riboflavin kinase / FAD FT synthetase, score 1.2e-24" FT /inference="protein motif:Pfam:PF01687" FT CDS 549825..550535 FT /transl_table=11 FT /locus_tag="Cj0590" FT /product="putative SAM-dependent methyltransferase" FT /note="Original (2000) note: Cj0590, unknown, len: 236 aa; FT similar to hypothetical proteins e.g. YECO_ECOLI (247 FT aa),fasta scores; opt: 476 z-score: 737.5 E(): 0, 35.6% FT identity in 239 aa overlap. 45.3% identity to HP0388" FT /note="Updated (2006) note: Prosite domain PS50193 FT SAM_BIND, SAM (and some other nucleotide) binding motif FT identified within CDS. Product modified to more specific FT family member due to motif match. No specific FT characterisation has been carried out yet. Putative kept FT within product function. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="GOA:Q0PAS7" FT /db_xref="InterPro:IPR005271" FT /db_xref="UniProtKB/Swiss-Prot:Q0PAS7" FT /inference="protein motif:Prosite:PS50193" FT /protein_id="CAL34736.1" FT /translation="MMKDELFKQSPKKQFEFDKSVASVFDDMINRSVPFYRENLELCGN FT LLAKILPTNASVCDLGCSSANFLIFLANLRKDFKLFGVDNSASMLEVAKSKAKAYGLDI FT SFFEANLCEFDFFTCDVFVANYTMQFIRPPKRQELLDQIYKNLNSKGILIMSEKILYED FT AFLSKNIIELYADYKEKQGYSKFEIAAKREALENVLIPYSQKENLNMLEKAGFKKIESI FT FKWANFETFIAFKD" FT CDS complement(550525..550746) FT /transl_table=11 FT /locus_tag="Cj0591c" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0591c, probable lipoprotein, FT len: 73 aa; no Hp match. Contains N-terminal signal FT sequence and PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site. Some similarity to upstream gene Cj0592c FT (39.7% identity in 63 aa overlap). Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PAS6" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34737.1" FT /translation="MTMKITLFLSLIGIFFAACEQTKSVEYYQNHPEEAKKRSLECRHK FT AIISQDCVNAYKIGFPKDEWEDENISNP" FT sig_peptide complement(550687..550746) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000273_550525_550746 by SignalP 2.0 FT HMM (Signal peptide probability 0.953) with cleavage site FT probability 0.474 between residues 20 and 21" FT misc_feature complement(550690..550722) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(550743..551177) FT /transl_table=11 FT /locus_tag="Cj0592c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0592c, probable periplasmic FT protein, len: 144 aa; no Hp match. Contains N-terminal FT signal sequence. Some similarity to downstream gene Cj0591c FT (39.7% identity in 63 aa overlap). Functional FT classification - Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAS5" FT /protein_id="CAL34738.1" FT /translation="MRRLSILLAILIVINITACDSKTENYYKNLPSEAKEKAKECKESG FT TLSEDCINALKVGVKPTNEEGKYSPNTPKKSDNQILEALKQNDLKKEKTTKDINQSSEN FT NESIIIPPIAETPSEIYPSKTTENNQSSIFSDDVNMTQEK" FT CDS complement(551235..551867) FT /transl_table=11 FT /locus_tag="Cj0593c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0593c, probable integral FT membrane protein, len: 210 aa; similar to hypothetical FT proteins e.g. YICG_ECOLI (205 aa), fasta scores; opt: 783 FT z-score: 1285.7 E(): 0, 57.4% identity in 204 aa overlap. FT No Hp match" FT /note="Updated (2006) note: Pfam domains x2 PF03458 UPF0126 FT domain was identified within CDS. This domain is found FT duplicated in bacterial membrane proteins of unknown FT function and contains three transmembrane helices. Also FT seven probable transmembrane helices predicted by TMHMM2.0. FT Further support given to product function. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="GOA:Q9PHS3" FT /db_xref="InterPro:IPR005115" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHS3" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03458" FT /protein_id="CAL34739.1" FT /translation="MEINALTITTLYIIGISAEGMTGALAAGRHKMDLFGVIFIALVTA FT IGGGSIRDVLLGHYPLTWVKHPEYIILICFCALVATKIPRVVTKLETLFLTLDAIGLVV FT FSILGAQIAIDQNHGFIIAVAAAVITGVFGGILRDILCMRIPLVFQKEIYAGIAIIAGA FT IYYSLIIWLELNALVCTLLTLFIGVFARLLAIKYQWSLPIFSYNEEK" FT misc_feature complement(join(551787..551855,551700..551768, FT 551607..551663,551526..551594,551445..551513, FT 551352..551411,551283..551342)) FT /note="7 probable transmembrane helices predicted for FT Cj0593c by TMHMM2.0 at aa 5-27, 34-56, 69-87, FT 92-114,119-141, 153-172 and 176-195" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(551334..551588) FT /note="HMMPfam hit to PF03458, UPF0126 domain, score FT 2.4e-34" FT /inference="protein motif:Pfam:PF03458" FT misc_feature complement(551589..551846) FT /note="HMMPfam hit to PF03458, UPF0126 domain, score FT 6.7e-38" FT /inference="protein motif:Pfam:PF03458" FT CDS complement(551878..552528) FT /transl_table=11 FT /locus_tag="Cj0594c" FT /product="putative DNA/RNA non-specific endonuclease" FT /EC_number="3.1.30.-" FT /note="Original (2000) note: Cj0594c, probable periplasmic FT protein, len: 216 aa; no Hp match. Contains N-terminal FT signal sequence" FT /note="Updated (2006) note: Pfam domain PF01223 DNA/RNA FT non-specific endonuclease was identified within CDS. FT Product modified to more specific family member due to FT motif match. No specific characterisation with acceptable FT identity score has been carried out yet. Thus, putative FT kept within product function. Functional classification FT -DNA replication, restriction/modification, recombination FT and repair" FT /db_xref="GOA:Q0PAS3" FT /db_xref="InterPro:IPR001604" FT /db_xref="InterPro:IPR020821" FT /db_xref="UniProtKB/TrEMBL:Q0PAS3" FT /inference="protein motif:Pfam:PF01223" FT /protein_id="CAL34740.1" FT /translation="MKIFIFLLTISLNIFALEPYKPSADFSSYFNNINCSQILDKFFYL FT NCYDYKLKGTKAVAYKVEASNLKDRQIKKRPRFEDDTNIPKKYRTTWSNYKNSGYTRGH FT TAPNASFSFSKAAQNSVFLMSNITPQNAQINNKIWNEIEQRERNLALEFQSIEVLNLVL FT YDKEPQYIKNRIAIPSFYVKIIKTPKFKECYQAPNHEVNDENIKQYQINCDKF" FT misc_feature complement(551881..552411) FT /note="HMMPfam hit to PF01223, DNA/RNA non-specific FT endonuclease, score 5.7e-21" FT /inference="protein motif:Pfam:PF01223" FT CDS complement(552525..553151) FT /transl_table=11 FT /gene="nth" FT /locus_tag="Cj0595c" FT /product="endonuclease III" FT /EC_number="4.2.99.18" FT /note="Original (2000) note: Cj0595c, nth, probable FT endonuclease III, len 208 aa; similar to many e.g. FT END3_ECOLI endonuclease III (EC 4.2.99.18) (211 aa), fasta FT scores; opt: 488 z-score: 749.2 E(): 0, 39.7% identity in FT 204 aa overlap. 57.4% identity to HP0585. Contains PS00764 FT Endonuclease III iron-sulfur binding region signature and FT Pfam match to entry PF00730 Endonuclease_3, Endonuclease FT III" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -DNA replication, restriction/modification, recombination FT and repair" FT /note="PMID:2669955" FT /db_xref="GOA:Q0PAS2" FT /db_xref="InterPro:IPR003265" FT /db_xref="InterPro:IPR003651" FT /db_xref="InterPro:IPR004035" FT /db_xref="InterPro:IPR005759" FT /db_xref="InterPro:IPR011257" FT /db_xref="InterPro:IPR023170" FT /db_xref="UniProtKB/TrEMBL:Q0PAS2" FT /inference="protein motif:Pfam:PF00730" FT /inference="protein motif:Prosite:PS00764" FT /protein_id="CAL34741.1" FT /translation="MKRNLEIKELFLKHFDKPVTELKFSNLYELLVCVMLSAQCTDKRV FT NLITPDLFKAYPDIKSLANANLSSLKTYIQTCSFFNNKAQNLIKMAKAVCENFDGEIPL FT DEQNLKSLAGVGQKTAHVVLIEWCGANFMAVDTHVFRVSHRLGLSKAKTPEATEEDLTR FT TFKDNLNYLHQAMVLFGRYTCKAKKPLCKECFLNHLCKSKDKELK" FT misc_feature complement(552552..552602) FT /note="PS00764 Endonuclease III iron-sulfur binding region FT signature" FT /inference="protein motif:Prosite:PS00764" FT misc_feature complement(552651..553058) FT /note="HMMPfam hit to PF00730, HhH-GPD superfamily base FT excision DNA repair, score 9.8e-20" FT /inference="protein motif:Pfam:PF00730" FT CDS 553232..554053 FT /transl_table=11 FT /gene="peb4-cbf2" FT /locus_tag="Cj0596" FT /product="major antigenic peptide PEB-cell binding factor" FT /note="Original (2000) note: Cj0596, peb4-cbf2, major FT antigenic peptide PEB4-cell binding factor 2, len: 273 aa; FT identical to CBF2_CAMJE cell binding factor 2 precursor,and FT TR:G451285 peb4=major antigenic peptide (34 aa). Also FT similar to memebers of the PPIC-parvulin family of FT rotamases e.g. PRTM_LACPA protease maturation protein FT precursor (299 aa), fasta scores; opt: 238 z-score: 303.5 FT E(): 1.3e-09, 31.3% identity in 240 aa overlap, and FT CYPD_ECOLI peptidyl-prolyl cis-trans isomerase D (623 FT aa),fasta scores; opt: 244 z-score: 293.9 E(): 4.5e-09, FT 27.1% identity in 221 aa overlap. 35.7% identity to HP0175. FT Contains PS01096 PpiC-type peptidyl-prolyl cis-trans FT isomerase signature and Pfam match to entry PF00639 FT Rotamase, PPIC-type PPIASE domain" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Functional classification FT -Miscellaneous periplasmic proteins" FT /note="PMID:8525063" FT /db_xref="GOA:Q0PAS1" FT /db_xref="InterPro:IPR000297" FT /db_xref="InterPro:IPR008880" FT /db_xref="InterPro:IPR023058" FT /db_xref="PDB:3RFW" FT /db_xref="UniProtKB/Swiss-Prot:Q0PAS1" FT /inference="protein motif:Pfam:PF00639" FT /inference="protein motif:Prosite:PS01096" FT /protein_id="CAL34742.1" FT /translation="MKKFSLVAATLIAGVVLNVNAATVATVNGKSISDTEVSEFFAPML FT RGQDFKTLPDNQKKALIQQYIMQDLILQDAKKQNLEKDPLYTKELDRAKDAILVNVYQE FT KILNTIKIDAAKVKAFYDQNKDKYVKPARVQAKHILVATEKEAKDIINELKGLKGKELD FT AKFSELAKEKSIDPGSKNQGGELGWFDQSTMVKPFTDAAFALKNGTITTTPVKTNFGYH FT VILKENSQAKGQIKFDEVKQGIENGLKFEEFKKVINQKGQDLLNSAKVEYK" FT sig_peptide 553232..553303 FT /note="Signal peptide predicted for peb4-cbf2 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.584 between residues 24 and 25" FT misc_feature 553244..553312 FT /note="1 probable transmembrane helix predicted for Cj0596 FT by TMHMM2.0 at aa 5-27" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 553643..553915 FT /note="HMMPfam hit to PF00639, PPIC-type PPIASE FT domain,score 2.7e-30" FT /inference="protein motif:Pfam:PF00639" FT misc_feature 553727..553792 FT /note="PS01096 PpiC-type peptidyl-prolyl cis-trans FT isomerase signature" FT /inference="protein motif:Prosite:PS01096" FT CDS 554053..555117 FT /transl_table=11 FT /gene="fba" FT /locus_tag="Cj0597" FT /product="fructose-bisphosphate aldolase" FT /EC_number="4.1.2.13" FT /note="Original (2000) note: Cj0597, FT fba,fructose-bisphosphate aldolase, len: 354 aa; identical FT to ALF_CAMJE fructose-bisphosphate aldolase (EC 4.1.2.13) FT (354 aa), and highly similar to many e.g. ALF_ECOLI (358 FT aa), fasta scores; opt: 1557 z-score: 1802.7 E(): 0, 64.5% FT identity in 355 aa overlap. 28.0% identity to HP0176. FT Contains PS00602 and PS00806 Fructose-bisphosphate aldolase FT class-II signatures 1 and 2, and Pfam match to entry FT PF01116 F_bP_aldolase, Fructose-bisphosphate aldolase FT class-II, score 719.30, E-value 1.8e-212" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Functional classification - Energy FT metabolism - Glycolysis" FT /note="PMID:8525063" FT /db_xref="GOA:Q0PAS0" FT /db_xref="InterPro:IPR000771" FT /db_xref="InterPro:IPR006411" FT /db_xref="InterPro:IPR013785" FT /db_xref="PDB:3QM3" FT /db_xref="UniProtKB/Swiss-Prot:Q0PAS0" FT /inference="protein motif:Pfam:PF01116" FT /inference="protein motif:Prosite:PS00806" FT /inference="protein motif:Prosite:PS00602" FT /protein_id="CAL34743.1" FT /translation="MGVLDIVKAGVISGDELNKIYDYAKAEGFAIPAVNVVGTDSINAV FT LEAAKKVNSPVIIQFSNGGAKFYAGKNCPNGEVLGAISGAKHVHLLAKAYGVPVILHTD FT HAARKLLPWIDGLIEANAQYKKTHGQALFSSHMLDLSEESLEENLSTCEVYLQKLDALG FT VALEIELGCTGGEEDGVDNTGIDNSKLYTQPEDVALAYERLGKISDKFSIAASFGNVHG FT VYKPGNVSLQPEILKNSQKFVKDKFALNSDKPINFVFHGGSGSELKDIKNAVSYGVIKM FT NIDTDTQWAFWDGVREYELKNRAYLQGQIGNPEGDDKPNKKYYDPRVWLRSGEESMIKR FT LEIAFEDLNCINKN" FT misc_feature 554092..555114 FT /note="HMMPfam hit to PF01116, Fructose-bisphosphate FT aldolase class-II, score 9.3e-215" FT /inference="protein motif:Pfam:PF01116" FT misc_feature 554335..554370 FT /note="PS00602 Fructose-bisphosphate aldolase class-II FT signature 1" FT /inference="protein motif:Prosite:PS00602" FT misc_feature 554548..554583 FT /note="PS00806 Fructose-bisphosphate aldolase class-II FT signature 2" FT /inference="protein motif:Prosite:PS00806" FT CDS 555212..556654 FT /transl_table=11 FT /locus_tag="Cj0598" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0598, probable membrane FT protein, len: 480 aa; no Hp match" FT /note="Updated (2006) note: Four probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PAR9" FT /db_xref="InterPro:IPR002898" FT /db_xref="UniProtKB/TrEMBL:Q0PAR9" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34744.1" FT /translation="MDIKSDEISELVLPEGKDARGSLVYFKIIFIPAFLYILILLGYFN FT VIDFKVELHTVIMTGVIFFTALIFARHSAEYAYSIFEQQKDEFKQALKRHIMRHFLAIG FT KDTKSNANFDDFAYTYIKGARNENFASIGSAIFPMMGILGTFISIAFSMPNFSSSDTAA FT LEQEIADLLSGVGTAFYVSIYGIFLALWWMFFEKYGKSKIDRLLNRQKNATSGFFWTKE FT ELDQRYLTESLQHFEKIGAIFKQVSNDDFFAELDHAIDRKFGIFQDMLNVEEKAIRLSS FT EHIKQTMGELSKAQRDQRDLGKLYSEMLNGIGLLNQNLKEINTRMSEQYNRLLDISSDK FT IHHLDKTLSAFDEKIERFGKNFELYEKAMLESQEKVFEGFKASLFEGMHKFKEVYEEEK FT SIDAKIKMMDELKKEMKALDEETSQMMSKLSGDENQNKENETKQIEDFSESKTEENQDE FT IQAEISKQESNDELKNEDKENK" FT misc_feature order(555272..555340,555368..555421,555596..555664, FT 555728..555796) FT /note="4 probable transmembrane helices predicted for FT Cj0598 by TMHMM2.0 at aa 21-43, 53-70, 129-151 and 173-195" FT /inference="protein motif:TMHMM:2.0" FT CDS 556651..557604 FT /transl_table=11 FT /locus_tag="Cj0599" FT /product="putative OmpA family membrane protein" FT /note="Original (2000) note: Cj0599, probable periplasmic FT protein, len: 317 aa; no Hp match. Contains N-terminal FT signal sequence" FT /note="Updated (2006) note: Pfam domain PF00691 OmpA family FT protein was identified within CDS. Also, one probable FT transmembrane helix predicted by TMHMM2.0. Further support FT given to product function. No specific characterisation FT with acceptable identity scores has been carried out yet. FT Putative kept within product function. Functional FT classification - Miscellaneous periplasmic proteins" FT /db_xref="GOA:Q0PAR8" FT /db_xref="InterPro:IPR006665" FT /db_xref="UniProtKB/TrEMBL:Q0PAR8" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00691" FT /protein_id="CAL34745.1" FT /translation="MKNESKEDSNFWIAYADLMAGLLFVFILLIGAIVVKYVLTQSDLK FT EIKDNLNKQEARLEESKEELRNKEAIVFKLSSDLNNASSALNLANSQKAELEANITNYK FT QLSKDLNSTLDNKDKQILILLGQLEKKDEELKNLQEDFQKAKEKVQNLGLIRENLSKEL FT QSKLDNNITIDEKIGSISLPAEVLFDKDSYVLKNEAKASLRKILSEYFDAILEDPKIFS FT NIENIIIEGHTDSDGSYIYNLDLSQKRAYEVMNFIYTFYKSDKLQKLLMASGRSFSDPV FT FVNGVEDKDKSRRIEIKFSIKNDNALKDVEKFFEFH" FT misc_feature 556687..556755 FT /note="1 probable transmembrane helix predicted for Cj0599 FT by TMHMM2.0 at aa 13-35" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 557209..557532 FT /note="HMMPfam hit to PF00691, OmpA family, score 2.1e-05" FT /inference="protein motif:Pfam:PF00691" FT CDS 557591..558466 FT /transl_table=11 FT /locus_tag="Cj0600" FT /product="hypothetical protein Cj0600" FT /note="Original (2000) note: Cj0600, unknown, len: 291 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="GOA:Q0PAR7" FT /db_xref="InterPro:IPR001926" FT /db_xref="UniProtKB/TrEMBL:Q0PAR7" FT /protein_id="CAL34746.1" FT /translation="MNFIKTISPIQKINFNGFEFYIKRDDLLGEINGNKARKLAFYIHQ FT RYPKNQSFVSYGGSQSNALAALSIFAKQRSYKLVFACEKISTFLKNNPCGNYALALENG FT VDFVENIHSLSLKQFALSLCKKDDVFIEQGIANLEAQYGYMELAQEIQMQSQSLKLDFD FT IFLPSGTGTSAAFLAKYSKFKVFTCACVGDIKYLKKQILTLDPSYDFSNLEFLTSDKKY FT HFAKPYKEFYELYMDLKLKCNIEFDLLYDILGLSIALKQEWKKPLLYIHQGGILGNSTM FT LERYKFKKSV" FT CDS complement(558458..559801) FT /transl_table=11 FT /locus_tag="Cj0601c" FT /product="putative sodium-dependent transmembrane transport FT protein" FT /note="Original (2000) note: Cj0601c, probable FT sodium-dependent transmembrane transport protein, len: 447 FT aa; similar to members of the sodium:neurotransmitter FT symporter family e.g. YG90_HAEIN hypothetical FT sodium-dependent transporter HI1690 (457 aa), fasta scores; FT opt: 1380 z-score: 2645.2 E(): 0, 61.0% identity in 456 aa FT overlap, and NTSE_RAT sodium-dependent serotonin FT transporter (630 aa), fasta scores; opt: 265 z-score: 744.2 FT E(): 0. 25.8% identity in 488 aa overlap. No Hp ortholog. FT Also similar to Cj0935c (32.4% identity in 451 aa overlap), FT and Cj0934c (28.0% identity in 454 aa overlap). Contains FT PS00610 Sodium:neurotransmitter symporter family signature FT 1 and Pfam match to entry PF00209 SNF, FT Sodium:neurotransmitter symporter family" FT /note="Updated (2006) note: Eleven probable transmembrane FT helices predicted by TMHMM2.0. No specific characterisation FT with acceptable identity scores carried out yet. Putative FT kept within product function. Functional classification - FT Transport/binding proteins - Other" FT /db_xref="GOA:Q0PAR6" FT /db_xref="InterPro:IPR000175" FT /db_xref="UniProtKB/TrEMBL:Q0PAR6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00209" FT /inference="protein motif:Prosite:PS00610" FT /protein_id="CAL34747.1" FT /translation="MQRQTWSSTLTYILTVAGATIGFGATWRFPYLVGENGGGAYVLVF FT CIAMIIIGIPVILVENVIGRKAMTNSVDAFKQKWQSIGYMGLLGSFGIMAYYMVLGGWV FT LVYIWELTLGNFSLANVVSKEFTHQFFNDKIAFNPLGVGIFTTVFVIINYIILKRGIID FT GIEKSVKFLMPLLFICLIIVVGRNLTLDGAMAGVKFYLEPDFSKILSPKLLIDVLGQVF FT FALSLGFGVMITLSSHLNKNENMAKTAIYTGVLNTIIAVLAGFMIFPALFSAGLAPDSG FT PSLVFETLPIAFSHIHFGTIVCILFFVLLLIAALTTSLPIYQVIISVLEEKFKYSKNLS FT INLTLGFIFILGNLPCILTYGPWRDIVIIKGKNIFDSFDFISGNILFVLTAFFCCIYVG FT WILGKQESLKELSNNNTLKSSWFGIWFYYVKYIVPLIILIIFIYGILN" FT misc_feature complement(join(559721..559789,559625..559693, FT 559475..559543,559331..559399,559232..559300, FT 559085..559153,558980..559048,558848..558916, FT 558719..558787,558593..558661,558464..558532)) FT /note="11 probable transmembrane helices predicted for FT Cj0601c by TMHMM2.0 at aa 5-27, 37-59, 87-109, FT 135-157,168-190, 217-239, 252-274, 296-318, 339-361, FT 381-403 and 424-446" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(558533..559795) FT /note="HMMPfam hit to PF00209, Sodium:neurotransmitter FT symporter family, score 1.2e-14" FT /inference="protein motif:Pfam:PF00209" FT misc_feature complement(559679..559723) FT /note="PS00610 Sodium:neurotransmitter symporter family FT signature 1" FT /inference="protein motif:Prosite:PS00610" FT CDS complement(559852..560520) FT /transl_table=11 FT /locus_tag="Cj0602c" FT /product="MOSC-domain containing protein" FT /note="Original (2000) note: Cj0602c, unknown, len: 222 aa; FT similar to hypothetical proteins e.g. YIIM_ECOLI (234 aa), FT fasta scores; opt: 298 z-score: 406.4 E(): 2.4e-15,30.4% FT identity in 207 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domains PF03475 3-alpha FT domain and PF03473 MOSC domain were identified within CDS. FT Product modified to more specific family member due to FT motif match. Functional classification - Misc" FT /db_xref="GOA:Q0PAR5" FT /db_xref="InterPro:IPR005302" FT /db_xref="InterPro:IPR011037" FT /db_xref="InterPro:IPR015808" FT /db_xref="UniProtKB/TrEMBL:Q0PAR5" FT /inference="protein motif:Pfam:PF03473" FT /inference="protein motif:Pfam:PF03475" FT /protein_id="CAL34748.1" FT /translation="MKIQSLQIGKIKNYKNFQSAFIKDTYLEETQIDFLGVLDDQIADK FT IHHGGYHKAIFTNSCQNYPIWERFLNKKLNFGSMGENLSIDGLCEQNVCIGDIHQFSNA FT ILQVSEPRKPCVKISKIHNNPNFTHEIFKTGLSGWYYKVLQVGQIRKHENIKILEKNST FT SLSVFELNQLFYSPHQILKQNPNLLDKLEKLNSLISQNWHETIHKRLKNTYDISYMDSL FT " FT misc_feature complement(559876..560031) FT /note="HMMPfam hit to PF03475, 3-alpha domain, score FT 2.7e-17" FT /inference="protein motif:Pfam:PF03475" FT misc_feature complement(560050..560418) FT /note="HMMPfam hit to PF03473, MOSC domain, score 2.2e-44" FT /inference="protein motif:Pfam:PF03473" FT CDS complement(560517..562220) FT /transl_table=11 FT /gene="dsbD" FT /locus_tag="Cj0603c" FT /product="putative thiol:disulphide interchange protein" FT /EC_number="1.8.1.8" FT /note="Original (2000) note: Cj0603c, dsbD, possible FT thiol:disulfide interchange protein, len: 567 aa; similar FT to e.g. DSBD_ECOLI thiol:disulfide interchange protein DSBD FT (488 aa), fasta scores; opt: 795 z-score: 977.8 E(): 0, FT 31.5% identity in 496 aa overlap. 27.1% identity to HP0265" FT /note="Updated (2006) note: Pfam domain PF02683 Cytochrome FT C biogenesis protein transmembrane was identified within FT CDS. Also, Prosite domain PS50223 THIOREDOXIN_2,Thioredoxin FT domain 2 identified along with eight probable transmembrane FT helices predicted by TMHMM2.0. Further support given to FT product function. DsbA and DsbC periplasmic proteins are FT involved in disulphide bond formation. DsbD generates a FT reducing source in the periplasm, which is required for FT maintaining proper redox conditions. Characterised within FT Escherichia coli with marginal identity score. Putative FT kept within product function. Functional classification - FT Protein translation and modification" FT /note="PMID:7628442, PMID:11085993" FT /db_xref="GOA:Q9PHR3" FT /db_xref="InterPro:IPR003834" FT /db_xref="InterPro:IPR005746" FT /db_xref="InterPro:IPR012336" FT /db_xref="InterPro:IPR013766" FT /db_xref="InterPro:IPR022910" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHR3" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02683" FT /inference="protein motif:Prosite:PS50223" FT /protein_id="CAL34749.1" FT /translation="MRIFGIILLSFCLCFASILSLNEAFNVKSNSYNNSISIDIELGKD FT IYLYSNKLKLYINEKDISSLINLPQSSTRGNENVYYQKLNLALPNLLLERFAKNTTNLI FT KLEFQGCSEQGLCYNPQTWYFDLISKKDAFEISKPYKAQKTDKKTKIESEESSIANFLA FT TDNFFWILLSFFGYGLLLSLTPCILPMIPILSSLIVAKSNAKFSKKYSFFLSFIYVFFM FT SLAYAIAGVIASFLGASIQGILQKPIILILFALIFIAFAFAMFGAFRFELPLRFQTFIH FT KKSEKGKGVVGIAIMGFLSALIVGPCVAAPLAGALIYIANTGNALLGGSALFIMSFGMG FT IPLLFIGLGLGFIKPGFWMEKVKIFFGFVMLAMAIWILSRIIEENYILIAYGILGVFFS FT VFMGIFEKSFTIISKIKKSILILILAYSLSIFLGGLFGAKNFLNPLNFNTISASKHALS FT YDYINNFEQLKQEIQTNTKPIMLDFTASWCENCKLLDELTFSDERIIQKMQNYKLIKVD FT VSENNNEQIKTMKEFNVFGPPVLIFFENGKEKLKITGFISADDLLKKIEP" FT misc_feature complement(join(561624..561692,561522..561590, FT 561411..561479,561258..561353,561162..561230, FT 561075..561128,561006..561065,560910..560969)) FT /note="8 probable transmembrane helices predicted for FT Cj0603c by TMHMM2.0 at aa 177-199, 211-233, FT 248-270,290-321, 331-353, 365-382, 386-405 and 418-437" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(561084..561701) FT /note="HMMPfam hit to PF02683, Cytochrome C biogenesis FT protein transmembran, score 1.2e-07" FT /inference="protein motif:Pfam:PF02683" FT sig_peptide complement(562143..562220) FT /note="Signal peptide predicted for dsbD by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.306 between residues 26 and 27" FT CDS 562315..563196 FT /transl_table=11 FT /locus_tag="Cj0604" FT /product="putative polyphosphate kinase" FT /note="Original (2000) note: Cj0604, unknown, len: 293 aa; FT similar to hypothetical proteins e.g. TR:O05877 FT (EMBL:O05877) Mycobacterium tuberculosis Rv3232c FT (MTCY20B11.07c) (295 aa), fasta scores; opt: 858 z-score: FT 1317.7 E(): 0, 52.0% identity in 227 aa overlap. No Hp FT match" FT /note="Updated (2006) note: Pfam domain PF03976 Domain of FT unknown function (DUF344) was identified within CDS This FT Pfam has now been modified to Polyphosphate kinase 2. FT Product modified to more specific family member due to FT motif match. No specific characterisation with acceptable FT identity score has been carried out yet. Putative kept FT within product function. Functional classification - Misc" FT /note="PMID:12486232" FT /db_xref="GOA:Q0PAR3" FT /db_xref="InterPro:IPR016898" FT /db_xref="InterPro:IPR022486" FT /db_xref="InterPro:IPR022488" FT /db_xref="UniProtKB/TrEMBL:Q0PAR3" FT /inference="protein motif:Pfam:PF03976" FT /protein_id="CAL34750.1" FT /translation="MQENNSPKAQAVVKKNEIYVSVKRKKSTIEYEKDLKNLQIELLKF FT QNHVKAKGLKVLILIEGRDAAGKGGAIKRLIEHLNPRGCRVVALEKPSDVEKTQWYFQR FT YIAHLPSAGEIVIFDRSWYNRAGVEPVMGFCTPQQHKDFLREVPLFENMISNSDIIFFK FT FYFSVSKDEQKKRFEKRRSDPLKQYKLSPVDQKSQELWDKYTLAKYSMLLASNTPTCPW FT TIISSDDKKKARLNLLRFILSKVEYPNKKTGDFSKIDAKLVRSGEEEIRKMEANLEKLD FT SKKADEKIKDLD" FT misc_feature 562387..563073 FT /note="HMMPfam hit to PF03976, Domain of unknown function FT (DUF344), score 3.4e-171" FT /inference="protein motif:Pfam:PF03976" FT CDS 563205..564395 FT /transl_table=11 FT /locus_tag="Cj0605" FT /product="putative amidohydrolase" FT /note="Original (2000) note: Cj0605, probable FT amidohydrolase, len: 396 aa; similar to members of the FT AMA/HIPO/HYUC family of hydrolases (peptidase family M40) FT e.g. AMAA_BACST N-acyl-L-amino acid amidohydrolase (370 FT aa), fasta scores; opt: 805 z-score: 1165.8 E(): 0, 41.4% FT identity in 307 aa overlap. Also similar to HIPO_CAMJE FT hippurate hydrolase (Cj0985c) (383 aa) (39.1% identity in FT 376 aa overlap). No Hp match. Contains PS00070 Aldehyde FT dehydrogenases cysteine active site" FT /note="Updated (2006) note: Pfam domain PF01546 Peptidase FT family M20/M25/M40 was identified within CDS. Further FT support given to product function. Putative kept within FT product function. Functional classification - Misc" FT /db_xref="GOA:Q0PAR2" FT /db_xref="InterPro:IPR002933" FT /db_xref="InterPro:IPR011650" FT /db_xref="InterPro:IPR017439" FT /db_xref="UniProtKB/TrEMBL:Q0PAR2" FT /inference="protein motif:Pfam:PF01546" FT /inference="protein motif:Prosite:PS00070" FT /protein_id="CAL34751.1" FT /translation="MQKLVENLALKYYDKVVDLRHQIHMHPELEFEEENTAHLVCKILD FT EFGIKYQKNIAKTGILAIIEGKKKSQKKPKCVLLRADMDALPVQEKTNLSYASKIDGKM FT HACGHDGHTAGLLGAALILNELKDEFCGTIKFMFQPAEEGSGGAKPMIESGVLENPYVD FT AVFGCHLWGPLLENTAQIVSGEMMAGTDIFDLEFIGRGGHGAHPHTCIDPIIMTTQFVN FT NIQSVISRRLAPYEAGVITVGQICAGTTYNVIPTNAYLKGTVRFLNDKTQDILKSSLEE FT VAAATAKSNGGDYKLKYTKEFPPLINDEKAVLIARKAFAKVLGEENIIVSSKPDMGAED FT FAFLTRERMGAYVFVGISKDLNHPALHHSSTFCWDDENLKVLMQGDVMMALEFLNL" FT misc_feature 563436..564380 FT /note="HMMPfam hit to PF01546, Peptidase family FT M20/M25/M40, score 1e-43" FT /inference="protein motif:Pfam:PF01546" FT misc_feature 563919..563954 FT /note="PS00070 Aldehyde dehydrogenases cysteine active FT site" FT /inference="protein motif:Prosite:PS00070" FT CDS 564474..565646 FT /transl_table=11 FT /locus_tag="Cj0606" FT /product="putative secretion protein HlyD" FT /note="Original (2000) note: Cj0606, probable periplasmic FT protein, len: 390 aa; similar to hypothetical proteins e.g. FT E. coli TR:P75830 (EMBL:AE000189) (380 aa), fasta scores; FT opt: 522 z-score: 648.1 E(): 8.4e-29, 31.3% identity in 386 FT aa overlap. No Hp ortholog. Contains probable N-terminal FT signal sequence and poly-Serine tract from aa 211 to 225" FT /note="Updated (2006) note: Pfam domain PF00529 HlyD family FT secretion protein was identified within CDS. Literature FT search identified paper linking the putative three-gene FT operon Cj0606-0608) to a putative type-one secretion FT system. Each of the three CDSs show characteristics similar FT to the alpha-haemolysin secretion system of Escherichia FT coli (PMID:8137117). Product modified to more specific FT family member due to motif match. Some characterisation FT work carried out within Escherichia coli (marginal identity FT score) and designated as macrolide-specific ABC-type efflux FT transporter. Putative kept within product function. FT Functional classification - Protein and peptide secretion" FT /note="PMID:15554967, PMID:8137117, PMID:11544226" FT /db_xref="GOA:Q0PAR1" FT /db_xref="InterPro:IPR006143" FT /db_xref="UniProtKB/TrEMBL:Q0PAR1" FT /inference="protein motif:Pfam:PF00529" FT /protein_id="CAL34752.1" FT /translation="MKKKIVLIILIAILGSVGAYFIFFNNDEKISYLTQKIQKKDISQT FT IEAVGKVYAKDQVDVGAQVSGQIIKLYVDVGTHVKQGDLIAQIDKDKQQNDLDITKAQL FT ESAKANLESKKVALEIANKQYQREQKLYAAKASSLENLETQKNNYYTLKANVAELNAQV FT VQLEITLKNAQKDLGYTTITAPMDGVVINVAVDEGQTVNANQNTPTIVRIANLDEMEVR FT MEIAEADVSKIKVGTELDFSLLNDPQKTYHAKIASIDPADTEVSDSSTSSSSSSSSSSS FT SSSSNAIYYYAKFYVANKDDFLRIGMSIQNEIVVASAKAVLAVPTYAIKSDPKGYYVEI FT LENQKAVKKYVKLGIKDSINTQILEGVNEDEELIVSSSADGLAPKMKLRF" FT sig_peptide 564474..564548 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000284_564474_565646 by SignalP 2.0 FT HMM (Signal peptide probability 0.877) with cleavage site FT probability 0.233 between residues 25 and 26" FT misc_feature 564486..564545 FT /note="1 probable transmembrane helix predicted for Cj0606 FT by TMHMM2.0 at aa 5-24" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 564639..565418 FT /note="HMMPfam hit to PF00529, HlyD family secretion FT protein, score 0.00033" FT /inference="protein motif:Pfam:PF00529" FT CDS 565646..567571 FT /transl_table=11 FT /locus_tag="Cj0607" FT /product="ABC-type transmembrane transport protein" FT /note="Original (2000) note: Cj0607, probable ABC-type FT transmembrane transport protein, len: 641 aa; similar to FT many predicted ABC transporters e.g. YBJZ_ECOLI (648 FT aa),fasta scores; opt: 1729 z-score: 1619.1 E(): 0, 44.3% FT identity in 632 aa overlap. No Hp ortholog. Contains 2x FT PS00017 ATP/GTP-binding site motif A (P-loop), PS00211 ABC FT transporters family signature, Pfam match to entry PF00005 FT ABC_tran, ABC transporters, and two possible FT membrane-spanning regions" FT /note="Updated (2006) note: Literature search identified FT paper linking the three-gene operon (Cj0606-0608) to a FT putative type-one secretion system. Each of the three CDSs FT show characteristics similar to the alpha-haemolysin FT secretion system of E.coli (PMID:8137117). Some FT characterisation work carried out within Escherichia coli FT (marginal identity score) and designated as FT macrolide-specific ABC-type efflux transporter. Putative FT not added to product function. Functional classification FT -Transport/binding proteins - Other" FT /note="PMID:15554967, PMID:8137117, PMID:11544226" FT /db_xref="GOA:Q0PAR0" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR003838" FT /db_xref="InterPro:IPR017871" FT /db_xref="InterPro:IPR017911" FT /db_xref="UniProtKB/Swiss-Prot:Q0PAR0" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34753.1" FT /translation="MIFLKNICKNIGENAILKNVSLSIEKGEFVAIIGQSGSGKTSLLN FT IIGTLDTPSSGTYVFDEYEVTKLNNDEKARLRREKIGFIFQRYNLLSLLSAKENVSLPA FT VYAGKNLQERSQNAKKLLNDLELAHKLDSKPNELSGGQQQRVSIARALINGGELILADE FT PTGALDSKSGIMVLEILQKLNEQGHTIVLVTHDPKIAAQAKRVIEIKDGEILSDTKKEK FT AQEKLILKTMPKEKKTLTLLKNQAFECFKIAYSSILAHKLRSILTMLGIIIGIASVVCV FT VALGLGSQAKVLESIARLGTNTIEIRPGKGFGDLRSGKTRLNFSDLETLRSLEYLEAVD FT AHSNTSGVATYTNISLSARAEGVGVNNFAIEGLRIDAGRILNNDDVKNSTNVAVLDFNA FT KKNLFPDEKSENILGRVVLFNSQPFKIIGVLQKDTDKPIEDNVVRFYIPYTTLMNKLTG FT DRNLREIIVKVKDDVSSTLAENAIIRILEIKRGQKDFFTFNSDTFKQAITANKRTTTIL FT TACVAVIALIVGGIGVMNIMLVSVSERTREIGIRMAIGARREDIMMQFLIEAVMICTIG FT AILGVILSIFVIFAFNTLSTDFPMILNAYSVLLGLLSSMFIGVVFGFFPARNAANLNPI FT SALSKE" FT misc_feature 565724..566281 FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 3.9e-54" FT /inference="protein motif:Pfam:PF00005" FT misc_feature 565745..565768 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 566057..566101 FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature order(566438..566506,567191..567259,567344..567412, FT 567449..567517) FT /note="4 probable transmembrane helices predicted for FT Cj0607 by TMHMM2.0 at aa 265-287, 516-538, 567-589 and FT 602-624" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 566582..566605 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 567029..567547 FT /note="HMMPfam hit to PF02687, Predicted permease, score FT 2.4e-46" FT /inference="protein motif:Pfam:PF02687" FT CDS 567573..568943 FT /transl_table=11 FT /locus_tag="Cj0608" FT /product="putative outer membrane efflux protein" FT /note="Original (2000) note: Cj0608, possible outer FT membrane protein, len: 456 aa; similar to hypothetical FT proteins e.g. YE62_HAEIN HI1462 (454 aa), fasta scores; FT opt: 711 z-score: 933.7 E(): 0, 29.8% identity in 450 aa FT overlap, and weakly to outer membrene proteins e.g. FT TR:Q51006 (EMBL:X95635) Neisseria gonorrhoeae MTRE gene FT (fragment) (467 aa), fasta scores; opt: 289 z-score: 325.5 FT E(): 8.3e-11, 22.8% identity in 465 aa overlap. No Hp FT match. Also similar to Cj0365c (28.6% identity in 455 aa FT overlap). Contains N-terminal signal sequence, PS00013 FT Prokaryotic membrane lipoprotein lipid attachment site and FT PS00217 Sugar transport proteins signature 2" FT /note="Updated (2006) note: Pfam domain PF02321 Outer FT membrane efflux protein was identified within CDS. Product FT modified to more specific family member due to motif match. FT Literature search identified paper linking the three-gene FT operon (Cj0606-0608) to a putative type-one secretion FT system. Each of the three CDSs show characteristics similar FT to the alpha-haemolysin secretion system of E.coli FT (PMID:8137117). Putative kept within product function. FT Functional classification -Transport/binding proteins - FT Other" FT /note="PMID:15554967, PMID:8137117, PMID:11544226" FT /db_xref="GOA:Q0PAQ9" FT /db_xref="InterPro:IPR003423" FT /db_xref="UniProtKB/TrEMBL:Q0PAQ9" FT /inference="protein motif:Pfam:PF02321" FT /inference="protein motif:Prosite:PS00217" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34754.1" FT /translation="MKIILSIFLAFFLSACGVKLSLPKEVDLTQEQMKDLNLTYDWYRS FT YDNAKLNEFLNFVLLNNSDINIARKTLLSALARADLIDYDLYPTLSGNLGFGADKDLNS FT GKQSKNFNNSLNLSYELDIYGKLRDSASASEFSAKASAYDLENLKISMINTALNDVFEL FT AYFNDVDKLLRAYLSNLEQMKELYNYKYKLGKIEELDLLNIEQSLLRAKQNLLSNDQNR FT NLLIKNLQDLLARQEGFAYIEYFKTLSLNDFKTLSPDFNIPLKALAYRADVRSKLNSLK FT SAFKDYSSMQKSILPSISLGGALSGSDKKIDDSFKFEILSGNVKISLPFLDYGRVKQNI FT KISQFAYEQLLISYEQVLQSAMNEFALNYKDYQSDTLLLQNLQNINIKQELITKAYYEK FT YILGKSELKDYLDANNTLNSTQQEFLRARFNLLKTINSYYQITALSFNNENLEFPKY" FT misc_feature 567588..567620 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 567723..568274 FT /note="HMMPfam hit to PF02321, Outer membrane efflux FT protein, score 1.2e-12" FT /inference="protein motif:Pfam:PF02321" FT misc_feature 568359..568901 FT /note="HMMPfam hit to PF02321, Outer membrane efflux FT protein, score 7.5e-11" FT /inference="protein motif:Pfam:PF02321" FT misc_feature 568470..568547 FT /note="PS00217 Sugar transport proteins signature 2" FT /inference="protein motif:Prosite:PS00217" FT CDS complement(568946..570124) FT /transl_table=11 FT /locus_tag="Cj0609c" FT /product="possible periplasmic protein" FT /note="Original (2000) note: Cj0609c, possible periplasmic FT protein, len: 392 aa; no Hp match. Contains possible FT N-terminal signal sequence. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="GOA:Q0PAQ8" FT /db_xref="InterPro:IPR001087" FT /db_xref="InterPro:IPR013830" FT /db_xref="InterPro:IPR013831" FT /db_xref="UniProtKB/TrEMBL:Q0PAQ8" FT /protein_id="CAL34755.1" FT /translation="MLVNKFKVILLFFIIFTSSYAQNLNTNDTIDSILNQNKNHSALTS FT YVSKKDLKNLEKKLEKNQNIGIRIYGDSHMAADFFPRVIRGYLIRSNSIGFAYPLQPKY FT QQNLNLVYSYKNFEILNSRNPANAGHNFPLGGIIAKAKTKGAKINLDTTLDKKNFKIGF FT LFKAKQNTNAFSIKDAKNQSYELRTTQINKWSYKELELDLPLQISALQKDAELGGYFIT FT NKDNNVFLDTIAINGAKSDLWLSWNQEVVKKELELLHNDLIILAYGSNDALFKGFEKQK FT FKNNLKKWISILKTYNKNAVIMLISPPTVVQKQGKNYKLAPDFFTIRKALYEVAKEEKT FT LIFDMHQFMQDSGGKNKWIEQKLSLNDVHLTIKGYELMAKKLLEDLKNIIDY" FT sig_peptide complement(570062..570124) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000287_568946_570124 by SignalP 2.0 FT HMM (Signal peptide probability 0.862) with cleavage site FT probability 0.639 between residues 21 and 22" FT CDS complement(570111..571121) FT /transl_table=11 FT /locus_tag="Cj0610c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0610c, probable periplasmic FT protein, len: 336 aa; no Hp match. Contains probable FT N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF04311 Protein of FT unknown function (DUF459) was identified within CDS. FT Product function kept the same. Functional classification - FT Miscellaneous periplasmic proteins" FT /db_xref="GOA:Q0PAQ7" FT /db_xref="InterPro:IPR007407" FT /db_xref="InterPro:IPR013830" FT /db_xref="InterPro:IPR013831" FT /db_xref="UniProtKB/TrEMBL:Q0PAQ7" FT /inference="protein motif:Pfam:PF04311" FT /protein_id="CAL34756.1" FT /translation="MSVVRFFFILIIVLGLVVVVMNQSISSYIEQKYHFAFYPHNDLLK FT EANGFKIKLEQIRAILSNEPLPQTNEETTNQENKSIDENLSKIDKVLNTLENDENTSHK FT ETNPTLIQDANISFIDNTKLELQNGDEFLFIGDSLMQGVAIALNRDLRNLNLKVTDLSK FT QNTGLSYKSYFDWSKATNEAFIKNSNIKYLVVLLGANDPWDIKKGGNYHRFGSLSWIDI FT YTSRVDEIIKIAKKHKAKVFWFEIPPVKKEDLNKKIQVLNKIYSDEILKNKEIFINTKL FT FFSVNDEYSAYIKDENNRSIKVRTDDGVHFTPSGAREMSKLLLEHIKLKEENASK" FT misc_feature complement(570132..571049) FT /note="HMMPfam hit to PF04311, Protein of unknown function FT (DUF459), score 1.7e-184" FT /inference="protein motif:Pfam:PF04311" FT misc_feature complement(571035..571103) FT /note="1 probable transmembrane helix predicted for Cj0610c FT by TMHMM2.0 at aa 7-29" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(571038..571121) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000288_570111_571121 by SignalP 2.0 FT HMM (Signal peptide probability 0.991) with cleavage site FT probability 0.596 between residues 28 and 29" FT CDS complement(571122..572498) FT /transl_table=11 FT /locus_tag="Cj0611c" FT /product="putative acyltransferase family protein" FT /note="Original (2000) note: Cj0611c, probable FT transmembrane transport protein, len: 458 aa; similar to FT e.g. TR:Q51392 (EMBL:U50202) Pseudomonas aeruginosa ALGI FT (520 aa), fasta scores; opt: 729 z-score: 779.3 E(): FT 0,32.5% identity in 428 aa overlap, and DLTB_BACSU DLTB FT protein (395 aa), fasta scores; opt: 431 z-score: 482.4 FT E(): 1.4e-19, 29.6% identity in 361 aa overlap. 32.9% FT identity to HP0855" FT /note="Updated (2006) note: Pfam domain PF03062 MBOAT FT family identified within CDS. Also, 11 probable FT transmembrane helices predicted by TMHMM2.0. Product FT modified to more specific family member due to motif match. FT No specific characterisation with acceptable identity FT scores identified yet. Putative kept within product FT function. Functional classification - Misc" FT /note="PMID:8636017, PMID:11208804" FT /db_xref="GOA:Q0PAQ6" FT /db_xref="InterPro:IPR004299" FT /db_xref="InterPro:IPR024194" FT /db_xref="UniProtKB/TrEMBL:Q0PAQ6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03062" FT /protein_id="CAL34757.1" FT /translation="MTYFSLEFSILMIAFFAIYWTFKNDYKIQNILILIFSYIIYILIN FT PYFALVLFIYTFFIHYFALLIFVRRKRYIFATCMAFIILNLCFFKYFPSIKGSVDEILN FT FFGLEFLNIDLVLPIGISFYTFTSITYLVEVYQKRRLESFLNLATFLSFFPTLLSGPIM FT RSSFFFEQAYQKREFKHANLIIILLVFGIVKKVLIANYLGIYAKSILDFPQSYNFIQLL FT SAIYAYAIQIYCDFSGYVDLVCAFALMLGFTLPPNFNMPYLAKNLKDFWARWHISLSTF FT IRDYIYIPLGGNRKGIPRTVANILIAFILSGMWHGNTLAFIVWGLLHGIGIVFIHLLTL FT SKFSLQKIPALGRFLTFQFVCFTWIFFYYSKNLEDAIEYFKACYYNFFQIPSYNDIYML FT VAFGVLFMIYPLFINFKEYCIKILNLTPFLLKPFIIAFILLLVFAFMPDGIPDFIYSSF FT " FT misc_feature complement(join(572433..572486,572301..572405, FT 572214..572282,572103..572171,572010..572069, FT 571884..571952,571725..571793,571476..571544, FT 571389..571457,571254..571313,571167..571235)) FT /note="11 probable transmembrane helices predicted for FT Cj0611c by TMHMM2.0 at aa 5-22, 32-66, 73-95, FT 110-132,144-163, 183-205, 236-258, 319-341, 348-370, FT 396-415 and 422-444" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(571377..572195) FT /note="HMMPfam hit to PF03062, MBOAT family, score 4.1e-80" FT /inference="protein motif:Pfam:PF03062" FT CDS complement(572541..573044) FT /transl_table=11 FT /gene="cft" FT /locus_tag="Cj0612c" FT /product="ferritin" FT /note="Original (2000) note: Cj0612c, cft, probable FT ferritin, len: 167 aa; identical to TR:Q46106 FT (EMBL:D64082), and similar to many e.g. FTN_ECOLI ferritin FT (165 aa), fasta scores; opt: 535 z-score: 957.6 E(): FT 0,47.2% identity in 161 aa overlap. 63.9% identity to FT HP0653. Contains Pfam match to entry PF00210 ferritin" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Functional classification FT -Transport/binding proteins - Cations" FT /note="PMID:8809765" FT /db_xref="GOA:Q46106" FT /db_xref="InterPro:IPR001519" FT /db_xref="InterPro:IPR008331" FT /db_xref="InterPro:IPR009040" FT /db_xref="InterPro:IPR009078" FT /db_xref="InterPro:IPR012347" FT /db_xref="PDB:1KRQ" FT /db_xref="UniProtKB/Swiss-Prot:Q46106" FT /inference="protein motif:Pfam:PF00210" FT /protein_id="CAL34758.1" FT /translation="MLSKEVVKLLNEQINKEMYAANLYLSMSSWCYENSLDGAGAFLFA FT HASEESDHAKKLITYLNETDSHVELQEVKQPEQNFKSLLDVFEKTYEHEQFITKSINTL FT VEHMLTHKDYSTFNFLQWYVSEQHEEEALFRGIVDKIKLIGEHGNGLYLADQYIKNIAL FT SRKK" FT misc_feature complement(572613..573026) FT /note="HMMPfam hit to PF00210, Ferritin-like domain, score FT 6.7e-50" FT /inference="protein motif:Pfam:PF00210" FT CDS 573224..574219 FT /transl_table=11 FT /gene="pstS" FT /locus_tag="Cj0613" FT /product="putative periplasmic phosphate binding protein" FT /note="Original (2000) note: Cj0613, pstS, possible FT periplasmic phosphate binding protein, len: 167 aa; similar FT to e.g. SPHX_SYNP7 SPHX protein precursor (337 aa), fasta FT scores; opt: 346 z-score: 602.6 E(): 2.9e-26,33.2% identity FT in 301 aa overlap. No Hp match. Contains probable FT N-terminal signal sequence" FT /note="Updated (2006) note: Characterised within FT Escherichia coli, however, identity score was FT unnacceptable. Putative kept within product function. FT Functional classification - Transport/binding proteins FT -Anions" FT /note="PMID:2651888, PMID:7741855" FT /db_xref="InterPro:IPR024370" FT /db_xref="UniProtKB/TrEMBL:Q0PAQ4" FT /protein_id="CAL34759.1" FT /translation="MKKILSLSVTSLALCGALNAVDLKIAGSSTVYPFTSFVAEEYASI FT KNTKTPIVESLGTGGGFKVFCEGTTDISNASRPMKLSEFETCKKAGVTDIVGMMIGYDG FT IVLAQNKTNAPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPP FT SSSGTRDTIEELVMSDVSKKIPEYKGEYKTIRQDGAYIPSGENDNLIVSKLTIDKDAFG FT IFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYINAKKNPKEAFDFAKI FT YMSDDLAKSGGELEKIGLVPLSDDKLKASQKHVEDRKILNDELVKAGKVF" FT sig_peptide 573224..573307 FT /note="Signal peptide predicted for pstS by SignalP 2.0 HMM FT (Signal peptide probability 0.999) with cleavage site FT probability 0.457 between residues 28 and 29" FT CDS 574229..575143 FT /transl_table=11 FT /gene="pstC" FT /locus_tag="Cj0614" FT /product="putative phosphate transport system permease FT protein" FT /note="Original (2000) note: Cj0614, pstC, probable FT phosphate transport system permease protein, len: 304 aa; FT similar to e.g. PSTC_ECOLI phosphate transport system FT permease protein (319 aa), fasta scores; opt: 289 z-score: FT 590.3 E(): 1.4e-25, 28.9% identity in 305 aa overlap. No Hp FT ortholog. Also similar to downstream gene Cj0615 (30.7% FT identity in 254 aa overlap). Contains Pfam match to entry FT PF00528 BPD_transp, Binding-protein-dependent transport FT systems inner membrane component" FT /note="Updated (2006) note: Six probable transmembrane FT helices predicted by TMHMM2.0. Characterised within FT Pseudomonas putida and Escherichia coli, however, identity FT scores were unnacceptable. Putative kept within product FT function. Functional classification - Transport/binding FT proteins - Anions" FT /note="PMID:16232467, PMID:2646285" FT /db_xref="GOA:Q0PAQ3" FT /db_xref="InterPro:IPR000515" FT /db_xref="InterPro:IPR011864" FT /db_xref="UniProtKB/TrEMBL:Q0PAQ3" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00528" FT /protein_id="CAL34760.1" FT /translation="MLKEKIIKFALFLCAFVSVIVSFAIMLTILIEALKFFQKESVVTF FT LFSSQWAADAAFMNADGTSKQGVFGALSLFWGTFYISLIAMLTALPLGVMCAIYLGVFA FT GKKSKNYLKPILEIIAGIPTVVFGFFAAIVVAPFIVWFFSLFGIQASFQSALGAGFIMG FT IMIVPIVASLSQDCIEAVSEKRINGAYALGMTKKEVVFAVILPEAIPGIVAACLLGLSR FT ALGETMIVVMAASLRPNLTLNFLEDMTTVTVKIVEALSGDQAFDSSLALSAFSLGLVLF FT VITLIINMFSVYLINRFHKRKNL" FT sig_peptide 574229..574342 FT /note="Signal peptide predicted for pstC by SignalP 2.0 HMM FT (Signal peptide probability 0.994) with cleavage site FT probability 0.505 between residues 38 and 39" FT misc_feature order(574253..574321,574475..574543,574580..574648, FT 574691..574750,574823..574891,575045..575113) FT /note="6 probable transmembrane helices predicted for FT Cj0614 by TMHMM2.0 at aa 9-31, 83-105, 118-140, FT 155-174,199-221 and 273-295" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 574451..575128 FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 3.6e-16" FT /inference="protein motif:Pfam:PF00528" FT CDS 575140..576228 FT /transl_table=11 FT /gene="pstA" FT /locus_tag="Cj0615" FT /product="putative phosphate transport system permease FT protein" FT /note="Original (2000) note: Cj0615, pstA, probable FT phosphate transport system permease protein, len: 362 aa; FT similar to e.g. PSTA_ECOLI phosphate transport system FT permease protein (296 aa), fasta scores; opt: 346 z-score: FT 447.5 E(): 1.3e-17, 29.2% identity in 226 aa overlap. No Hp FT ortholog. Also similar to upstream gene Cj0614 (30.7% FT identity in 254 aa overlap). Contains Pfam match to entry FT PF00528 BPD_transp, Binding-protein-dependent transport FT systems inner membrane component" FT /note="Updated (2006) note: Six probable transmembrane FT helices predicted by TMHMM2.0. Characterised within FT Escherichia coli, however, identity scores were FT unnacceptable. Putative kept within product function. FT Functional classification - Transport/binding proteins FT -Anions" FT /note="PMID:2993631, PMID:2896188" FT /db_xref="GOA:Q0PAQ2" FT /db_xref="InterPro:IPR000515" FT /db_xref="InterPro:IPR005672" FT /db_xref="InterPro:IPR024573" FT /db_xref="UniProtKB/TrEMBL:Q0PAQ2" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00528" FT /protein_id="CAL34761.1" FT /translation="MKKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAF FT KQTYIFVEANRNSPAYDLLSRAEQRKIRTGQITEKSWLLANSEVDQYMKQKYNRLSEKQ FT RTLVDDLMQKGEIELKFNSNFFLNGDSKSPENSGILSSVVGTLLVMLVCMVVSVPIGVA FT AAIYLEEFAPQNILTHFIEVCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTL FT AIMSLPIIIVSTKAALKSVDINMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLA FT GAIGETAPLMIIGMIAFIPDVASSIFDSTSVLPAQIYSWSAMPERAFLERTAAGIIVLL FT GLLVVLNLSAILLRKYFQGKLK" FT sig_peptide 575140..575277 FT /note="Signal peptide predicted for pstA by SignalP 2.0 HMM FT (Signal peptide probability 1.000) with cleavage site FT probability 0.581 between residues 46 and 47" FT misc_feature order(575200..575268,575575..575643,575701..575769, FT 575782..575850,575926..575994,576130..576198) FT /note="6 probable transmembrane helices predicted for FT Cj0615 by TMHMM2.0 at aa 21-43, 146-168, 188-210, FT 215-237,263-285 and 331-353" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 575566..576213 FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 1.9e-17" FT /inference="protein motif:Pfam:PF00528" FT CDS 576225..576965 FT /transl_table=11 FT /gene="pstB" FT /locus_tag="Cj0616" FT /product="phosphate transport ATP-binding protein" FT /EC_number="3.6.3.27" FT /note="Original (2000) note: Cj0616, pstB, probable FT phosphate transport ATP-binding protein, len: 246 aa; FT highly similar to many e.g. PSTB_ECOLI phosphate transport FT ATP-binding protein (257 aa), fasta scores; opt: 788 FT z-score: 929.3 E(): 0. 49.0% identity in 247 aa overlap. No FT Hp ortholog. Contains PS00017 ATP/GTP-binding site motif A FT (P-loop), PS00211 ABC transporters family signature, and FT Pfam match to entry PF00005 ABC_tran, ABC transporters" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT removed from product function. Functional classification FT -Transport/binding proteins - Anions" FT /note="PMID:2993631, PMID:8682808" FT /db_xref="GOA:Q9PHQ1" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR005670" FT /db_xref="InterPro:IPR015850" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHQ1" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34762.1" FT /translation="MIAKTTNLNLFYGKKQALFDINMQIEQNKITALIGASGCGKSTFL FT RCFNRMNDKIAKIDGLVEIKGKDVKNQDVVALRKNVGMVFQQPNVFVKSIYENISYAPK FT LHGMIKNKDEEEALVVDCLQKVGLFEEVKDKLKQNALALSGGQQQRLCIARALAIKPKL FT LLLDEPTSALDPISSGVIEELLKELSHNLSMIMVTHNMQQGKRVADYTAFFHLGELIEF FT GESKEFFENPKQEKTKAYLSGAFG" FT misc_feature 576306..576875 FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 3.2e-51" FT /inference="protein motif:Pfam:PF00005" FT misc_feature 576327..576350 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 576651..576695 FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT CDS 577027..577638 FT /transl_table=11 FT /locus_tag="Cj0617" FT /product="hypothetical protein Cj0617 (617 family)" FT /note="Original (2000) note: Cj0617, unknown, len: 203 aa; FT no Hp match. A member of the 617 family of C.j. proteins FT containing homopolymeric tracts; similar to N-terminus of FT Cj1305c (38.9% identity in 180 aa overlap), Cj1306c (39.2% FT identity in 181 aa overlap), Cj1310c (37.4% identity in 182 FT aa overlap) and Cj1342c (49.7% identity in 191 aa overlap). FT The similarities continue in the downstream ORF Cj0618, FT suggesting that these two ORFs may encode a single protein, FT but are frameshifted w.r.t. each other. There is a poly-G FT tract at the site of the possible frameshift FT (577586..577594) and all of the similar genes contain FT variable poly-G tracts at this position. Functional FT classification - Unknown" FT /db_xref="InterPro:IPR022605" FT /db_xref="UniProtKB/TrEMBL:Q0PAQ0" FT /protein_id="CAL34763.1" FT /translation="MIINQIYSIDSCDDVELNIKRGSKLEFRLTYDDSKEIEAIVCIIP FT GGAEDMNSYIYIDDYLTRNYKVAVININYHCIGNRPHLGSSFYLDDIDKFILDTSLKAI FT NLKCINVYGINSYENLNNAFIRIDQEIQKLKLNQQLHQNYKLKTHVSFLPFKNEYQNFG FT IMQAMDILNAIFYIKENSPFKLMRGGVLERFCLEIHMADI" FT repeat_region 577586..577594 FT /note="G(9)" FT CDS 577608..578255 FT /transl_table=11 FT /locus_tag="Cj0618" FT /product="hypothetical protein Cj0618 (617 family)" FT /note="Original (2000) note: Cj0618, unknown, len: 215 aa; FT no Hp match. A member of the 617 family of C.j. proteins FT containing homopolymeric tracts; similar to C-terminus of FT Cj1305c (36.7% identity in 221 aa overlap), Cj1306c (39.1% FT identity in 220 aa overlap), Cj1310c (33.6% identity in 220 FT aa overlap) and Cj1342c (43.4% identity in 221 aa overlap). FT The similarities continue from the upstream ORF Cj0617, FT suggesting that these two ORFs may encode a single protein, FT but are frameshifted w.r.t. each other. There is a poly-G FT tract at thesite of the possible frameshift FT (577586..577594) and all of the similar genes contain FT variable poly-G tracts at this position" FT /note="Updated (2006) note: Literature search identified FT paper giving functional link to motility. Functional FT classification - Unknown" FT /note="PMID:15066034" FT /db_xref="InterPro:IPR022605" FT /db_xref="UniProtKB/TrEMBL:Q0PAP9" FT /protein_id="CAL34764.1" FT /translation="MFGNSYGGYLANLCAKIAPWSIDFILDNSSFVNLFGNIFRLIGFG FT KEIDFTRYHGTYDDTLFKNIFLYLSDKTYWNNNKFSKNYFSNARKIIREPLNKEHLIIQ FT SLYPNPKYILYHSIFDERSPFKNKENFVHILKELNFKVEFFAISQVDNKFIKNLNHGMG FT LSTKLFFKKHLLQILKEPLQDKICKKEVSYKCDELVYTFKEENHQIILNITN" FT CDS 578345..579661 FT /transl_table=11 FT /locus_tag="Cj0619" FT /product="putative MATE family transport protein" FT /note="Original (2000) note: Cj0619, probable integral FT membrane protein, len: 438 aa; similar to hypothetical FT proteins e.g. TR:O07940 B. subtilis YISQ (455 aa), fasta FT scores; opt: 880 z-score: 1364.9 E(): 0, 32.1% identity in FT 446 aa overlap, and YEEO_ECOLI (547 aa), fasta scores; opt: FT 164 z-score: 529.6 E(): 3.3e-22, 22.7% identity in 437 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF01554 MatE was FT identified within CDS. This family of protein function as FT drug/sodium antiporters. These proteins mediate resistance FT to a wide range of cationic dyes, FT fluroquinolones,aminoglycosides and other structurally FT diverse antibodies and drugs. MatE proteins are found in FT bacteria, archaea and eukaryotes. These proteins are FT predicted to have 12 alpha-helical transmembrane regions FT (which this putative CDS has). Product modified to more FT specific family member due to motif match. Literature FT search identified paper giving further support. Functional FT classification -Membranes, lipoproteins and porins" FT /note="PMID:16048946" FT /db_xref="GOA:Q0PAP8" FT /db_xref="InterPro:IPR002528" FT /db_xref="UniProtKB/TrEMBL:Q0PAP8" FT /inference="protein motif:Pfam:PF01554" FT /protein_id="CAL34765.1" FT /translation="MAKKQLSLTRLSFPIFWDLLSKYLTVIINTAMVSHYSNFLVGAMG FT AGNQILDLFITIFSFLSVGCSVLIAQAIGAKDHVLARKVIHQSLFLNALLGFVCGVLIL FT WHGEYLLYLLKIPQELLKDSEIYLHMLAICLFFDAIGIVLAAIVRVYNMAYWVMFIGFL FT MDIVVICGNYYVLHYTKSELFGVGLSNIFARIVAIVALFAILFYKLKIHLKIKEMIKLE FT KEVLKKVLNIGGFSAGENLLWIVQYTIAFAFVASLGEASLSVQTIYFQISMLIMLIGQA FT ISIANEIIVGKLIGARYENIAYKHAWRALYFSVIASALVAFLNYLCQDFTMQILGLKEE FT LKNLMIPLFALSIFLEISRTFNIVMVNSLRASGDAKFPFFSGLVFMMGVSLPVGYVLCF FT HFNLGILGVWIGFCADEFLRGMVNSYRWKSKKWQGKALV" FT misc_feature order(578381..578449,578492..578551,578609..578677, FT 578720..578788,578807..578875,578903..578971, FT 579029..579097,579140..579208,579269..579328, FT 579371..579439,579473..579541,579551..579610) FT /note="12 probable transmembrane helices predicted for FT Cj0619 by TMHMM2.0 at aa 13-35, 50-69, 89-111, FT 126-148,155-177, 187-209, 229-251, 266-288, 309-328, FT 343-365,377-399 and 403-422" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 578384..578866 FT /note="HMMPfam hit to PF01554, MatE, score 3.7e-19" FT /inference="protein motif:Pfam:PF01554" FT misc_feature 578507..578539 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 579637..580284 FT /transl_table=11 FT /locus_tag="Cj0620" FT /product="conserved hypothetical protein Cj0620" FT /note="Original (2000) note: Cj0620, unknown, len: 215 aa; FT some simlarity to TR:O58443 (EMBL:AB009490) Pyrococcus FT horikoshii PHCF016 (230 aa), fasta scores; opt: 229 FT z-score: 237.3 E(): 6.4e-06, 26.9% identity in 197 aa FT overlap. 33.7% identity to HP0806, 25.0% identity to FT HP1401" FT /note="Updated (2006) note: Pfam domain PF01863 Protein of FT unknown function DUF45 identified within CDS. This motif FT has no known function. Members are found in some FT archaebacteria, as well as Helicobacter pylori (Epsilon FT Proteobacteria). The proteins are 190-240 amino acids long, FT with the C terminus being the most conserved FT region,containing three conserved histidines. This motif is FT similar to that found in Zinc proteases, suggesting a FT possible role as a protease. Conserved added to product FT function. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="InterPro:IPR002725" FT /db_xref="UniProtKB/TrEMBL:Q0PAP7" FT /inference="protein motif:Pfam:PF01863" FT /protein_id="CAL34766.1" FT /translation="MARQSSSLKSFIYKDECYFYSKKCIKTLRLRLNEKGEFVLSIPYF FT CTFKSVYEFLDKSSSWMNEAKKRFEKKVLKDDELIFLAKKYKIIFDENTKKTYFDKDKI FT ICQNKAKLDLFLRQNAKKIFTFYLKKWSQKTGLFYTHLSIKNMKTRWGSCNHNKAYVNL FT NLKLIQKSLRAIEYVILHEISHLKFPNHSKEFYTFIEHFMSDFRQREKEFLS" FT misc_feature 579682..580281 FT /note="HMMPfam hit to PF01863, Protein of unknown function FT DUF45, score 1.1e-18" FT /inference="protein motif:Pfam:PF01863" FT CDS 580326..581846 FT /transl_table=11 FT /locus_tag="Cj0621" FT /product="hypothetical protein Cj0621" FT /note="Original (2000) note: Cj0621, unknown, len: 506 aa; FT similar to TR:E1186594 (EMBL:AJ003049) hypothetical protein FT HYDE from Wolinella succinogenes (546 aa), fasta scores; FT opt: 207 z-score: 285.3 E(): 1.3e-08, 25.8% identity in 551 FT aa overlap. 23.2% identity to HP0635" FT /note="Updated (2006) note: Literature search identified FT paper linking product function to hydE-like protein. FT Functional classification - Conserved hypothetical FT proteins" FT /note="PMID:10533287" FT /db_xref="UniProtKB/TrEMBL:Q0PAP6" FT /protein_id="CAL34767.1" FT /translation="MTLDFDFIYNADNDIFEYLLRFYAKNYNYILSKEENTYHFSIDAD FT EENLKTFCDSLNFMSHSVFLKKFDVKAGQGFNPCIPEDKEFSRFSYITHLNSNAYQEKK FT LLNKNEWGVFCECEFSSNLSEFEKINEENFNTFLNLAFDLLSQEKKIYLKDKNGIYEFS FT LFKNEFIGDFLLPCDIKAINSVFVCSNENLKLLASLEKPLMKLRLNAMFRKNHNLDFSD FT FKIRLARDLFCFALGLKLFENEYKFLSVKKIEEYQKDFYISALDEQVVVLEGFEFINAK FT ARELIFSKEDKNMARISYLVSRYKEKAFILELSKDYEDILLINKELNLLKLCLPKHSKE FT LYEEIKKDEIGARLLENFNKEFPLLDENFELQNNFYSLLGLLGRVLNLGRNLQESASEL FT LKIADESKMPRGVKIDYRLKEDKSFDYTRTLRSAMSFMLAGVDSANIAYGAVESLAYFL FT RDTYDELREKKQSDLALISGSLFEHKSLLKNTLKHLKNCQLSDVPLRI" FT CDS 581827..584016 FT /transl_table=11 FT /gene="hypF" FT /locus_tag="Cj0622" FT /product="carbamoyltransferase" FT /EC_number="2.1.3.-" FT /note="Original (2000) note: Cj0622, hypF, probable FT transcriptional regulatory protein, len: 729 aa; similar to FT many e.g. HYPF_ECOLI transcriptional regulatory protein FT HYPF (750 aa), fasta scores; opt: 1166 z-score: 1359.5 E(): FT 0, 34.1% identity in 747 aa overlap. 35.0% identity to FT HP0048. Contains PS00150 Acylphosphatase signature 1 and FT Pfam match to entry PF01300 Sua5_yciO_yrdC,SUA5/yciO/yrdC FT family" FT /note="Updated (2006) note: Pfam domain PF07503 HypF finger FT was identified within CDS. Further support given to product FT function. Characterised within Escherichia coli with FT marginal identity score. Product function updated with new FT EC number. Putative not added to product function. FT Functional classification - Energy metabolism -Respiration" FT /note="PMID:15504408, PMID:1849603" FT /db_xref="GOA:Q0PAP5" FT /db_xref="InterPro:IPR001792" FT /db_xref="InterPro:IPR004421" FT /db_xref="InterPro:IPR006070" FT /db_xref="InterPro:IPR011125" FT /db_xref="InterPro:IPR017945" FT /db_xref="InterPro:IPR017968" FT /db_xref="UniProtKB/TrEMBL:Q0PAP5" FT /inference="protein motif:Pfam:PF07503" FT /inference="protein motif:Pfam:PF01300" FT /inference="protein motif:Prosite:PS00150" FT /protein_id="CAL34768.1" FT /translation="MCHLGYKIKISGLVQGVGFRPLVYELALKSKLFGEVRNDGFGVEI FT ILACTQKECENFIENLKNHLPPLARIDQLIITQISISNYENFSITPSLENTKSTPMLSD FT FAFCKECKKEFFDEKNPRFLYPFITCTHCGPRFSIIKSLPYDRAHTSMQELLMCEFCKS FT EYEDPKNRRFHAQPISCPKCKINVFLKNPKGEILAKDQEAFMQSAKFLKEGKILAIKGI FT GGFHLMCDAFNEEALKTLRLRKNRPKKPFALMCKDLQSAKELAFIDEKEEALLGGVLAP FT IVILKAKKAFSLIAPDVDKIGIMLAYTPLHLLLFEYFKGSLVATSANLSGESIIKDEFN FT LCKKLDKVFDFYLDYDREIINASDDSIAQVVNGETMFLRTSRGLNPFYLERNFNKKGTF FT LALGAELKNEFVIFYENKLLISPYIGDLKSLDVHERFFKLLEFFKQNYDLKFDAILCDK FT HPHFSYAKEFEERIKISHHYAHFCAAYFEYEENFAKDEKALAFICDGTGYGEDGKIWGG FT EVFVGNLKEYERIAHFENFTLINSDIKNIQNLALSLIFHYDLEDKAKDFLAKIPKIKLK FT NLKKIYSHSNLQTSSLGRIIDAFGSIVFNLEKSSYEAQVGLMCEAFYDKNLDFSYKLFV FT EKGQVNFKNLILGALQDEKTKAITGMFNALANFIIDFSKDYDLKVLLSGGVFQNKTLLE FT ILKAKNFDFFIPLKYPCNDSSIALGQMVHFLNLEK" FT misc_feature 581845..582093 FT /note="HMMPfam hit to PF00708, Acylphosphatase, score FT 2.2e-07" FT /inference="protein motif:Pfam:PF00708" FT misc_feature 581854..581886 FT /note="PS00150 Acylphosphatase signature 1" FT /inference="protein motif:Prosite:PS00150" FT misc_feature 582145..582249 FT /note="HMMPfam hit to PF07503, HypF finger, score 2e-16" FT /inference="protein motif:Pfam:PF07503" FT misc_feature 582295..582393 FT /note="HMMPfam hit to PF07503, HypF finger, score 3.2e-16" FT /inference="protein motif:Pfam:PF07503" FT misc_feature 582448..582969 FT /note="HMMPfam hit to PF01300, yrdC domain, score 6.5e-52" FT /inference="protein motif:Pfam:PF01300" FT misc_feature 583099..583305 FT /note="HMMPfam hit to PF00814, Glycoprotease family, score FT 2.3e-18" FT /inference="protein motif:Pfam:PF00814" FT CDS 584094..584837 FT /transl_table=11 FT /gene="hypB" FT /locus_tag="Cj0623" FT /product="hydrogenase isoenzymes formation protein" FT /note="Original (2000) note: Cj0623, hypB, probable FT hydrogenase isoenzymes formation protein, len: 247 aa; FT similar to many e.g. HYPB_ECOLI hydrogenase isoenzymes FT formation protein (290 aa), fasta scores; opt: 691 z-score: FT 1142.3 E(): 0, 46.1% identity in 230 aa overlap. 44.2% FT identity to HP0900. Contains PS00028 Zinc finger,C2H2 type, FT domain" FT /note="Updated (2006) note: Pfam domain PF02492 FT CobW/HypB/UreG, nucleotide-binding domain was identified FT within CDS. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Putative not added to product function. FT Functional classification - Energy metabolism -Respiration" FT /note="PMID:7601092, PMID:1849603" FT /db_xref="GOA:Q0PAP4" FT /db_xref="InterPro:IPR003495" FT /db_xref="InterPro:IPR004392" FT /db_xref="InterPro:IPR012202" FT /db_xref="UniProtKB/TrEMBL:Q0PAP4" FT /inference="protein motif:Pfam:PF02492" FT /inference="protein motif:Prosite:PS00028" FT /protein_id="CAL34769.1" FT /translation="MCKDCGCSINSSHTHGHHHDHHHENPSLKEGKTIEVISKILSKND FT EEAKHNRAHFNEANTLCINLMSSPGSGKTTLLESTIKALKNELKIAVIEGDLETNNDAL FT RVKNAGALAYQITTGQSCHLDAFMVHEALHHLAIDDVDLLFIENVGNLVCPASYDLGEH FT LNVVLLSITEGSDKPQKYPVMFKKADIVLITKADLAHHFDFDIKEATRLIKELNPRADI FT ITLDAKNGTNMELWYKVLKLKKELF" FT misc_feature 584097..584162 FT /note="PS00028 Zinc finger, C2H2 type, domain" FT /inference="protein motif:Prosite:PS00028" FT misc_feature 584274..584765 FT /note="HMMPfam hit to PF02492, FT CobW/HypB/UreG,nucleotide-binding domain, score 4e-67" FT /inference="protein motif:Pfam:PF02492" FT misc_feature 584427..584459 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 584837..585118 FT /transl_table=11 FT /gene="hypC" FT /locus_tag="Cj0624" FT /product="hydrogenase isoenzymes formation protein" FT /note="Original (2000) note: Cj0624, hypC, probable FT hydrogenase isoenzymes formation protein, len: 93 aa; FT similar to many e.g. HYPC_ECOLI hydrogenase isoenzymes FT formation protein (90 aa), fasta scores; opt: 145 z-score: FT 173.2 E(): 0.024, 35.9% identity in 78 aa overlap. 53.3% FT identity to HP0899" FT /note="Updated (2006) note: Pfam domain PF01455 HupF/HypC FT family protein was identified within CDS. Further support FT given to product function. Characterised within Escherichia FT coli with acceptable identity score. Putative not added to FT product function. Functional classification -Energy FT metabolism - Respiration" FT /note="PMID:8021226, PMID:1849603" FT /db_xref="InterPro:IPR001109" FT /db_xref="UniProtKB/TrEMBL:Q0PAP3" FT /inference="protein motif:Pfam:PF01455" FT /protein_id="CAL34770.1" FT /translation="MCLSIPSEILEIDELNNALVQTLGVKRKVNLDLIDEPLKQGDYVL FT IHVGVAMEKIDKEAALESIKTYQEIVEKMNSGEIKSDEGDLGLNEFHR" FT misc_feature 584837..585058 FT /note="HMMPfam hit to PF01455, HupF/HypC family, score FT 2e-26" FT /inference="protein motif:Pfam:PF01455" FT CDS 585102..586193 FT /transl_table=11 FT /gene="hypD" FT /locus_tag="Cj0625" FT /product="hydrogenase isoenzymes formation protein" FT /note="Original (2000) note: Cj0625, hypD, probable FT hydrogenase isoenzymes formation protein, len: 363 aa; FT similar to many e.g. HYPD_ECOLI hydrogenase isoenzymes FT formation protein (373 aa), fasta scores; opt: 1097 FT z-score: 1671.2 E(): 0, 41.3% identity in 368 aa overlap. FT 58.5% identity to HP0898" FT /note="Updated (2006) note: Pfam domain PF01924 Hydrogenase FT formation hypA family protein was identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli with acceptable identity score. FT Putative not added to product function. Functional FT classification - Energy metabolism -Respiration" FT /note="PMID:1849603" FT /db_xref="GOA:Q0PAP2" FT /db_xref="InterPro:IPR002780" FT /db_xref="UniProtKB/TrEMBL:Q0PAP2" FT /inference="protein motif:Pfam:PF01924" FT /protein_id="CAL34771.1" FT /translation="MNFIDEFRDKESILALKKLIEQELKNPINIMEICGGHTHSIMKYA FT LPSILPKEINFIHGPGCPVCVMPRVRIDTAIKLASMKDTIFCTLGDLLRVPGSEISLLD FT LRAKGADVRALYSPLEVLEIAKQNLNKNIIFFAIGFETTTPMSALLLQKVIEEKINNVF FT FHINHITVPAPVEAIMNDENVKINAFLGPSHVSVITGYGIYEPLAAKFKTPIAVSGFEP FT VDILESVLNIIKQSNEGTFKVYNQYKRAVSKEGNVKAQNLVKKYFRVCDFEFRGLGLIK FT DGGLELKEEFSAYDASKKFDCTVQSKNESKACICGQILRGLAKPYDCKVFGKACTPRSP FT IGSCMVSGEGACAAYYKYSKVNA" FT misc_feature 585126..586184 FT /note="HMMPfam hit to PF01924, Hydrogenase formation hypA FT family, score 8.6e-204" FT /inference="protein motif:Pfam:PF01924" FT CDS 586190..587164 FT /transl_table=11 FT /gene="hypE" FT /locus_tag="Cj0626" FT /product="hydrogenase isoenzymes formation protein" FT /note="Original (2000) note: Cj0626, hypE, probable FT hydrogenase isoenzymes formation protein, len: 324 aa; FT similar to many e.g. HYPE_ECOLI hydrogenase isoenzymes FT formation protein (322 aa), fasta scores; opt: 705 z-score: FT 923.2 E(): 0, 40.4% identity in 327 aa overlap. 46.8% FT identity to HP0047. Contains Pfam match to entry PF00586 FT AIRS, AIR synthase related proteins" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Energy metabolism - Respiration" FT /note="PMID:1849603" FT /db_xref="GOA:Q0PAP1" FT /db_xref="InterPro:IPR000728" FT /db_xref="InterPro:IPR010918" FT /db_xref="InterPro:IPR011854" FT /db_xref="InterPro:IPR016188" FT /db_xref="UniProtKB/TrEMBL:Q0PAP1" FT /inference="protein motif:Pfam:PF00586" FT /protein_id="CAL34772.1" FT /translation="MKNISLAHGGGGEEMNELLTKLFKIFDNEILNANNDAAILGNLAL FT STDSFVLSPIFLDEEVNIGKLCVCGSINDVLMVGAKPKYLSLGLILEEGFELEKLERIL FT KSIKEECEKCGVMLVCGDTKVVPKGKADEIYINTTALGEIISKKESKNIKAGLSILLSG FT DIGRHGASVLIKRNELEADIKSDCKALNKEVLELLEKDIKVVAMRDATRGGLSAVLNEW FT AKQSGNDLLIFEEKIIVQDEVLGLCELFGYEAYELANEGTFILCVEKEDELKALEILKK FT YNVNASIIGEVLEEKKARVILQNAYGAKRFLESPKGELLPRIC" FT misc_feature 586190..586630 FT /note="HMMPfam hit to PF00586, AIR synthase related FT protein, N-terminal dom, score 7.3e-21" FT /inference="protein motif:Pfam:PF00586" FT misc_feature 586649..587098 FT /note="HMMPfam hit to PF02769, AIR synthase related FT protein, C-terminal dom, score 3.7e-36" FT /inference="protein motif:Pfam:PF02769" FT CDS 587164..587508 FT /transl_table=11 FT /gene="hypA" FT /locus_tag="Cj0627" FT /product="hydrogenase expression/formation protein" FT /note="Original (2000) note: Cj0627, hypA, probable FT hydrogenase isoenzymes formation protein, len: 114 aa; FT similar to e.g. HYPA_AZOVI hydrogenase expression/formation FT protein (113 aa), fasta scores; opt: 228 z-score: 397.9 FT E(): 7.2e-15, 32.4% identity in 111 aa overlap. 39.7% FT identity to HP0869. Contains Pfam match to entry PF01155 FT HypA, Hydrogenase expression/synthesis hypA family" FT /note="Updated (2006) note: Characterised within FT Azotobacter vinelandii and Escherichia coli with marginal FT identity scores. Putative not added to product function. FT Functional classification - Energy metabolism -Respiration" FT /note="PMID:1849603, PMID:1610901" FT /db_xref="GOA:Q9PHP0" FT /db_xref="InterPro:IPR000688" FT /db_xref="InterPro:IPR020538" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHP0" FT /inference="protein motif:Pfam:PF01155" FT /protein_id="CAL34773.1" FT /translation="MHELSIVESLIELCEENALNNKAYNVQEIYVKIGRLSGIEVDLFK FT RCFETFKENSNICKNAKLFIELAPLEILCLKCDQTSILEENVFKCPKCQSIEYKIIQGE FT DLHLMRLVMK" FT misc_feature 587164..587505 FT /note="HMMPfam hit to PF01155, Hydrogenase FT expression/synthesis hypA family, score 3.3e-50" FT /inference="protein motif:Pfam:PF01155" FT CDS join(587868..588371,588373..591303) FT /transl_table=11 FT /locus_tag="Cj0628" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0628, probable FT lipoprotein,len: 171 aa; no Hp match. Contains N-terminal FT signal sequence and appropriately positioned PS00013 FT Prokaryotic membrane lipoprotein lipid attachment site. FT There is a variable poly-T tract at the C-terminus T(4-5). FT T5 causes the ORF to stop here, T4 allows translation into FT the downstream ORF Cj0629. Similar to Cj1677 (42.4% FT identity in 172 aa overlap). Cj1677 has a non-variable FT poly-T tract in an quivalent position, which could allow FT translation into Cj1678 (highly similar to Cj0629)" FT /note="Original (2000) note: Cj0629, possible FT lipoprotein,len: 978 aa; no Hp match. Contains a variable FT poly-T tract at the N-terminus T(4-5). T5 causes the ORF to FT start here,T4 allows translation from the upstream ORF FT Cj0628 (which contains a signal sequence and lipid FT attachment site). Highly similar to Cj1678 (90.7% identity FT in 901 aa overlap). Cj1678 has a non-variable poly-T tract FT in an quivalent position, which could allow translation FT from Cj1677 (similar to Cj0628)" FT /note="Updated (2006) note: Coding sequences have been FT merged to reflect the complete amino acid sequence for this FT gene regardless of phase. Previous annotation gave Cj0628 FT and Cj0629 as seperate CDS. Merging of these CDSs has lead FT to loss of the downstream CDS. Functional classification - FT Membranes, lipoproteins and porins" FT /db_xref="InterPro:IPR005546" FT /db_xref="UniProtKB/TrEMBL:Q0PAN9" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34774.1" FT /translation="MNKTALTKTYTKDIQNSCLNSKKIVLSLATISFLASCTHATLTPE FT IKTYEETNRHAKARSGLQSRNSNNETINNLQTLTKTISDTGNTLVIESSGTITISNDGQ FT QAVNFQPNSSTSTFLNKGTLIGGNNTASVQLGAANGNNGVSIETFNNQGIIGNGSSKFG FT VTVFGGGSKDNPKSIINNFSNSGTIHSNTGESIYFGNAKISSFVNSGTIKSKQGAGVNI FT SQGTSIENFNNTGTGIIEGKRMGVNVRSTINTFVNDGLIAATNDGIQINANVKTLINKG FT TIKGDAISIRSLGGTIETLTNEGIMYGKSAGIYMNRSLVKTLTNSGTINQNNSATWSAG FT IKLENGSIIENIINTGSIRSNAFGISVTGGKFGTLTIKDGGMVYGKYSAIGVGRSQTLG FT DLYIDGRSNNGTVSGIYSEEHGILLENNSRTQKIELKNGGIIKGNIDGIRLINSASLSG FT EMILSGEGSRVEGGRGVGILNRSGKIEGSIKVEDGATVTATSNRAIANSGSGSITGGIT FT VSGKNTKLEGNIINTGNASIGSDIKIEGGAKVEGGLVNQGNGSISGSVQVSGGSSIDSI FT TNEGNGAISGSITVYKDSKLDSITNTSTSSTGISGSITNNSDNKLEISNSGNIGGKIES FT TGSADMVISNSNGGTISGGISSSGSGSTSISNSQGSTINNGITVSGSAQVEISNQGSVG FT KDENGNTVTNNGSGSVGIKDWLVSTDKNTGKLNTVVIGGSRAFNVKVENITVDQSNVDL FT EELNDINNIISGVNQNNIGNIGTNGSGEISLSFDPITGKLTTDFNLNASISGATFRSLI FT STTSRRSTFIDNVMGNSMQSFALASSSKSQSIAMSEKGNLYADASDYIKSDLNNGSYGS FT NKEHSLFILPYTSSQNVELSLNEESKGHTKGTIIGYSTLKDSGIYGVYAGYEDTKMGST FT YFDINNRTYYAGLKYFNTLFTTEKGQEVYIKAQGKAALIKNDLTEKIGNNEAKAEPNSY FT AYGVNTALGMNFISNKDIFSPEIGLAYEGGYTEAFSMKDTIGQATVKGGERTYANYLNL FT FSTKTSLTWFRDWLPNLKTSVELGAKFNINPKVEAEARFGNIKVSDEFDLPRVQKFVST FT SFIVPVNEAFYFSLNYNGMFDKDGNTHTGFAQFNYLW" FT sig_peptide 587868..587987 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000295_587868_591303 by SignalP 2.0 FT HMM (Signal peptide probability 0.790) with cleavage site FT probability 0.634 between residues 40 and 41" FT misc_feature 587946..587978 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT repeat_region 588369..588378 FT /note="G(10)" FT repeat_region 588981..591400 FT /note="repeat 2: identical to 1598048..1600468" FT misc_feature 590479..591276 FT /note="HMMPfam hit to PF03797, Autotransporter beta-domain, FT score 5.9e-38" FT /inference="protein motif:Pfam:PF03797" FT CDS complement(591537..592502) FT /transl_table=11 FT /gene="holA" FT /locus_tag="Cj0630c" FT /product="putative DNA polymerase III, delta subunit" FT /note="Original (2000) note: Cj0630c, unknown, len: 321 aa; FT 26.6% identity to HP1247" FT /note="Updated (2006) note: Pfam domain PF06144 DNA FT polymerase III, delta subunit identified within CDS. FT Product modified to more specific family member due to FT motif match. No specific characterisation has been carried FT out. Putative kept within product function. Functional FT classification - DNA replication,restriction/modification, FT recombination and repair" FT /note="PMID:11432857" FT /db_xref="GOA:Q0PAN8" FT /db_xref="InterPro:IPR010372" FT /db_xref="UniProtKB/TrEMBL:Q0PAN8" FT /inference="protein motif:Pfam:PF06144" FT /protein_id="CAL34775.1" FT /translation="MYRKELQILLSKDSIPNFFFLYGADNFQSELYAEFIKEKYKPDET FT LKLFFEEYNFTRASDFLSAGSLFSEKKLLEIKTSKKIPTKDLKVLVELCKNNTDNFFLL FT ELYDESSKQSDIEKIFSPHFVRFFKANGAKEGVELLSIKAKQLGVEITQNALFTLFTSF FT DENLYLAASELNKFSGLRVDEKTIEQYCYSLNTGSFESFFDKILKKQDFKSELEKILDN FT FNEIALINSLYNSFYRLFKIALYAKINGKIDFKELLGYTPPPQVGQNLSSQAFSLKIEQ FT YKEIFTLLLKSEYELKTNPKLVKKEFLISNLLKLARILKN" FT misc_feature complement(591576..592448) FT /note="HMMPfam hit to PF06144, DNA polymerase III, delta FT subunit, score 0.0012" FT /inference="protein motif:Pfam:PF06144" FT CDS complement(592495..594429) FT /transl_table=11 FT /locus_tag="Cj0631c" FT /product="putative ribonuclease" FT /note="Original (2000) note: Cj0631c, possible FT ribonuclease, len: 644 aa; similar to members of the FT ribonuclease II (RNB) family, e.g. VACB_ECOLI VACB protein FT (813 aa), fasta scores; opt: 503 z-score: 829.1 E(): FT 0,31.0% identity in 580 aa overlap. 35.1% identity to FT HP1248. Contains PS01175 Ribonuclease II family FT signature,and Pfam match to entry PF00773 RNB, RNB-like FT proteins" FT /note="Updated (2006) note: Some characterisation within FT Escherichia coli, however, identity scores were marginal. FT Putative kept within product function. Functional FT classification - Degradation of macromolecules" FT /note="PMID:9603904" FT /db_xref="GOA:Q0PAN7" FT /db_xref="InterPro:IPR001900" FT /db_xref="InterPro:IPR022966" FT /db_xref="UniProtKB/TrEMBL:Q0PAN7" FT /inference="protein motif:Pfam:PF00773" FT /inference="protein motif:Prosite:PS01175" FT /protein_id="CAL34776.1" FT /translation="MKEFLNSLSYGISSHEVNNEFKQIFRELLTNHIIKEHKNKYYLNN FT GFAFGVLDISSKGTGFLQCFDESFKKDLLIENKNLKGANYKDIVAVKLLPLKKKRPSAK FT VILVLKRANETSLMITKRYGEAVLGMNIKTGLSTALKASQKSLKALPLGTILKIENENN FT NIIEVLGHIDDESVDEKISLALFNKNNEFSDACIKEALANGDSVDASMYENRMDLRALP FT FCTIDPIHAKDFDDAIYFDTQKREIYVAIADVSEYVYAYSAIDKEARNRGFSIYFPHIA FT IPMLPRPLSENICSLKPHLDRLAYCFKITLNHENKVIKEELFEGIINSKRRFNYDEVDE FT ILIQKPDLKELSWLYELFEITKNLRKMRLKNAFEFRTEELRMNLDENLSLKSTVFEKDT FT PSHNLIEDCMLLANKAAAKLIDIGVFRNHLSADVRKIDKLLNELRELGIDVNFKPNLPE FT LIRDIQALADELNLRAEVDKLIIKAQKKAEYSSVNAGHFGLGFDKYSHFTSPIRRYSDL FT ILHRLLKAKQKNDEKLFNYLLLNIESTCENLSTLEREADKVAFDFMDRKFARWAAKNIG FT KKFKALVVQNDGVCIAKLDDEIKGADIILYDTRVNLLENVEVQIMEADIVMAKIYAKIT FT QRLIKEENV" FT misc_feature complement(592870..592944) FT /note="PS01175 Ribonuclease II family signature" FT /inference="protein motif:Prosite:PS01175" FT misc_feature complement(592957..594024) FT /note="HMMPfam hit to PF00773, RNB-like protein, score FT 1.9e-59" FT /inference="protein motif:Pfam:PF00773" FT CDS 594548..595570 FT /transl_table=11 FT /gene="ilvC" FT /locus_tag="Cj0632" FT /product="ketol-acid reductoisomerase" FT /EC_number="1.1.1.86" FT /note="Original (2000) note: Cj0632, ilvC, probable FT ketol-acid reductoisomerase, len: 340 aa; similar to many FT e.g. ILVC_LACLA ketol-acid reductoisomerase (EC 1.1.1.86) FT (344 aa), fasta scores; opt: 1275 z-score: 2051.2 E(): FT 0,60.5% identity in 319 aa overlap, and ILVC_ECOLI FT ketol-acid reductoisomerase (EC 1.1.1.86) (490 aa), fasta FT scores; opt: 571 z-score: 742.6 E(): 0, 33.0% identity in FT 330 aa overlap. 52.6% identity to HP0330" FT /note="Updated (2006) note: Pfam domain PF01450 cetohydroxy FT acid isomeroreductase, catalytic domain identified within FT CDS. Further support given to product function. FT Characterised within more than one genus with acceptable FT identity scores. Putative not added to product function. FT Functional classification - Amino acid biosynthesis - FT Branched chain family" FT /note="PMID:3003115" FT /db_xref="GOA:Q9PHN5" FT /db_xref="InterPro:IPR000506" FT /db_xref="InterPro:IPR008927" FT /db_xref="InterPro:IPR013023" FT /db_xref="InterPro:IPR013116" FT /db_xref="InterPro:IPR013328" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHN5" FT /inference="protein motif:Pfam:PF01450" FT /protein_id="CAL34777.1" FT /translation="MAITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDNGVNVT FT IGLREGSVSAVKAKNAGFEVVSVSEASKIADVIMILAPDEIQADIFNVEIKPNLSEGKA FT IAFAHGFNIHYGQIVVPKGVDVIMIAPKAPGHTVRNEFTLGGGTPCLIAIHQDESKNAK FT NLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLSALIQAGFETLVEAGYEP FT EMAYFECLHEMKLIVDLIYQGGIADMRYSISNTAEYGDYITGPKIITEETKKAMKGVLK FT DIQNGVFAKDFILERRAGFARMHAERKNMNDSLIEKTGRNLRAMMPWISAKKLVDKDKN FT " FT misc_feature 595100..595537 FT /note="HMMPfam hit to PF01450, Acetohydroxy acid FT isomeroreductase, catalyti, score 2e-84" FT /inference="protein motif:Pfam:PF01450" FT CDS 595574..596656 FT /transl_table=11 FT /locus_tag="Cj0633" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0633, probable periplasmic FT protein, len: 360 aa; similar in C-terminus to hypothetical FT proteins e.g. TR:O51711 (EMBL:AE001176) Borrelia FT burgdorferi BB0770 (293 aa), fasta scores; opt: 425 FT z-score: 553.2 E(): 1.6e-23, 36.3% identity in 237 aa FT overlap. No Hp match. Contains probable N-terminal signal FT sequence" FT /note="Updated (2006) note: Pfam domain PF04748 Divergent FT polysaccharide deacetylase identified within CDS. No FT specific characterisation has been carried out yet. Product FT function unchanged. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="GOA:Q0PAN5" FT /db_xref="InterPro:IPR002509" FT /db_xref="InterPro:IPR006837" FT /db_xref="InterPro:IPR011330" FT /db_xref="UniProtKB/TrEMBL:Q0PAN5" FT /inference="protein motif:Pfam:PF04748" FT /protein_id="CAL34778.1" FT /translation="MSKKKLVQIQRYLIIAILFLLCIALALGILVKYQNSQDVSSVKPD FT YFIDKQEDLISLNKDHYEIGIFQENEFDNNKSVSILEQKIQEIDDLNTSLNEQNLSSVE FT QNLSLEQNQSLEQNFILKDTNLTQDQNLTFNEDIHLNKISKKPKLAIIIDDMANASQVR FT GLKALNLKLNPSFFPPDKNHSETPKLALKFDFYMVHLPLAAINYNKPELDTLNPNDSKE FT RIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMKKLYEALKNQNIFFVDSKTIGNSKA FT NKIAKELSIPYIQRDVFLDNEDDVNYVKKQLENAVKLAQKKGFVIAIGHPRKNTFKALE FT QSKDLLKGVDLVYLSEIYGK" FT sig_peptide 595574..595672 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000297_595574_596656 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.570 between residues 33 and 34" FT misc_feature 595607..595666 FT /note="1 probable transmembrane helix predicted for Cj0633 FT by TMHMM2.0 at aa 12-31" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 596024..596650 FT /note="HMMPfam hit to PF04748, Divergent polysaccharide FT deacetylase, score 1.4e-112" FT /inference="protein motif:Pfam:PF04748" FT CDS 596646..597419 FT /transl_table=11 FT /gene="dprA" FT /locus_tag="Cj0634" FT /product="DNA processing protein A" FT /note="Original (2000) note: Cj0634, unknown, len: 257 aa; FT similar, in part, to members of the SMF family e.g. FT SMF_HAEIN SMF protein (DNA processing chain A) (373 FT aa),fasta scores; opt: 329 z-score: 487.6 E(): 7.2e-20, FT 31.5% identity in 213 aa overlap. 48.8% identity to HP0333" FT /note="Updated (2006) note: Pfam domain PF02481 SMF family FT identified within CDS. Further support given to product FT function. Literature search identified Campylobacter jejuni FT characterising paper. Product modified to more specific FT family member. Functional classification - DNA replication, FT restriction/modification, recombination and repair" FT /note="PMID:16194595" FT /db_xref="GOA:Q0PAN4" FT /db_xref="InterPro:IPR003488" FT /db_xref="UniProtKB/TrEMBL:Q0PAN4" FT /inference="protein motif:Pfam:PF02481" FT /protein_id="CAL34779.1" FT /translation="MASEILPDEFLELFKDLKKPPKKLHYKGNLSLLKQDKIAIIGSRR FT MSVYTKNCVFSLASMLKNAHLCVVSGGALGVDITASMAAMPNTIGIFANGLDQIYPRTN FT EKIIKQIYENALALSEYEDDYLPKNYDFLLRNRLVIALSKAVVVAQADIKSGSMQSAKL FT ALELNKPLYVLPQRLGESTATNLLLKENKAKLICDFKEFVSEFASIDMNQDEFLEFCKK FT GVSVDEALKIYGQKVYEYELEGKISIEGLFIRVLA" FT misc_feature 596649..597236 FT /note="HMMPfam hit to PF02481, SMF family, score 2e-53" FT /inference="protein motif:Pfam:PF02481" FT CDS 597416..597799 FT /transl_table=11 FT /locus_tag="Cj0635" FT /product="putative holliday junction resolvase" FT /note="Original (2000) note: Cj0635, unknown, len: 127 aa; FT similar to hypothetical proteins e.g. YQGF_ECOLI (138 FT aa),fasta scores; opt: 154 z-score: 261.0 E(): 3e-07, 32.8% FT identity in 131 aa overlap. 44.1% identity to HP0334" FT /note="Updated (2006) note: Marginal identity score with FT partially characterised Escherichia coli. Product modified FT to new function. Putative kept within product function. FT Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /note="PMID:10982859, PMID:12153044" FT /db_xref="GOA:Q9PHN2" FT /db_xref="InterPro:IPR005227" FT /db_xref="InterPro:IPR006641" FT /db_xref="InterPro:IPR012337" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHN2" FT /protein_id="CAL34780.1" FT /translation="MRALALDVGLKRIGVALCIDKKIALPLDAVLRKNRNQAANEIKNL FT LKIHEISLLIVGIPKGGSSEEEMTRRIKHFVSLLEFDKEICFVDESGTSKEALGYGVAN FT TRKKDGKLDSLSAFIMIKDYFAL" FT misc_feature 597416..597796 FT /note="HMMPfam hit to PF03652, Uncharacterised protein FT family (UPF0081), score 1e-52" FT /inference="protein motif:Pfam:PF03652" FT CDS 597828..598667 FT /transl_table=11 FT /locus_tag="Cj0636" FT /product="NOL1/NOP2/sun family protein" FT /note="Original (2000) note: Cj0636, unknown, len: 279 aa; FT similar to members of the NOL1/NOP2/sun family e.g. FT Y026_METJA MJ0026 (274 aa), fasta scores; opt: 422 z-score: FT 688.4 E(): 4.8e-31, 33.9% identity in 280 aa overlap. No Hp FT match. Contains Pfam match to entry PF01189 Nol1_Nop2_Sun, FT NOL1/NOP2/sun family. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="InterPro:IPR001678" FT /db_xref="InterPro:IPR023267" FT /db_xref="UniProtKB/TrEMBL:Q0PAN2" FT /inference="protein motif:Pfam:PF01189" FT /protein_id="CAL34781.1" FT /translation="MQNILSSFAQEKNVCVFANTLKTSIEELEKEFLKQNLKFKKINVY FT CYLFDAKDKAILSSMKAFNEAHFYIQNYSSYLCALNLEVKAGQSVLDMCAAPGGKSINL FT ANFMQNTGYLACNEMSRDRFFILQKNLKNYGVNAKVFMKDGKNIGNLCPLKFDKILLDA FT PCSTFAKIGFDLEKSYKEIKNIAKTQKKLLHSALKALKIGGELVYSTCTFTKEENEEVI FT ENALKSEFKLELLDIDLENVEAKAGQSEEFAEISKCRRILPSLDYDGFFIAKLRKLC" FT misc_feature 597837..598655 FT /note="HMMPfam hit to PF01189, NOL1/NOP2/sun family, score FT 2.4e-30" FT /inference="protein motif:Pfam:PF01189" FT CDS complement(598843..599340) FT /transl_table=11 FT /gene="mrsA" FT /locus_tag="Cj0637c" FT /product="putative peptide methionine sulfoxide reductase" FT /EC_number="1.8.4.6" FT /note="Original (2000) note: Cj0637c, mrsA, probable FT peptide methionine sulfoxide reductase, len: 165 aa; highly FT similar to many e.g. PMSR_STRPN peptide methionine FT sulfoxide reductase (312 aa), fasta scores; opt: 413 FT z-score: 690.6 E(): 3.6e-31, 39.5% identity in 152 aa FT overlap. 43.3% identity to HP0224. May be necessary for the FT production and maintenance of functional adhesins on the FT cell surface. See Proc. Natl. Acad. Sci. U.S.A. FT 93:7985-7990(1996)" FT /note="Updated (2006) note: Pfam domain PF01625 Peptide FT methionine sulfoxide reductase identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli, however, marginal identity score FT was obtained. Putative kept within product function. FT Functional classification - Pathogenicity" FT /note="PMID:1386361, PMID:10964927" FT /db_xref="GOA:Q9PHN0" FT /db_xref="InterPro:IPR002569" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHN0" FT /inference="protein motif:Pfam:PF01625" FT /protein_id="CAL34782.1" FT /translation="MKNIVLGGGCFWCVEAVFERLKGVINTEVGYSGGKPNPSYESVCN FT GDGNIEVVKINYDEKQISLLEILTLFFKIHDPTSIDKQGGDIGIQYRSIIFYENEEDKI FT LAQNFIEEQQKIFSKKIVTKISRLQTYYKAENYHQHYFINNPDQGYCQAVIAPKLQKIQ FT SD" FT misc_feature complement(598873..599337) FT /note="HMMPfam hit to PF01625, Peptide methionine sulfoxide FT reductase, score 2.4e-66" FT /inference="protein motif:Pfam:PF01625" FT CDS complement(599381..599899) FT /transl_table=11 FT /gene="ppa" FT /locus_tag="Cj0638c" FT /product="inorganic pyrophosphatase" FT /EC_number="3.6.1.1" FT /note="Original (2000) note: Cj0638c, ppa, probable FT inorganic pyrophosphatase, len: 172 aa; highly similar to FT many e.g. IPYR_ECOLI inorganic pyrophosphatase (EC 3.6.1.1) FT (175 aa), fasta scores; opt: 564 z-score: 990.9 E(): 0, FT 54.0% identity in 161 aa overlap. 59.3% identity to HP0620. FT Contains PS00387 Inorganic pyrophosphatase signature and FT Pfam match to entry PF00719 Pyrophosphatase,Inorganic FT pyrophosphatase" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Literature search identified FT paper linking protein to glycoprotein (PMID:12186869). FT Functional classification - Central intermediary metabolism FT - General" FT /note="PMID:12186869, PMID:2848015, PMID:9201917" FT /db_xref="GOA:Q9PHM9" FT /db_xref="InterPro:IPR008162" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHM9" FT /inference="protein motif:Pfam:PF00719" FT /inference="protein motif:Prosite:PS00387" FT /protein_id="CAL34783.1" FT /translation="MNLSKIKIGDIPNKINAVIEIPYGSNIKYEIDKDSGAIMVDRVMA FT SAIFYPANYGFIANTLADDGDPVDILVLNEYPIQAGAVIPCRLIGVLIMEDESGMDEKL FT LAVPNSKIDARYDNIKTYTDLPQATLNKIKNFFETYKILEPNKWVKVQDFKDEKAAIEI FT LEKAIKNYK" FT misc_feature complement(599384..599854) FT /note="HMMPfam hit to PF00719, Inorganic FT pyrophosphatase,score 2.4e-53" FT /inference="protein motif:Pfam:PF00719" FT misc_feature complement(599690..599710) FT /note="PS00387 Inorganic pyrophosphatase signature" FT /inference="protein motif:Prosite:PS00387" FT CDS complement(599909..600487) FT /transl_table=11 FT /gene="adk" FT /locus_tag="Cj0639c" FT /product="adenylate kinase" FT /EC_number="2.7.4.3" FT /note="Original (2000) note: Cj0639c, adk, possible FT adenylate kinase, len: 192 aa; similar to many e.g. FT KAD_PRUAR adenylate kinase (EC 2.7.4.3) (231 aa), fasta FT scores; opt: 324 z-score: 432.2 E(): 8.9e-17, 33.9% FT identity in 183 aa overlap. 62.4% identity to HP0618. FT Contains PS00017 ATP/GTP-binding site motif A FT (P-loop),PS00113 Adenylate kinase signature and Pfam match FT to entry PF00406 adenylatekinase, Adenylate kinase" FT /note="Updated (2006) note: Characterised within FT Escherichia coli and Bacillus subtilis with marginal FT identity scores. Appropriate motifs present. Putative not FT added to product function. Functional classification FT -Central intermediary metabolism - General" FT /note="PMID:2997739, PMID:15100224" FT /db_xref="GOA:Q9PHM8" FT /db_xref="InterPro:IPR000850" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHM8" FT /inference="protein motif:Pfam:PF00406" FT /inference="protein motif:Prosite:PS00113" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34784.1" FT /translation="MKELFLIIGAPGSGKTTDASLIAQADATNITHYSTGDLLRAEVAS FT GSELGKTIDSFISKGNLVPLDVVINTIVYALKAAPTKTIIIDGYPRSVEQMMEFDKVLS FT EQNEICLKGVIEVRVSEEVAKERVLGRNRGADDNEEVFYNRMKVYTEPLNEILDFYQKK FT KLHFIIDGERTIEPIVADMKELIKKIQSI" FT misc_feature complement(599993..600469) FT /note="HMMPfam hit to PF00406, Adenylate kinase, score FT 2.4e-40" FT /inference="protein motif:Pfam:PF00406" FT misc_feature complement(600203..600238) FT /note="PS00113 Adenylate kinase signature" FT /inference="protein motif:Prosite:PS00113" FT misc_feature complement(600440..600463) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(600484..602235) FT /transl_table=11 FT /gene="aspS" FT /locus_tag="Cj0640c" FT /product="aspartyl-tRNA synthetase" FT /EC_number="6.1.1.12" FT /note="Original (2000) note: Cj0640c, aspS, probable FT aspartyl-tRNA synthetase, len: 583 aa; highly simlar to FT many e.g. SYD_ECOLI aspartyl-tRNA synthetase (EC 6.1.1.12) FT (590 aa), fasta scores; opt: 1951 z-score: 2706.1 E(): FT 0,51.6% identity in 589 aa overlap. 64.1% identity to FT HP0617. Contains PS00179 and PS00339 Aminoacyl-transfer RNA FT synthetases class-II signatures 1 and 2, and Pfam match to FT entry PF00152 tRNA-synt_2, tRNA synthetases class II" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Aminoacyl tRNA synthetases and their modification" FT /note="PMID:2129559" FT /db_xref="GOA:Q9PHM7" FT /db_xref="InterPro:IPR002312" FT /db_xref="InterPro:IPR004115" FT /db_xref="InterPro:IPR004364" FT /db_xref="InterPro:IPR004365" FT /db_xref="InterPro:IPR004524" FT /db_xref="InterPro:IPR006195" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR016027" FT /db_xref="InterPro:IPR018150" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHM7" FT /inference="protein motif:Pfam:PF00152" FT /inference="protein motif:Prosite:PS00339" FT /inference="protein motif:Prosite:PS00179" FT /protein_id="CAL34785.1" FT /translation="MRSHYNTDLGISHVGQSVKLCGWVNSYRDHGGVIFIDLRDRSGII FT QLVCDPNDSKEAHEIASNARNEFVLITEGTIRPRGEGLVNPKLKTGEIEVVVSKLTIEN FT ESAVPPFAIADESVNEELRLKYRFLDLRNPKLYENFALRSKACIAARNSLANMGFLEVE FT TPILTKATPEGARDYLVPSRVHQGEFYALPQSPQLFKQLLMCSGFDRYFQIAKCFRDED FT LRADRQPEFTQIDVEMSFCEQKDVIKVAETFLKDIFKACGKEIQTPFRQMQYKDAMENY FT GSDKPDLRFDLKFIDVIDIFTKSNNEIFANIAKDTKKNRIKAIRVPKGDTIFSKRQMQR FT FEEFVRKFGAQGLAFIQVKKDGLKGPLCKFFSEEDLNELSKRCELEVGDVVFFGAGAKK FT TVLDYMGRFRIFLANELKLIDPNALEFLWVVDFPMFEQNDDGSYSAMHHPFTMPKNIDE FT TDLEEISSIAYDVVLNGVELGGGSIRIHKNDIQQKVFKLLNIDEEQQKEKFGFLLDALS FT FGAPPHGGIAIGLDRLIMLVTGANSIREVIAFPKTQRAQCLMTDAPSPASNEAMRELGI FT KLRENIK" FT misc_feature complement(600574..601881) FT /note="HMMPfam hit to PF00152, tRNA synthetases class II FT (D, K and N), score 1.8e-24" FT /inference="protein motif:Pfam:PF00152" FT misc_feature complement(600628..600657) FT /note="PS00339 Aminoacyl-transfer RNA synthetases class-II FT signature 2" FT /inference="protein motif:Prosite:PS00339" FT misc_feature complement(601021..601311) FT /note="HMMPfam hit to PF02938, GAD domain, score 1.9e-31" FT /inference="protein motif:Pfam:PF02938" FT misc_feature complement(601531..601584) FT /note="PS00179 Aminoacyl-transfer RNA synthetases class-II FT signature 1" FT /inference="protein motif:Prosite:PS00179" FT misc_feature complement(601927..602184) FT /note="HMMPfam hit to PF01336, OB-fold nucleic acid binding FT domain, score 3.7e-26" FT /inference="protein motif:Pfam:PF01336" FT CDS 602326..603186 FT /transl_table=11 FT /locus_tag="Cj0641" FT /product="putative inorganic polyphosphate/ATP-NAD kinase" FT /EC_number="2.7.1.23" FT /note="Original (2000) note: Cj0641, unknown, len: 286 aa; FT similar to hypothetical proteins e.g. YFJB_ECOLI (292 FT aa),fasta scores; opt: 451 z-score: 649.8 E(): 6.7e-29, FT 31.9% identity in 288 aa overlap. 37.2% identity to HP1394" FT /note="Updated (2006) note: Pfam domain PF01513 ATP-NAD FT kinase identified within CDS. Partially characterised FT within Escherichia coli with marginal identity score. Motif FT identification gives further support to new product FT function. Functional classification - Central intermediary FT metabolism - General" FT /db_xref="GOA:Q9PHM6" FT /db_xref="InterPro:IPR002504" FT /db_xref="InterPro:IPR016064" FT /db_xref="InterPro:IPR017437" FT /db_xref="InterPro:IPR017438" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHM6" FT /inference="protein motif:Pfam:PF01513" FT /protein_id="CAL34786.1" FT /translation="MQNKIDYKNIKKIGLVTRPNVSLDKEILKLQSILSIYKVELVLLK FT ESSEILDLPKYGLDDLFKISDFVISLGGDGTLISLCRKACEYDKAVLGIHAGHLGFLTD FT FKVDEAENFFQAFFQGEFRIEKPYLLSIFLEDRQGKILEKLAFNDVVISKNNQASMAHI FT EVFRKEKKFNEYFGDGLIVATPAGSTAYNLSANGPIVYTLAQAFILTPVCSHSLTQRPI FT VLPKGFEIEIMAKDCMLCIDGQENYKMNDFKSIKVGLSDKNVALIHPKNRDYFQILKEK FT LHWGN" FT misc_feature 602359..603135 FT /note="HMMPfam hit to PF01513, ATP-NAD kinase, score FT 4.4e-54" FT /inference="protein motif:Pfam:PF01513" FT CDS 603186..604709 FT /transl_table=11 FT /gene="recN" FT /locus_tag="Cj0642" FT /product="putative DNA repair protein" FT /note="Original (2000) note: Cj0642, recN, possible DNA FT repair protein, len: 507 aa; some similarity to e.g. FT RECN_BACSU DNA repair protein RECN (576 aa), fasta scores; FT opt: 272 z-score: 353.1 E(): 2.3e-12, 24.5% identity in 559 FT aa overlap. 36.1% identity to HP1393. Contains PS00017 FT ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Characterised within Bacillus FT subtilis, however, identity score was unnacceptable. FT Putative kept within product function. Functional FT classification - DNA replication,restriction/modification, FT recombination and repair" FT /note="PMID:9044256" FT /db_xref="GOA:Q9PHM5" FT /db_xref="InterPro:IPR004604" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHM5" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34787.1" FT /translation="MINRIFMKENLGFKKAELEISKGLTVFTGLSGAGKSVLFKGILSA FT FSLSESEAKIVEIEVDDKLDLESFGIESEEENVFKLLKEKNTKYFINNQSIAKKSLQNL FT SKTFIKYLSAKENNEFGNEKFLNLLDALEMQENTNFVSFLEDFKKDFNAYSQISNELNA FT ILEEEKKVEELKELARAQIEKISSINPKIGEYEELLILKKKLSKKDKLEEAWSKAERIF FT ELEKVVIEALNLSEVDASFFSECLNELRVICENQKMEDLDFDVEALLDRIENLSYLIKR FT YESIENALEVLKQKKYELEHYENLSFEKKELEKKFQELKQKLEEKAQILTQTRKKNLKK FT LEKCLNNYLKDLYMKDASLTLKENEKISILGKDEIMLDINLAHLKNLSSGELNRLRLAF FT IATECNILNAGKGILFLDEIDANLSGKEAMSIAKVLEELSKFYQIFAISHLPQLSSKAH FT NHFLVEKNGEESKVKKLDQEERIKELARMVSGELVSDEAIEFAKTLFKN" FT misc_feature 603270..603293 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 604815..606059 FT /transl_table=11 FT /gene="cbrR" FT /locus_tag="Cj0643" FT /product="two-component response regulator" FT /note="Original (2000) note: Cj0643, probable two-component FT response regulator, len: 414 aa; similar to e.g. TR:P97018 FT (EMBL:U67070) Aeromonas jandaei response regulator protein FT RRPX (415 aa), fasta scores; opt: 597 z-score: 530.0 E(): FT 3.2e-22, 25.8% identity in 414 aa overlap, andTR:Q46020 FT (EMBL:L42554) Caulobacter crescentus response regulator FT PLED (454 aa), fasta scores; opt: 286 z-score: 309.9 E(): FT 5.8e-10, 22.0% identity in 451 aa overlap. No Hp ortholog. FT Contains 2x Pfam match to entry PF00072 response_reg, FT Response regulator receiver domain and Pfam match to entry FT PF00990 DUF9, Domain of unknown function" FT /note="Updated (2006) note: Pfam domain PF00990 has now FT been annotated as GGDEF domain that often happens to be FT linked to a regulatory domain. Further support given to FT product function. Literature search identified paper FT characterising Cj0643 and confirming it as a two-component FT response regulator and is designated as CbrR (Campylobacter FT bile resistance Regulator) protein. Functional FT classification - Signal transduction" FT /note="PMID:15901688" FT /db_xref="GOA:Q0PAM5" FT /db_xref="InterPro:IPR000160" FT /db_xref="InterPro:IPR001054" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR011006" FT /db_xref="UniProtKB/TrEMBL:Q0PAM5" FT /inference="protein motif:Pfam:PF00990" FT /inference="protein motif:Pfam:PF00072" FT /protein_id="CAL34788.1" FT /translation="MNKKILIIDDNKMLGKLLAKKIQMTLDYEVDIAFGFAEAKELMNN FT DYFLAFVDLCLPDAPNGEVVDYVIEKKIPAIVLTASGDKATKEKFMDKDILDYIFKESE FT TCIDEIISSIVKLNQYAKTKVIVAMSKLPERNEIKKILTQRQFNVLAAAHGEEAMSYLN FT DNNDVKLIIADVNMPVISGFELLTQVRERFSDDELGVILLGDHNDSFEANSFKNGVNEY FT LFKPLSKESFNCRLDRCLSYMDDKKFLSTYNVLDPVSGVKNYNALIDGIDDYFNEIATK FT DEEFAFAFLDIDNLQMINDEYGREVGDEVIKICANEIVNETKGRDLVGRYSAEKICILL FT KNISQERAIKIFSRIRVNIKKAGVLVNLDEVFFTASIGVVFGKSGDKIDSLADKASKIL FT SQAKDNGKDRVEVCS" FT misc_feature 604821..605171 FT /note="HMMPfam hit to PF00072, Response regulator receiver FT domain, score 3.7e-05" FT /inference="protein motif:Pfam:PF00072" FT misc_feature 605181..605546 FT /note="HMMPfam hit to PF00072, Response regulator receiver FT domain, score 4.3e-07" FT /inference="protein motif:Pfam:PF00072" FT misc_feature 605559..606041 FT /note="HMMPfam hit to PF00990, GGDEF domain, score 1.3e-23" FT /inference="protein motif:Pfam:PF00990" FT CDS 606050..606865 FT /transl_table=11 FT /locus_tag="Cj0644" FT /product="putative TatD-related deoxyribonuclease protein" FT /note="Original (2000) note: Cj0644, unknown, len: 271 aa; FT similar to hypothetical proteins e.g. YABD_BACSU (255 FT aa),fasta scores; opt: 614 z-score: 1024.7 E(): 0, 38.6% FT identity in 259 aa overlap. 49.2% identity to HP1573. FT Contains PS01137 Uncharacterized protein family UPF0006 FT signature 1 and Pfam match to entry PF01026 FT UPF0006,Uncharacterized protein family" FT /note="Updated (2006) note: Pfam domain PF01026 TatD FT related DNase and Prosite domain PS01137 FT TATD_1,TatD-related deoxyribonuclease were identified FT within CDS. Product modified to more specific family member FT due to motif match. No specific characterisation carried FT out yet. Putative kept within product function. Functional FT classification - Misc" FT /db_xref="GOA:Q0PAM4" FT /db_xref="InterPro:IPR001130" FT /db_xref="InterPro:IPR012278" FT /db_xref="InterPro:IPR015991" FT /db_xref="InterPro:IPR018228" FT /db_xref="UniProtKB/TrEMBL:Q0PAM4" FT /inference="protein motif:Pfam:PF01026" FT /inference="protein motif:Prosite:PS01137" FT /protein_id="CAL34789.1" FT /translation="MFLNLDFQDGLRIVDTHCHLDSEAFKDDLDETLNRAFKNGIEKII FT IPGADIKDLPYAATIAHKYKNIFFAAGVHPYEIDNYDEKILRQYLCDEKCVAVGECGLD FT YFRFKSDLAEEIQKEKENQKKIFIAQLELAIEFKKPVIIHSREANHDTYEILHGYSKDL FT VGGVLHCFNASEHLLTLFEEGFYFGIGGVLTFKNAKKLVEILPKIPKDKLLLETDAPYL FT TPEPYRGKRNEPLLTQFVVNKMCEVLNLSRKELLEICFNNSEKLFFKGY" FT misc_feature 606080..606853 FT /note="HMMPfam hit to PF01026, TatD related DNase, score FT 1.2e-106" FT /inference="protein motif:Pfam:PF01026" FT misc_feature 606086..606112 FT /note="PS01137 Uncharacterized protein family UPF0006 FT signature 1" FT /inference="protein motif:Prosite:PS01137" FT misc_feature 606581..606628 FT /note="PS00225 Crystallins beta and gamma 'Greek key' motif FT signature" FT /inference="protein motif:Prosite:PS00225" FT CDS 606865..607983 FT /transl_table=11 FT /locus_tag="Cj0645" FT /product="putative secreted transglycosylase" FT /EC_number="3.2.1.-" FT /note="Original (2000) note: Cj0645, possible secreted FT transglycosylase, len: 372 aa; similar to members of the FT SLT family e.g. MLTD_ECOLI membrane-bound lytic murein FT transglycosylase D precursor (EC 3.2.1.-) (452 aa), fasta FT scores; opt: 425 z-score: 431.3 E(): 1e-16, 28.4% identity FT in 348 aa overlap. 37.5% identity to HP1572. Contains FT N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domains PF01464 FT Transglycosylase SLT domain PF01476 LysM domain were FT identified within CDS. Further support given to product FT function. Characterised within Escherichia coli with FT marginal identity score and only partial alignment. FT Putative kept within product function. Functional FT classification - Murein sacculus and peptidoglycan" FT /note="PMID:10843862" FT /db_xref="GOA:Q0PAM3" FT /db_xref="InterPro:IPR002482" FT /db_xref="InterPro:IPR008258" FT /db_xref="InterPro:IPR018392" FT /db_xref="InterPro:IPR023346" FT /db_xref="UniProtKB/TrEMBL:Q0PAM3" FT /inference="protein motif:Pfam:PF01476" FT /inference="protein motif:Pfam:PF01464" FT /protein_id="CAL34790.1" FT /translation="MKKILLCFLICFNFLFAQINTPEFYERQMNVLRNLDINPSFISDL FT IFVQTQQDIKSKHAQTLIDSMQNFSKVTPMIRKILAQQEVPDEILYLAMVESGLKTHSV FT SNAKAVGVWQFMQPTARNLGLRIDAYVDERRDPVKSTYAATNYLKELKEEFGKWYLALL FT AYNCGNGKLRQAIKQAGSDDLSVLLNPDKKYLSLETRNFIRKILTLAFLANDRDFLLDK FT DASLMNYALSNEFAKVDVPSSASLKEIAKNLNMDLATFKKYNPQFKHNFTPPGKGYYMY FT IPLNKVAFFDKNFKAEKLAKVDTTIPMTRTYTVKSGDSLYKIAKNYNISVDEIREFNKI FT AKNHLSINQKLIIPIKENKNANKNNYTKVVSR" FT misc_feature 607081..607428 FT /note="HMMPfam hit to PF01464, Transglycosylase SLT domain, FT score 1.5e-28" FT /inference="protein motif:Pfam:PF01464" FT misc_feature 607798..607926 FT /note="HMMPfam hit to PF01476, LysM domain, score 1.7e-17" FT /inference="protein motif:Pfam:PF01476" FT CDS 607943..608770 FT /transl_table=11 FT /locus_tag="Cj0646" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0646, probable FT lipoprotein,len: 275 aa; similar to e.g. RLPA_ECOLI rare FT lipoprotein A precursor (362 aa), fasta scores; opt: 251 FT z-score: 431.7 E(): 9.4e-17, 33.6% identity in 131 aa FT overlap. 50.2% identity to HP1571. Contains N-terminal FT signal sequence and PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site" FT /note="Updated (2006) note: Pfam domain PF03330 Rare FT lipoprotein A (RlpA)-like double-psi beta-barrel was FT identified within CDS. Product modified to more specific FT family member due to motif match. No specific FT characterisation with acceptable identity score carried out FT yet. Putative kept within product function. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="GOA:Q9PHM1" FT /db_xref="InterPro:IPR007730" FT /db_xref="InterPro:IPR009009" FT /db_xref="InterPro:IPR012997" FT /db_xref="InterPro:IPR014733" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHM1" FT /inference="protein motif:Pfam:PF03330" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34791.1" FT /translation="MQIKTITLKLSAVSLGALFFSGCLGTSFFSSLDNAQVYYPSNDFK FT SSPSSSGTKGTMKPYTINGKTYYPTVVAVGETADGIASWYGPGFHGKKTSNGETYNQNA FT LTAAHKTLPMNTILKVTNLNNNRQVTVRVNDRGPFVNNRIIDLSKGAASQIDMIASGTA FT PVRLEVIGFGSSNSGNNIVHSNVNYGNSGEIANNGQIYEGGNFMVQIGAFKNPAGAQTI FT AARYKTYRTYSSTIRTSSVDGLNRVFLTGFRSEDEARDFAASGAFAGAFVVRE" FT sig_peptide 607943..608047 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000303_607943_608770 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.267 between residues 35 and 36" FT misc_feature 607961..608029 FT /note="1 probable transmembrane helix predicted for Cj0646 FT by TMHMM2.0 at aa 7-29" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 607979..608011 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 608171..608443 FT /note="HMMPfam hit to PF03330, Rare lipoprotein A FT (RlpA)-like double-psi be, score 1.9e-44" FT /inference="protein motif:Pfam:PF03330" FT CDS 608776..609264 FT /transl_table=11 FT /locus_tag="Cj0647" FT /product="putative HAD-superfamily hydrolase" FT /note="Original (2000) note: Cj0647, unknown, len: 162 aa; FT similar to hypothetical proteins e.g. YRBI_ECOLI (188 aa), FT fasta scores; opt: 322 z-score: 399.6 E(): 5.8e-15,40.0% FT identity in 155 aa overlap. 40.9% identity to HP1570" FT /note="Updated (2006) note: Pfam domain PF08282 haloacid FT dehalogenase-like hydrolase was identified by running own FT search within CDS. Product modified to more specific family FT member due to motif match. No specific characterisation FT carried out yet. Putative kept within product function. FT Some similarity to recently characterised Escherichia coli FT 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase (EC FT 3.1.3.45), KdsC, however, alignment was only partial. FT Functional classification - Misc" FT /note="PMID:12639950" FT /db_xref="GOA:Q0PAM1" FT /db_xref="InterPro:IPR005834" FT /db_xref="InterPro:IPR006549" FT /db_xref="InterPro:IPR010023" FT /db_xref="InterPro:IPR023214" FT /db_xref="UniProtKB/TrEMBL:Q0PAM1" FT /inference="protein motif:Pfam:PF08282" FT /protein_id="CAL34792.1" FT /translation="MTELIFLDVDGCLTDGKIIYTSNGEFIKEFNVKDGAAIEAWLKLG FT KKIAIITGRNCPCVEKRAKDLKIKILYQGIKDKLACAKEILQKLNLDFSQCAAIGDYFN FT DKALLESVGLSFKPKDGHKDLNVDIVLSKKGGKAAVAQMIEILVEKNHLEEEWNKLWL" FT CDS 609255..609770 FT /transl_table=11 FT /locus_tag="Cj0648" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0648, unknwn, len: 171 aa; FT no Hp match" FT /note="Updated (2006) note: One probable transmembrane FT helix predicted by TMHMM2.0. Also, one N-terminal signal FT peptide predicted by SignalP 2.0 HMM. Product function FT modified to more specific family member. Putative kept FT within product function. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PAM0" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34793.1" FT /translation="MAIKIFGILIALFTITFTILSLQDPYSLNLQTNALNFKNIEAKNL FT KAYESNTSIIKAYYKANSWVRYADRDEFNDFITLNLDFNLSANRLEFFNKDMSKVLFEG FT NVTYIGSNNVKIISQEVEYQPKDKILHTNTNFKALINGSIINGNTLNYDVKNKILNIQG FT VNAWLQDK" FT sig_peptide 609255..609323 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000305_609255_609770 by SignalP 2.0 FT HMM (Signal peptide probability 0.871) with cleavage site FT probability 0.349 between residues 23 and 24" FT misc_feature 609267..609320 FT /note="1 probable transmembrane helix predicted for Cj0648 FT by TMHMM2.0 at aa 5-22" FT /inference="protein motif:TMHMM:2.0" FT CDS 609752..610213 FT /transl_table=11 FT /locus_tag="Cj0649" FT /product="putative OstA family protein" FT /note="Original (2000) note: Cj0649, unknown, len: 153 aa; FT 31.6% identity to HP1568" FT /note="Updated (2006) note: Pfam domain PF03968 OstA-like FT protein was identified within CDS. Product modified to more FT specific family member due to Pfam match. No specific FT characterisation has been carried out. Putative kept within FT product function. Functional classification -Conserved FT hypothetical proteins" FT /note="PMID:7811102" FT /db_xref="InterPro:IPR005653" FT /db_xref="UniProtKB/TrEMBL:Q0PAL9" FT /inference="protein motif:Pfam:PF03968" FT /protein_id="CAL34794.1" FT /translation="MVARQIILLLVCVSVTWATQIEVKALNFYSDENKGESILSGNVEV FT IRGDDILNSEKLIIYTDKNRKPIRYEAMQNARFKIVLKGKTYKGSGDKFIYNVIKDTYE FT INGHAYINELGSNQKLFGDKIIVDRKANIYRVESKDQKPARFVFDLKDK" FT sig_peptide 609752..609820 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000306_609752_610213 by SignalP 2.0 FT HMM (Signal peptide probability 0.728) with cleavage site FT probability 0.287 between residues 23 and 24" FT misc_feature 609764..610210 FT /note="HMMPfam hit to PF03968, OstA-like protein, score FT 5.1e-61" FT /inference="protein motif:Pfam:PF03968" FT CDS 610210..610806 FT /transl_table=11 FT /locus_tag="Cj0650" FT /product="putative ATP/GTP binding protein" FT /note="Original (2000) note: Cj0650, putative ATP/GTP FT binding protein, len: 198 aa; similar to members of the FT UPF0009 family of hypothetical ATP/GTP binding proteins FT e.g. YIHA_ECOLI hypothetical GTP-binding protein (210 FT aa),fasta scores; opt: 322 z-score: 561.3 E(): 5.7e-24, FT 38.7% identity in 173 aa overlap. 49.5% identity to HP1567. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF01926 GTPase of FT unknown function was identified within CDS. Further support FT given to product function. No specific characterisation has FT been carried out. Putative kept within product function. FT Functional classification -Conserved hypothetical proteins" FT /db_xref="GOA:Q9PHL7" FT /db_xref="InterPro:IPR005225" FT /db_xref="InterPro:IPR006073" FT /db_xref="InterPro:IPR019987" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHL7" FT /inference="protein motif:Pfam:PF01926" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34795.1" FT /translation="MIISAKFITSLVKFDENLSSNFSEVAFLGRSNVGKSSLINSLCKQ FT KNLAKSSATPGKTQLINFFEVICRRNEEKFNINFIDLPGFGYAKVSKNLKEIWNQNLDE FT FLKLRTSIKLFIHLIDSRHTHLEIDVNLNDYLKRFLRPDQKILKVFTKCDKLNQSEKAK FT LKNEFKDSILVSNLNKFGLDSLEDIIINQTLGLDK" FT misc_feature 610276..610671 FT /note="HMMPfam hit to PF01926, GTPase of unknown FT function,score 2.6e-26" FT /inference="protein motif:Pfam:PF01926" FT misc_feature 610294..610317 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 610803..611297 FT /transl_table=11 FT /locus_tag="Cj0651" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0651, possible integral FT membrane protein, len: 164 aa; no Hp match" FT /note="Updated (2006) note: Five probable transmembrane FT helices predicted by TMHMM2.0 identified within CDS. FT Functional classification - Membranes, lipoproteins and FT porins" FT /db_xref="UniProtKB/TrEMBL:Q0PAL7" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34796.1" FT /translation="MRRNLSAYKAKFNGAYVFLGFFFLIYQILGSTFVYTPLLYGIFFC FT YMFCLLEERERTFSKLDFRWYFSLFFLFFTDITYNFFIFSSWLAFFIFYYLCADWIKTN FT LKIGKFIPVVFVLCAYGIILFLDMILSYIGDEKIKILGWAYIVSVFIECCLAYVFFKGK FT I" FT misc_feature order(610836..610889,610899..610958,610995..611090, FT 611133..611201,611220..611279) FT /note="5 probable transmembrane helices predicted for FT Cj0651 by TMHMM2.0 at aa 12-29, 33-52, 65-96, 111-133 and FT 140-159" FT /inference="protein motif:TMHMM:2.0" FT CDS 611298..613103 FT /transl_table=11 FT /gene="pbpC" FT /locus_tag="Cj0652" FT /product="penicillin-binding protein" FT /note="Original (2000) note: Cj0652, pbpC, probable FT penicillin-binding protein, len: 601 aa; similar to many FT e.g. PBP2_ECOLI penicillin-binding protein 2 (PBP-2) (633 FT aa), fasta scores; opt: 954 z-score: 1474.4 E(): 0, 32.7% FT identity in 609 aa overlap. 43.5% identity to HP1565. FT Contains Pfam match to entry PF00905 FT Transpeptidase,Penicillin binding protein transpeptidase FT domain" FT /note="Updated (2006) note: Pfam domain PF03717 FT Penicillin-binding Protein dimerisation domain was FT identified within CDS. Further support given to product FT function. Characterised within Escherichia coli with FT marginal identity score. Putative not added to product FT function. Functional classification - Murein sacculus and FT peptidoglycan" FT /note="PMID:9045804" FT /db_xref="GOA:Q0PAL6" FT /db_xref="InterPro:IPR001460" FT /db_xref="InterPro:IPR005311" FT /db_xref="InterPro:IPR012338" FT /db_xref="InterPro:IPR017790" FT /db_xref="UniProtKB/TrEMBL:Q0PAL6" FT /inference="protein motif:Pfam:PF03717" FT /inference="protein motif:Pfam:PF00905" FT /protein_id="CAL34797.1" FT /translation="MRMRLVVGFILLFFIFLLSRVYYLSIKSNVYYEELAKQNAIKTEF FT LPPVRGQITDRNGTLLAINDLGFSISIKPYLSIKKSNKGILDKELSELTNLFPDLNASK FT LAEIYKRNDSYYNQDFIKVVDFIPYDEIISHYSELNLNKTIKIDPVVKRKYPFGKLASH FT IIGYVGKANLQDVQENEIAKLSNYTGKSGIERYYNDILQGEKGTRVYKVNALNQEVEQL FT SYTPAMSNDIELTIDIELQSYLTSLFEGNAGAAIIMNVNDGSILAAGSFPEYDLNPFVT FT GISFKDWDELSNSLDHPFTNKLINGYYPPGSVVKMGVGLSFLNSKNISPSTHYVCNGSI FT ELGGRFFRCWNRSGHGPVDLKHAIKYSCDVYFYNGSLQVGIDQISETLSRIGFGVKTGV FT DLPSEFVGTLPSKEWKMQRYRQSWFQGDTLNTAIGQGNFLATPMQIARYTAQIAKSGEV FT IPHFLKSIENNNTTIENQMDENKKEIFTLFEKSQLPYIRDAMYAVANEQGGTSYRYLHN FT LDVKVAAKTGTAQVVGFSQTDKNRVDEKQFEYYTRSHAWLTSYAPYSKPKYVVTVLLEH FT GGRNITSGATVAKIYQKMIELGYFK" FT sig_peptide 611298..611366 FT /note="Signal peptide predicted for pbpC by SignalP 2.0 HMM FT (Signal peptide probability 0.952) with cleavage site FT probability 0.371 between residues 23 and 24" FT misc_feature 611310..611369 FT /note="1 probable transmembrane helix predicted for Cj0652 FT by TMHMM2.0 at aa 5-24" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 611430..611966 FT /note="HMMPfam hit to PF03717, Penicillin-binding Protein FT dimerisatio, score 1.9e-53" FT /inference="protein motif:Pfam:PF03717" FT misc_feature 612054..613085 FT /note="HMMPfam hit to PF00905, Penicillin binding protein FT transpeptid, score 1.5e-64" FT /inference="protein motif:Pfam:PF00905" FT CDS complement(613224..615014) FT /transl_table=11 FT /locus_tag="Cj0653c" FT /product="putative aminopeptidase" FT /note="Original (2000) note: Cj0653c, probable FT aminopeptidase, len: 596 aa; similar to e.g. TR:O54975 FT (EMBL:AF038591) rattus norvegicus cytoplasmic FT aminopeptidase P (623 aa), fasta scores; opt: 763 z-score: FT 1470.5 E(): 0, 36.8% identity in 612 aa overlap, and FT TR:O51094 (EMBL:AE001119) Borrelia burgdorferi putative FT peptidase BB0067 (592 aa), fasta scores; opt: 1234 z-score: FT 1316.7 E(): 0, 41.1% identity in 609 aa overlap. 25.8% FT identity to HP1037. Contains Pfam match to entry PF00557 FT pep_M24, metallopeptidase family M24" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores carried out yet. Putative FT kept within product function. Functional classification FT -Degradation of macromolecules - Proteins, peptides and FT glycopeptides" FT /db_xref="GOA:Q0PAL5" FT /db_xref="InterPro:IPR000587" FT /db_xref="InterPro:IPR000994" FT /db_xref="UniProtKB/TrEMBL:Q0PAL5" FT /inference="protein motif:Pfam:PF00557" FT /protein_id="CAL34798.1" FT /translation="MSIYKQRVLELRRLMKENNIDAYLILSADPHLSEYLPEYYKNRVF FT ISGFKGSVGTVLITQEEGFLWVDGRYWLQAQKELEGSGILLQKQDAKNTFTKWLEKNLS FT EDQILGIDFALLPLSLQKDLKINCKANLKHIDLISPLWKDRPTLPQEKIYEHELEYCSY FT SRKEKLALVRQKMKNLNATSHLISSLDDIAWLTNLRGNDVNYNPVFLSHLLILEDKALL FT FVDQKKVNSELEKKLNLDGFWLKNYDEIIMELEELANTNLLIEPSKMTALLINSLDKSV FT KIIQEINPSTHLKAAKNTKEIAHIQDAMIEDGVALCKFFAWLEEAIKNKELISELDIDV FT KASEFRAQSKYYISDSFATIAGFNENAAYPHYKATKESFAYLKKDGLLLIDSGGQYKNG FT TTDITRVVPIGKANAEQIHDYTLVLKAHIAISSAIFPKDITMPLLDAITRAPLWKEQID FT YIHGTGHGVGYFLNVHEGPQVLSYLSPVLEKTKAKEGMLTSIEPGIYKVGKWGIRLENL FT VIHTKVENPKNKDFGEFLYFKPVTLCPFEISCIDTKMLDEKEKEWLNNYHKEVFEKLSP FT KLGDYPKALVWLEKRTKAIF" FT misc_feature complement(613434..614093) FT /note="HMMPfam hit to PF00557, metallopeptidase family M24, FT score 3.5e-09" FT /inference="protein motif:Pfam:PF00557" FT CDS complement(join(615014..615511,615511..615774, FT 615768..616022,616022..616267,616267..616485)) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0654c" FT /product="pseudogene (putative transmembrane transport FT protein)" FT /note="Original (2000) note: Cj0654c, probable FT transmembrane transport protein pseudogene, len: 1433 bp; FT similar to members of the PTR2 family of transporters. No FT apparent Hp ortholog. Contains PS01023 PTR2 family FT proton/oligopeptide symporters signature 2" FT /note="Updated (2006) note: Pfam domain PF00854 POT family FT identified within CDS. Also, twelve probable transmembrane FT helices predicted by TMHMM2.0. Further support given to FT product function. No specific characterisation with FT acceptable identity score has been carried out yet. FT Thus,putative added to product function. Coding sequence FT has been updated to reflect the complete amino acid FT sequence for the encoded protein regardless of its FT expression. This will cause differences from the amino acid FT sequence of the previous annotation. Functional FT classification -Transport/binding proteins - Other" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00854" FT /inference="protein motif:Prosite:PS01023" FT misc_feature complement(join(616288..616356,616202..616261, FT 616121..616189,616022..616078,616011..616022, FT 615924..615992,615777..615845,615694..615750, FT 615607..615666,615380..615448,615254..615322, FT 615158..615217,615062..615130)) FT /note="12 probable transmembrane helices predicted for FT Cj0654c by TMHMM2.0 at aa 44-66, 76-95, 100-122, FT 137-159,166-188, 215-237, 249-267, 277-296, 350-372, FT 392-414,427-446 and 456-478" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(join(616267..616269,616022..616267, FT 615768..616022,615511..615774,615179..615511)) FT /note="HMMPfam hit to PF00854, POT family, score 8e-11" FT /inference="protein motif:Pfam:PF00854" FT CDS complement(616572..617120) FT /transl_table=11 FT /locus_tag="Cj0659c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0659c, possible periplasmic FT protein, len: 182 aa; no Hp match. Contains probable FT N-terminal signal sequence" FT /note="Updated (2006) note: One probable transmembrane FT helices predicted by TMHMM2.0 identified within CDS. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /db_xref="InterPro:IPR014717" FT /db_xref="UniProtKB/TrEMBL:Q0PAL4" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34800.1" FT /translation="MNKIEVFLQNLNPREKFLFISFICLCALFLAFKIHDHFLEDIFQK FT TLVEHNYLALNEAKIENSHLKEIETKLTKQIKIEEEKLKYYKEKLHLFSYDKDFFNKKI FT NNLSKNLIINEIKFSQENKNFIHYNYVSLSLNGNFKDLLNFIQNLENLPIALKIDKIKL FT YNTQGLKLKLDLMFKFVNL" FT misc_feature complement(617004..617072) FT /note="1 probable transmembrane helix predicted for Cj0659c FT by TMHMM2.0 at aa 17-39" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(617022..617120) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000310_616572_617120 by SignalP 2.0 FT HMM (Signal peptide probability 0.643) with cleavage site FT probability 0.636 between residues 33 and 34" FT CDS complement(617113..618219) FT /transl_table=11 FT /locus_tag="Cj0660c" FT /product="putative transmembrane protein" FT /note="Original (2000) note: Cj0660c, possible FT transmembrane protein, len: 368 aa; no Hp match. Contains a FT possible transmembrane domain around aa 220" FT /note="Updated (2006) note: One probable transmembrane FT helices predicted by TMHMM2.0 identified within CDS. FT Functional classification - Membranes, lipoproteins and FT porins" FT /db_xref="GOA:Q0PAL3" FT /db_xref="UniProtKB/TrEMBL:Q0PAL3" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34801.1" FT /translation="MMKINSLNKINFIKSTDLLYAQRTGISKEDELFNNLTADFKLSKP FT FDYQIAFFKHNEIYHCFLAPVYKLKKSRFCFPEPLIFQALFDERFIEESDYCVLNLYDQ FT TLYLYFYQEGKFINLKKIENFNPGNMDLFFKQNRFTELLKHYESKLLLYQDLNTIKHYF FT SSQIKCLNLNDILDKNSLLKLSSYSIKNLDQNCNFIKHNKIKISISFKIILIFIFSFSL FT SMMILLFKDFIEYKQNKEIQNKNFIIQEEISKLKQDKQKLLTNIQDLNFTLSNKISSTQ FT QQFHILSTITKEINLDKNKAIILNQIISWLNSNDLKITNLEFEQTKIILSFIDENHFKR FT ALENLNSAFKILDKNEETFNIILEVIHE" FT misc_feature complement(617533..617601) FT /note="1 probable transmembrane helix predicted for Cj0660c FT by TMHMM2.0 at aa 207-229" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(618206..619081) FT /transl_table=11 FT /gene="era" FT /locus_tag="Cj0661c" FT /product="GTP-binding protein Era homolog" FT /note="Original (2000) note: Cj0661c, era, GTP-binding FT protein ERA homolog, len: 291 aa; similar to many e.g. FT ERA_BACSU GTP-binding protein ERA homolog (301 aa), fasta FT scores; opt: 540 z-score: 562.4 E(): 4.9e-24, 35.0% FT identity in 280 aa overlap. 43.1% identity to HP0517. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Pfam domains PF07650 KH domain FT and PF01926 GTPase of unknown function were identified FT within CDS. Further support given to product function. FT Functional classification - Misc" FT /note="PMID:12399511" FT /db_xref="GOA:Q9PHL1" FT /db_xref="InterPro:IPR004044" FT /db_xref="InterPro:IPR005225" FT /db_xref="InterPro:IPR005662" FT /db_xref="InterPro:IPR006073" FT /db_xref="InterPro:IPR009019" FT /db_xref="InterPro:IPR015946" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHL1" FT /inference="protein motif:Pfam:PF01926" FT /inference="protein motif:Pfam:PF07650" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34802.1" FT /translation="MKSGFVSIIGRTNAGKSTLINSLLEEKIALVSHKQNATRRKIKAI FT VMHEKNQIIFIDTPGLHESGATLNQLLVQSAIKSMGDCDVILFVASVFDSTKDYENFLS FT LNPQVPHIITLNKVDLTDNATLLKKLSEYAKFSQHFKAIIPYSSKKKSYKKGLLDEIVK FT YLDEHEYFYDPEFLSASSEKEIYRDFILESIYENLSDELPYSSEVLIHRTKDTPNLLIL FT EANIITDTNSHKGMLIGKEGATLKRIGKDARFKISKLAQKKVLLKLFVTVKKNWQKDEE FT FLKKLLNDEN" FT misc_feature complement(618218..618412) FT /note="HMMPfam hit to PF07650, KH domain, score 1.1e-22" FT /inference="protein motif:Pfam:PF07650" FT misc_feature complement(618725..619072) FT /note="HMMPfam hit to PF01926, GTPase of unknown FT function,score 1.5e-31" FT /inference="protein motif:Pfam:PF01926" FT misc_feature complement(619031..619054) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(619078..620397) FT /transl_table=11 FT /gene="hslU" FT /locus_tag="Cj0662c" FT /product="ATP-dependent Hsl protease ATP-binding subunit" FT /note="Original (2000) note: Cj0662c, hslU, probable heat FT shock protein, len: 439 aa; highly similar to many e.g. FT HSLU_ECOLI heat shock protein HSLU (443 aa), fasta scores; FT opt: 1373 z-score: 1683.1 E(): 0, 48.6% identity in 442 aa FT overlap. 62.3% identity to HP0516. Contains PS00017 FT ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Pfam domains PF00004, PF0772 FT and PF07728 all ATPase family associated with various FT cellular activities (AAA) were identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli with acceptable identity score. FT Putative removed from product function. Characterisation FT work has been updated. Thus, product function also updated. FT Functional classification - Chaperones,chaperonins, heat FT shock" FT /note="PMID:10693812, PMID:9722513" FT /db_xref="GOA:Q9PHL0" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR004491" FT /db_xref="InterPro:IPR013093" FT /db_xref="InterPro:IPR019489" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHL0" FT /inference="protein motif:Pfam:PF07728" FT /inference="protein motif:Pfam:PF00004" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34803.1" FT /translation="MNLTPKEIVKFLDDYVIGQKKAKKIIAIALRNRYRRMQLSPELQD FT DIVPKNILMIGSTGVGKTEIARRLAKMMGFPFIKIEASKYTEVGFVGRDVESMVRDLAN FT AALNLVKNEQREKNKDKIDEFIENKILEKLLPPLPKGISDEKQEEYKNSLEKMRTKLRN FT GDLDESTIEIEISQNMFDTNPNLPPEMGAMQDIVKVIGVGSKKVKKEMKIKDAKNALKN FT EAGEKILDQESIKSEALKRAENEGIIFIDEIDKIAVSSGNSNRQDPSKEGVQRDLLPIV FT EGSNVQTKIGTLKTDHILFIAAGAFHLSKPSDLIPELQGRFPLRVELDSLDDKALYEIL FT TRPKNSLLKQYSQLLKTENLELEFDDEAIKEIAKIASRANEEMQDIGARRLHTVIEKLL FT EDLSFEADEYAGKKFVVDKKMVEEKLGDIIENKDLARYIL" FT misc_feature complement(619243..620247) FT /note="HMMPfam hit to PF00004, ATPase family associated FT with various cellul, score 1.5e-12" FT /inference="protein motif:Pfam:PF00004" FT misc_feature complement(619423..620256) FT /note="HMMPfam hit to PF07724, ATPase family associated FT with various cellul, score 4.8e-44" FT /inference="protein motif:Pfam:PF07724" FT misc_feature complement(620209..620232) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(620394..620936) FT /transl_table=11 FT /gene="hslV" FT /locus_tag="Cj0663c" FT /product="ATP-dependent protease HslV" FT /EC_number="3.4.-.-" FT /EC_number="3.4.25.-" FT /note="Original (2000) note: Cj0663c, hslV, probable heat FT shock protein, len: 180 aa; highly similar to many e.g. FT HSLV_ECOLI heat shock protein HSLV (EC 3.4.99.-) (175 FT aa),fasta scores; opt: 582 z-score: 794.3 E(): 0, 53.7% FT identity in 164 aa overlap. 67.6% identity HP0515" FT /note="Updated (2006) note: Pfam domain PF00227 Proteasome FT A-type and B-type was identified within CDS. Further FT support given to product function. Characterised within FT Escherichia coli with acceptable identity score. Putative FT removed from product function. Characterisation work has FT been updated. Thus, product function also updated. FT Functional classification - Chaperones, chaperonins, heat FT shock" FT /note="PMID:10693812, PMID:9177170" FT /db_xref="GOA:Q9PHK9" FT /db_xref="InterPro:IPR001353" FT /db_xref="InterPro:IPR022281" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHK9" FT /inference="protein motif:Pfam:PF00227" FT /protein_id="CAL34804.1" FT /translation="MFHATTILAYKGKNKSVIGGDGQVSFGNTVLKGNAVKIRKLNNGK FT VLAGFAGSTADAFNLFDMFENLLQSSKGDLLKAAIDFSKEWRKDKYLRKLEAMMLVLDR FT NHIFLLSGTGDVVEPEDGQIAAIGSGGNYALSAARALAKHTDLDEEELVKSSLQIAGEI FT CIYTNTNIKTYVIEDEK" FT misc_feature complement(620409..620936) FT /note="HMMPfam hit to PF00227, Proteasome A-type and FT B-type, score 1.2e-44" FT /inference="protein motif:Pfam:PF00227" FT CDS complement(620936..621379) FT /transl_table=11 FT /gene="rplI" FT /locus_tag="Cj0664c" FT /product="50S ribosomal protein L9" FT /note="Original (2000) note: Cj0664c, rplI, 50S ribosomal FT protein L9, len: 147 aa; highly similar to many e.g. FT RL9_BACSU 50S ribosomal protein L9 (149 aa), fasta scores; FT opt: 353 z-score: 545.5 E(): 4.3e-23, 39.9% identity in 148 FT aa overlap. 55.0% identity to HP0514. Contains PS00651 FT Ribosomal protein L9 signature and Pfam match to entry FT PF01281 Ribosomal_L9, Ribosomal protein L9" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:10756104" FT /db_xref="GOA:Q9PHK8" FT /db_xref="InterPro:IPR000244" FT /db_xref="InterPro:IPR009027" FT /db_xref="InterPro:IPR020069" FT /db_xref="InterPro:IPR020070" FT /db_xref="InterPro:IPR020594" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHK8" FT /inference="protein motif:Pfam:PF01281" FT /inference="protein motif:Prosite:PS00651" FT /protein_id="CAL34805.1" FT /translation="MKVLLIKDVKALGKAGEIKEVKDGYGQNFLIAKGFAKAATNEVLR FT KYESDKKKEAENLRFEIANLEKLKEELSKITLEISKPVGANGSLFGGVTKDEIAHALKE FT QSHIEIDKKSLECDTLKSLGIHEVSVKLGHAIHAKFNINIKAE" FT misc_feature complement(620939..621196) FT /note="HMMPfam hit to PF03948, Ribosomal protein FT L9,C-terminal domai, score 3.7e-20" FT /inference="protein motif:Pfam:PF03948" FT misc_feature complement(621212..621379) FT /note="HMMPfam hit to PF01281, Ribosomal protein FT L9,N-terminal domai, score 2.9e-21" FT /inference="protein motif:Pfam:PF01281" FT misc_feature complement(621260..621343) FT /note="PS00651 Ribosomal protein L9 signature" FT /inference="protein motif:Prosite:PS00651" FT CDS complement(621392..622612) FT /transl_table=11 FT /gene="argG" FT /locus_tag="Cj0665c" FT /product="argininosuccinate synthase" FT /EC_number="6.3.4.5" FT /note="Original (2000) note: Cj0665c, argG, probable FT argininosuccinate synthase, len: 406 aa; highly similar to FT many e.g. ASSY_RAT argininosuccinate synthase (EC 6.3.4.5) FT (412 aa), fasta scores; opt: 1191 z-score: 1564.9 E(): FT 0,48.0% identity in 398 aa overlap, and ASSY_METJA (395 FT aa),fasta scores; opt: 1080 z-score: 1260.3 E(): 0, 45.8% FT identity in 391 aa overlap. No Hp match. Contains PS00564 FT and PS00565 Argininosuccinate synthase signatures 1 and FT 2,and Pfam match to entry PF00764 FT Arginosuc_synth,Arginosuccinate synthase" FT /note="Updated (2006) note: Some characterisation work FT within Escherichia coli and Rattus norvegicus (Rat). FT Appropriate motifs present. Putative not added to product FT function. Functional classification - Amino acid FT biosynthesis - Glutamate family" FT /note="PMID:2123815, PMID:3174461" FT /db_xref="GOA:Q9PHK7" FT /db_xref="InterPro:IPR001518" FT /db_xref="InterPro:IPR014729" FT /db_xref="InterPro:IPR018223" FT /db_xref="InterPro:IPR023434" FT /db_xref="InterPro:IPR024074" FT /db_xref="UniProtKB/Swiss-Prot:Q9PHK7" FT /inference="protein motif:Pfam:PF00764" FT /inference="protein motif:Prosite:PS00565" FT /inference="protein motif:Prosite:PS00564" FT /protein_id="CAL34806.1" FT /translation="MKNEVKKVVLAYSGGLDTSIILKWLQDEYNCEVVTFTADIGQGEE FT LEPARKKALSLGIKEENIFIKDLRDEFVKDYVFPMFRANAIYEGEYLLGTSIARPLIAK FT TQAQIALQTGADAVSHGATGKGNDQVRFELGYLAFSPDLKIIAPWREWDLNSREKLLAY FT AQKHGIDISKKKGKSPYSMDANLLHISYEGLVLEDPAHAPEEDMWRWSKSPKDAPNESE FT IIELDFQKGDLVAINGEKLSPAGLLTKLNELGCKHGIGRLDIVENRYVGMKSRGCYETP FT GGTILLKAHRALESITLDREAAHLKDELMPKYASLIYNGYWFSPERMMLQALIDESQIH FT ANGRVKLELYKGNVMVIGRESANDSLFNAAYCTFEEDEVYNQKDAAGFIKLNALRFIIA FT GKNGRKF" FT misc_feature complement(621407..622588) FT /note="HMMPfam hit to PF00764, Arginosuccinate FT synthase,score 1.7e-193" FT /inference="protein motif:Pfam:PF00764" FT misc_feature complement(622217..622252) FT /note="PS00565 Argininosuccinate synthase signature 2" FT /inference="protein motif:Prosite:PS00565" FT misc_feature complement(622556..622582) FT /note="PS00564 Argininosuccinate synthase signature 1" FT /inference="protein motif:Prosite:PS00564" FT CDS 622768..623013 FT /transl_table=11 FT /locus_tag="Cj0667" FT /product="putative S4 domain protein" FT /note="Original (2000) note: Cj0667, unknown, len: 81 aa; FT similar to many hypothetical proteins e.g. YABO_BACSU (86 FT aa), fasta scores; opt: 149 z-score: 259.2 E(): FT 3.8e-07,35.4% identity in 79 aa overlap. 43.6% identity to FT HP1423" FT /note="Updated (2006) note: Pfam domain PF01479 S4 domain FT was identified within CDS. The S4 domain probably mediates FT binding to RNA. Product modified to more specific family FT member due to motif match. No specific characterisation has FT been carried out. Putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PAK7" FT /db_xref="InterPro:IPR002942" FT /db_xref="UniProtKB/TrEMBL:Q0PAK7" FT /inference="protein motif:Pfam:PF01479" FT /protein_id="CAL34807.1" FT /translation="MRVDKFLNVVNITKRRAISEDMCKSGVVGINGVIVKASKEVKVDD FT IITLHFTEYTQKYKVLALPSTKSIPKNAQNEYVVKL" FT misc_feature 622768..622908 FT /note="HMMPfam hit to PF01479, S4 domain, score 4.5e-06" FT /inference="protein motif:Pfam:PF01479" FT CDS 623010..623417 FT /transl_table=11 FT /locus_tag="Cj0668" FT /product="putative ATP/GTP-binding protein" FT /note="Original (2000) note: Cj0668, probable FT ATP/GTP-binding protein, len: 135 aa; similar to FT hypothetical proteins e.g. YJEE_ECOLI (153 aa), fasta FT scores; opt: 164 z-score: 205.3 E(): 0.00039, 33.8% FT identity in 80 aa overlap. 44.2% identity to HP0716. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF02367 FT Uncharacterised P-loop hydrolase UPF0079 was identified FT within CDS. No specific characterisation has been carried FT out yet. Putative kept within product function. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="InterPro:IPR003442" FT /db_xref="UniProtKB/TrEMBL:Q0PAK6" FT /inference="protein motif:Pfam:PF02367" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34808.1" FT /translation="MKEFILAKNEIKTMLQIMPKEGVVLLQGDLASGKTSLVQAWVKFL FT GLDVRVDSPTFSTMQKYENHDICIYHYDIYQEGLEGLLANGLFENFFEKGLHLVEWGGE FT NLKKTLMKFGISTIQIKISIKDDKRKYEIYE" FT misc_feature 623049..623402 FT /note="HMMPfam hit to PF02367, Uncharacterised P-loop FT hydrolase UPF0079, score 1e-18" FT /inference="protein motif:Pfam:PF02367" FT misc_feature 623091..623114 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 623410..624138 FT /transl_table=11 FT /locus_tag="Cj0669" FT /product="ABC-transporter ATP-binding protein" FT /note="Original (2000) note: Cj0669, probable FT ABC-transporter ATP-binding protein, len: 242 aa; highly FT similar to many e.g. YHBG_ECOLI probable ABC transporter FT ATP-binding protein (240 aa), fasta scores; opt: 840 FT z-score: 1144.2 E(): 0, 54.2% identity in 236 aa overlap. FT 65.8% identity to HP0715. Contains PS00017 ATP/GTP-binding FT site motif A (P-loop) and Pfam match to entry PF00005 FT ABC_tran, ABC transporters" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Appropriate motifs also present. Putative not added to FT product function. Functional classification FT -Transport/binding proteins - Other" FT /note="PMID:16079137" FT /db_xref="GOA:Q0PAK5" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="UniProtKB/TrEMBL:Q0PAK5" FT /inference="protein motif:Prosite:PS00017" FT /inference="protein motif:Pfam:PF00005" FT /protein_id="CAL34809.1" FT /translation="MSKLEIVNLEKIIKKTKIIHGISLEVNSGEVVGLLGPNGAGKTTT FT FYMICGLISPSSGKVLLDGLDVTKDPLNKRARSGIGYLPQESSIFKDLSVEDNLLLAAQ FT IFYKDKKILHDKVEQMLELLSIEPIRLRKGLSLSGGERRRCEIARSLMCEPKFLLLDEP FT FAGVDPIAVAEIQTLIKELKRLGIGVLITDHNVRETLAICDRAYVIRSGSLLASGNADE FT IATNKDVKKYYLGAEFKLLD" FT misc_feature 623494..624045 FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 8.9e-62" FT /inference="protein motif:Pfam:PF00005" FT misc_feature 623515..623538 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 624138..625388 FT /transl_table=11 FT /gene="rpoN" FT /locus_tag="Cj0670" FT /product="RNA polymerase sigma-54 factor" FT /note="Original (2000) note: Cj0670, rpoN, probable RNA FT polymerase sigma-54 factor, len 416 aa; similar to many FT e.g. RP54_BACSU RNA polymerase sigma-54 factor (436 FT aa),fasta scores; opt: 357 z-score: 603.0 E(): 2.7e-26, FT 28.9% identity in 443 aa overlap, and RP54_ECOLI (477 aa), FT fasta scores; opt: 365 z-score: 483.2 E(): 1.3e-19, 28.8% FT identity in 459 aa overlap. 47.4% identity to HP0714. FT Contains PS00718 Sigma-54 factors family signature 2, Pfam FT match to entry PF00309 Sigma54_factors, and FT helix-turn-helix motif at aa 303-324 (Score 1227; +3.37 FT SD)" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Putative not added to product FT function. Functional classification - Broad regulatory FT functions" FT /note="PMID:11292815" FT /db_xref="GOA:Q0PAK4" FT /db_xref="InterPro:IPR000394" FT /db_xref="InterPro:IPR007046" FT /db_xref="InterPro:IPR007634" FT /db_xref="UniProtKB/TrEMBL:Q0PAK4" FT /inference="protein motif:Pfam:PF00309" FT /inference="protein motif:Prosite:PS00718" FT /protein_id="CAL34810.1" FT /translation="MLKQKITQAPKTKISQTLRSWLPILQANIEDLKENLDKFAEDNPF FT LNVQDSIQTHDKGKNYFDSFYKHNVNSAFVDSKGLAKKSVYELLNEQILPPLFPTSKSQ FT ELAKKIIECLNEEGYFEHDEEFLKEYSLEEIERVRARFKFLDPVGVGAKDYKEAFLFAL FT ENMELDEDIDEFCRMLIMDFENIQNYTKEPLYKEALAVLKRFSTPPFLEYFEDSRIIVP FT DIFVYKENGEIKVKINDDYYPEISIQTDGLEHDFLSHYIKEAKNLVDALAMRKATLYKI FT GLMIVEYQYDFFMGKEIKPMTFKDLALDLERNASTISRAVANKYLSCERGLIPLRDFFA FT FALDEEGETSNVGVKEFVANLVKNEDRNKPLSDSKILELIKEEFKVDIGRRTITKYRKH FT LNIASSTDRKKLYELEG" FT misc_feature 624141..624287 FT /note="HMMPfam hit to PF00309, Sigma-54 factor, Activator FT interacting do, score 1.3e-15" FT /inference="protein motif:Pfam:PF00309" FT misc_feature 624357..624893 FT /note="HMMPfam hit to PF04963, Sigma-54 factor, core FT binding domain, score 3.6e-06" FT /inference="protein motif:Pfam:PF04963" FT misc_feature 624897..625367 FT /note="HMMPfam hit to PF04552, Sigma-54, DNA binding FT domain, score 3.7e-83" FT /inference="protein motif:Pfam:PF04552" FT misc_feature 625305..625328 FT /note="PS00718 Sigma-54 factors family signature 2" FT /inference="protein motif:Prosite:PS00718" FT CDS 625552..626976 FT /transl_table=11 FT /gene="dcuB" FT /locus_tag="Cj0671" FT /product="anaerobic C4-dicarboxylate transporter" FT /note="Original (2000) note: Cj0671, dcuB, probable FT anaerobic C4-dicarboxylate transporter, len: 474 aa; highly FT similar to e.g. DCUB_ECOLI anaerobic C4-dicarboxylate FT transporter (446 aa)opt: 1280 z-score: 2918.6 E(): 0, 69.1% FT identity in 466 aa overlap. No Hp ortholog. Also similar to FT Cj0088, dcuA (37.0% identity in 465 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF03605 Anaerobic FT C4-dicarboxylate membrane transport protein was identified FT within CDS. Twelve probable transmembrane helices predicted FT by TMHMM2.0. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Putative not added to product function. FT Functional classification - Transport/binding proteins - FT Carbohydrates, organic acids and alcohols" FT /note="PMID:8131924, PMID:9852003" FT /db_xref="GOA:Q0PAK3" FT /db_xref="InterPro:IPR004668" FT /db_xref="UniProtKB/TrEMBL:Q0PAK3" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03605" FT /protein_id="CAL34811.1" FT /translation="MDFLTSLSEAGQFAIQIIIVLICLFYGAKKGGIALGLLGGIGILM FT LVFAFHIKPGKPAIDVMLTILAVVVASATLQASGGLDVMLQIAERILRRNPKFLTILAP FT FVTCFLTILCGTGHVVYTIMPIIYDIAIKNGIRPERPMVAASISSQMGIIASPVSVAVV FT SLTALLLNANHKLAGFDGYINLLQITIPSTLFGVLCIGIFSWFRGKDLDKDEVFQEKLK FT DPEFKKYVYGDSKTLLGVKLPKSNWVAMWIFLGAIALVALLGVFDFLRPNWGQVVKNGI FT PQVDALGNPKMDVLSMVSVIQMFMLLAGSLIIIFTKTDAKKIGSNEIFKSGMIALVAVF FT GISWMADTMFAVHTPMMKAALGDIVKEHPWTYAVMLLLISKFVNSQAAAISAFVPLALG FT IGVEPGVIVAFAAACYGYYILPTYPSDLATIQFDRSGTTHIGKFVINHSFILPGLIGVI FT TSCIAGYFIAMAAGYL" FT misc_feature order(625579..625635,625648..625707,625735..625803, FT 625864..625932,625990..626058,626095..626163, FT 626290..626358,626431..626499,626542..626610, FT 626671..626739,626767..626835,626896..626964) FT /note="12 probable transmembrane helices predicted for FT Cj0671 by TMHMM2.0 at aa 10-28, 33-52, 62-84, FT 105-127,147-169, 182-204, 247-269, 294-316, 331-353, FT 374-396,406-428 and 449-471" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 625597..626763 FT /note="HMMPfam hit to PF03605, Anaerobic c4-dicarboxylate FT membrane transpo, score 4.2e-254" FT /inference="protein motif:Pfam:PF03605" FT misc_feature 626761..626793 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 626902..626934 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 627118..627306 FT /transl_table=11 FT /locus_tag="Cj0672" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0672, possible periplasmic FT protein, len: 62 aa; no Hp match. Contains possible FT N-terminal signal sequence and second hydrophobic domain" FT /note="Updated (2006) note: Two probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="InterPro:IPR011726" FT /db_xref="UniProtKB/TrEMBL:Q0PAK2" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34812.1" FT /translation="MRKGYPMDIIFALLLLLAFGSLCFFICFCEIQTKDTRMIFLLVLS FT LILALYLFYALLYPEKF" FT sig_peptide 627118..627207 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000315_627118_627306 by SignalP 2.0 FT HMM (Signal peptide probability 0.706) with cleavage site FT probability 0.562 between residues 30 and 31" FT misc_feature order(627145..627213,627232..627291) FT /note="2 probable transmembrane helices predicted for FT Cj0672 by TMHMM2.0 at aa 10-32 and 39-58" FT /inference="protein motif:TMHMM:2.0" FT CDS join(627316..627776,627776..628126,628129..628972) FT /pseudo FT /transl_table=11 FT /gene="kdpA" FT /locus_tag="Cj0676" FT /product="pseudogene (potassium-transporting ATPase A FT chain)" FT /EC_number="3.6.3.10" FT /note="Original (2000) note: Cj0676, kdpA, probable FT potassium-transporting ATPase A chain pseudogene, len: 1744 FT bp; highly similar to e.g. ATKA_ECOLI FT potassium-transporting ATPase A chain (EC 3.6.1.36) (557 FT aa). No hp match. Note thay kdpB (Cj0677) is intact, while FT kdpC (Cj0678) is a pseudogene" FT /note="Updated (2006) note: Pfam domain PF03814 FT Potassium-transporting ATPase A subunit identified within FT CDS. Also, ten probable transmembrane helices predicted by FT TMHMM2.0. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Thus, putative not used within product FT function. Coding sequence has been updated to reflect the FT complete amino acid sequence for the encoded protein FT regardless of its expression. This will cause differences FT from the amino acid sequence of the previous annotation. FT Functional classification - Transport/binding proteins FT -Cations" FT /note="PMID:6146979, PMID:15919996" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03814" FT misc_feature order(627319..627776,627776..628126,628129..628954) FT /note="HMMPfam hit to PF03814, Potassium-transporting FT ATPase A subunit, score 4e-243" FT /inference="protein motif:Pfam:PF03814" FT misc_feature order(627325..627384,627493..627561,627697..627765, FT 627801..627869,628038..628106,628157..628216, FT 628445..628513,628562..628630,628766..628834, FT 628883..628951) FT /note="10 probable transmembrane helices predicted for FT Cj0676 by TMHMM2.0 at aa 4-23, 60-82, 128-150, FT 163-185,242-264, 281-300, 377-399, 416-438, 484-506 and FT 523-545" FT /inference="protein motif:TMHMM:2.0" FT repeat_region 628170..628178 FT /note="G(9)" FT CDS 629020..631065 FT /transl_table=11 FT /gene="kdpB" FT /locus_tag="Cj0677" FT /product="potassium-transporting ATPase B chain" FT /EC_number="3.6.3.10" FT /note="Original (2000) note: Cj0677, kdpB, probable FT potassium-transporting ATPase B chain, len: 681 aa; similar FT to e.g. ATKB_ECOLI potassium-transporting ATPase B chain FT (EC 3.6.1.36) (682 aa), fasta scores; opt: 2419 z-score: FT 2798.9 E(): 0, 56.6% identity in 678 aa overlap. No Hp FT match. Contains PS00154 E1-E2 ATPases phosphorylation site FT and Pfam match to entry PF00122 E1-E2_ATPase. Note that FT kdpA (Cj0676) and kdpC (Cj0678) are pseudogenes" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Transport/binding proteins - Cations" FT /note="PMID:6146979, PMID:15919996" FT /db_xref="GOA:Q0PAK1" FT /db_xref="InterPro:IPR001757" FT /db_xref="InterPro:IPR005834" FT /db_xref="InterPro:IPR006391" FT /db_xref="InterPro:IPR008250" FT /db_xref="InterPro:IPR018303" FT /db_xref="InterPro:IPR023214" FT /db_xref="InterPro:IPR023299" FT /db_xref="InterPro:IPR023300" FT /db_xref="UniProtKB/TrEMBL:Q0PAK1" FT /inference="protein motif:Pfam:PF00122" FT /inference="protein motif:Prosite:PS00154" FT /protein_id="CAL34814.1" FT /translation="MSKKQNKLITKEILNNAIKGAFLKFDPRFMVKNPVMFMVEVGSIL FT TLILSIFPTLFNGNSDERIYNILITFILFIILFFANFAESIAEGRGKAQAATLRQSKKD FT SKARHIKSDGSEEMLNSSELKIGDIVLVKAGELIPNDGEIIEGTASVDESAITGESAPV FT MREAGGDFSSVTGGTTVLTDFLKIKILVGAGESFLDKMINLVEGAARQKTPNEIALNTL FT LIVLSLSFLMVVVSLYPFMQFLGVSLPISWLVALLVCLIPTTIGGLLSAIGIAGMDRVT FT RFNVIALSGKAVESCGDVDTMILDKTGTITFGNRLANEFYEVQGISKEEMIKACVLSSL FT KDETPEGKSIVALAQKMGYELEGNDIKEFIEFSAQNRMSGVDLQDNTKIRKGAFDAIRA FT YISEMNGKIPSDLETKVMEISNLGGTPLVVCKNEKILGVIYLKDTVKPGLKERFDELRK FT MGIKTLMCTGDNPLTAATITKEAGLDGFIAECKPEDKIKAIKKEQAQGKIVAMTGDGTN FT DAPVLTQADVGIAMNSGTQAAKEAANMIDLDSNPTKILEVVEIGKGLLITRGSLTTFSM FT TNDIAKYFAILPAMFSVVLPQMQILNIMHLATPKSAILSALIFNAIIIPLLIPIAMRGV FT KFKPMKSEHLLLRNLSIYGLGGMIAPFIGIKIIDIPTAWILRILGV" FT misc_feature order(629119..629187,629215..629268,629671..629739, FT 629767..629835,630766..630822,630850..630918, FT 630955..631023) FT /note="7 probable transmembrane helices predicted for FT Cj0677 by TMHMM2.0 at aa 34-56, 66-83, 218-240, FT 250-272,583-601, 611-633 and 646-668" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 629233..629904 FT /note="HMMPfam hit to PF00122, E1-E2 ATPase, score 4.5e-52" FT /inference="protein motif:Pfam:PF00122" FT misc_feature 629914..630624 FT /note="HMMPfam hit to PF00702, haloacid dehalogenase-like FT hydrolase, score 1.9e-30" FT /inference="protein motif:Pfam:PF00702" FT misc_feature 629932..629952 FT /note="PS00154 E1-E2 ATPases phosphorylation site" FT /inference="protein motif:Prosite:PS00154" FT misc_feature 630661..630699 FT /note="PS00018 EF-hand calcium-binding domain" FT /inference="protein motif:Prosite:PS00018" FT CDS join(631067..631075,631077..631469,631459..631587, FT 631587..631661) FT /pseudo FT /transl_table=11 FT /gene="kdpC" FT /locus_tag="Cj0678" FT /product="pseudogene (potassium-transporting ATPase C FT chain)" FT /EC_number="3.6.3.10" FT /note="Original (2000) note: Cj0678, kdpC, probable FT potassium-transporting ATPase C chain pseudogene, len: 553 FT bp; similar to e.g. ATKC_ECOLI potassium-transporting FT ATPase C chain (EC 3.6.1.36) (190 aa). No Hp match. Note FT that kdpA (Cj0676) is a pseudogene, but kdpB (Cj0677) is FT intact" FT /note="Updated (2006) note: Pfam domain PF02669 FT K+-transporting ATPase, c chain identified within CDS. Also FT one probable transmembrane helix predicted by TMHMM2.0. FT Further support given to product function. Characterised FT within Escherichia coli with acceptable identity score. FT Thus, putative not used within product function. Coding FT sequence has been updated to reflect the complete amino FT acid sequence for the encoded protein regardless of its FT expression. This will cause differences from the amino acid FT sequence of the previous annotation. Functional FT classification - Transport/binding proteins -Cations" FT /note="PMID:6146979, PMID:1532388" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02669" FT misc_feature order(631070..631075,631077..631459,631469..631587, FT 631587..631649) FT /note="HMMPfam hit to PF02669, K+-transporting ATPase, c FT chain, score 8.8e-32" FT /inference="protein motif:Pfam:PF02669" FT misc_feature 631080..631139 FT /note="1 probable transmembrane helix predicted for Cj0678 FT by TMHMM2.0 at aa 5-24" FT /inference="protein motif:TMHMM:2.0" FT CDS 631667..633487 FT /transl_table=11 FT /gene="kdpD" FT /locus_tag="Cj0679" FT /product="truncated KdpD protein" FT /EC_number="2.7.3.-" FT /note="Original (2000) note: Cj0679, kdpD', truncated KdpD FT protein, len: 606 aa; similar to other kdpD sensor FT proteins, but lacking the C-terminal two-component FT histidine kinase domain, e.g. KDPD_ECOLI sensor protein FT KDPD (EC 2.7.3.-) (894 aa), fasta scores; opt: 883 z-score: FT 1523.9 E(): 0, 34.8% identity in 604 aa overlap. No Hp FT match. Note that C. jejuni apparently lacks a kdpE FT two-component regulator homolog" FT /note="Updated (2006) note: Pfam domain PF02702 FT Osmosensitive K+ channel His kinase sensor domain was FT identified within CDS. Five probable transmembrane helices FT predicted by TMHMM2.0. Further support for product FT function. Putative not added to product function. FT Functional classification - Transport/binding proteins FT -Cations" FT /note="PMID:9226259, PMID:7499326, PMID:1532388" FT /db_xref="GOA:Q0PAK0" FT /db_xref="InterPro:IPR003852" FT /db_xref="UniProtKB/TrEMBL:Q0PAK0" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02702" FT /protein_id="CAL34816.1" FT /translation="MQRQSPEQILKKLEVKAKEEEKNKLVKLKIFLGYAAGSGKTYAML FT SEARTLRDNGVDVVLGYIEPHDRPETMALAQGFESIANLEIPYKNIVLKEFDLDATLKR FT KPALVLVDELAHTNAKGLRNEKRFQDIEELLKAGIDVYTTLNIQHLESLNDLVANISKI FT EVKERIPDRIFDEADQVELVDIEPNKLLKRMQDGKIYKEKQAKLALENFFRQERLIALR FT EIALRRLASRVNLRASEQRLINDDLAYHTGEHILVCINASNAKVIRAAARLALAFHAKL FT SALYIKNPNIKEAKALEENIELAKSFDAKIISVYDDIARQIAEYSSLSNVSKIVLGKNK FT DKKSLKKRFLKLSLKKHPILIYILSMKIKFLLLKYEVKKSFDFLGFLKITGVLLLATFI FT AFVFHKFNTQPSNIVMIFILAVFASSFISDNKIFAFYSSLVSVLIYNFFFLEPIFSLKV FT HDSGNIITFTTMFIVGFLTAVFTRRLKLQSKELTKRAYRTAILLENSENLARVKSKQEL FT WEQLGNQALKLLNLPIIIYPINKNNILSKPLLFFNDDKQMLKNCFSADEIAIAQWVATN FT KERAGVCTNTLPNANAMYLPIEDGKKLKGL" FT misc_feature 631739..632365 FT /note="HMMPfam hit to PF02702, Osmosensitive K+ channel His FT kinase sensor d, score 1.3e-150" FT /inference="protein motif:Pfam:PF02702" FT misc_feature order(632738..632797,632816..632875,632903..632947, FT 632960..633028,633056..633124) FT /note="5 probable transmembrane helices predicted for FT Cj0679 by TMHMM2.0 at aa 358-377, 384-403, 413-427,432-454 FT and 464-486" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(633589..635562) FT /transl_table=11 FT /gene="uvrB" FT /locus_tag="Cj0680c" FT /product="excinuclease ABC subunit B" FT /note="Original (2000) note: Cj0680c, uvrB, probable FT excinuclease ABC subunit B, len: 657 aa; highly similar to FT many e.g. UVRB_ECOLI excinuclease ABC subunit B (673 FT aa),fasta scores; opt: 2185 z-score: 2414.8 E(): 0, 50.8% FT identity in 667 aa overlap. 63.8% identity to HP1114. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop),and FT Pfam match to entry PF00271 helicase_C, Helicases conserved FT C-terminal domain" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity scores. Putative FT not added to product function. Functional classification FT -DNA replication, restriction/modification, recombination FT and repair" FT /note="PMID:3008099, PMID:10631326, PMID:11689453" FT /db_xref="GOA:Q9PPM7" FT /db_xref="InterPro:IPR001650" FT /db_xref="InterPro:IPR001943" FT /db_xref="InterPro:IPR004807" FT /db_xref="InterPro:IPR006935" FT /db_xref="InterPro:IPR009055" FT /db_xref="InterPro:IPR014001" FT /db_xref="InterPro:IPR024759" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPM7" FT /inference="protein motif:Pfam:PF00271" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34817.1" FT /translation="MLELTSEFKPSPDQQEAIKGIVKSIKKGNKYQTLLGVTGSGKTFT FT MANVIKELNIPTLIMSHNKSLCAQLYSEFKGFFSKNHVEYFISYYDYYQPEAYIPRTDV FT FIEKDSSTNEDLERLRLSATASLLSYEDVVCIASVSANYGLGNPNEYIGMVLIFELGMQ FT ISQKELLKKLVDMGYKRNDNFFDRADFRVQGDIIDIYPAYYEDEVVRLEFFGDELDAMY FT HYNVLENKKGKDLKRFILYPTSQFSVGETRLKQAIKDIKAELNERLAYFEHENKLVEYQ FT RLKQRVEFDLEMLTSTGMCKGVENYARHLTGLKEGDTPYTLFDYFAIKDRKFLVIVDES FT HVSLPQFRGMFAGDRSRKQTLVDYGFRLPSALDNRPLMFDEFIHKNCQFLFVSATPAPL FT ELELSKENIFHQIMRPTGLLDPLIELKDSDNQVEILFDEAKKVIQRNERVLVTVLTKKL FT AEELTRYYLELGIKVKYMHSDIDAIERNEIIRGLRSGAFDMLIGINLLREGLDLPEVSL FT IAIMDADKEGFLRSTTSLIQTMGRAARNVNGKVLLFCKKITKSMQEAMDTTNERRKLQM FT AYNKKYNITPTSVKRHIEESLKNEEDLGEIYRKGKKLEKMPASERAKLVKELRKQMLEA FT AKALEFEKAAAIRDEINKLRDL" FT misc_feature complement(633592..633699) FT /note="HMMPfam hit to PF02151, UvrB/uvrC motif, score FT 1.2e-11" FT /inference="protein motif:Pfam:PF02151" FT misc_feature complement(633925..634170) FT /note="HMMPfam hit to PF00271, Helicase conserved FT C-terminal domain, score 7.4e-18" FT /inference="protein motif:Pfam:PF00271" FT misc_feature complement(635182..635541) FT /note="HMMPfam hit to PF04851, Type III restriction enzyme, FT res subunit, score 1.4e-06" FT /inference="protein motif:Pfam:PF04851" FT misc_feature complement(635434..635457) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 635716..635946 FT /transl_table=11 FT /locus_tag="Cj0681" FT /product="hypothetical protein Cj0681" FT /note="Original (2000) note: Cj0681, unknown, len: 76 aa; FT 36.2% identity to HP0385. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAJ8" FT /protein_id="CAL34818.1" FT /translation="MFDEKIINTMTDKVNELIEKYNEVCEANEALRNELVSVKAQNEAK FT SNQIMRLEEELKSRNIESEDIYKKIEAVLGR" FT CDS 635936..636178 FT /transl_table=11 FT /locus_tag="Cj0682" FT /product="hypothetical protein Cj0682" FT /note="Original (2000) note: Cj0682, unknown, len: 80 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAJ7" FT /protein_id="CAL34819.1" FT /translation="MADNLKQVIVNVNAKDFIVKCSEEFANFLEDDIALISGGTKKIEL FT KRFVDAFVKKSYENYILERELKKLIKAINEELPTK" FT CDS 636175..636612 FT /transl_table=11 FT /locus_tag="Cj0683" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0683, probable periplasmic FT protein, len: 145 aa; no Hp match" FT /note="Updated (2006) note: One probable transmembrane FT helices predicted by TMHMM2.0. Further support for product FT function. Pfam domain PF07963 Prokaryotic N-terminal FT methylation motif was identified within CDS. The motif is FT involved in methylation and is said to be found at the FT N-terminus of pilins and other proteins involved in FT secretion. Functional classification - Miscellaneous FT periplasmic proteins" FT /db_xref="InterPro:IPR012902" FT /db_xref="UniProtKB/TrEMBL:Q0PAJ6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF07963" FT /protein_id="CAL34820.1" FT /translation="MNKAFTLLELVFVILILGILSSLSLSFINTTKDEVKILKLKMDYE FT MLSSALALMRSQMRLKNLNFPEILDNAQNNQAKEKLFYCLNDCDYSLLDTPIYSDFKSW FT IKIGKNHYRFALNAKEMVEFIYDSKEGLLKCIGSSRCKDLI" FT sig_peptide 636175..636279 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000318_636175_636612 by SignalP 2.0 FT HMM (Signal peptide probability 0.844) with cleavage site FT probability 0.281 between residues 35 and 36" FT misc_feature 636181..636252 FT /note="HMMPfam hit to PF07963, Prokaryotic N-terminal FT methylation motif, score 0.0002" FT /inference="protein motif:Pfam:PF07963" FT misc_feature 636187..636255 FT /note="1 probable transmembrane helix predicted for Cj0683 FT by TMHMM2.0 at aa 5-27" FT /inference="protein motif:TMHMM:2.0" FT CDS 636594..638447 FT /transl_table=11 FT /gene="priA" FT /locus_tag="Cj0684" FT /product="putative primosomal protein N'" FT /EC_number="3.6.1.-" FT /note="Original (2000) note: Cj0684, priA, probable FT primosomal protein N', len: 617 aa; similar to e.g. FT PRIA_BACSU primosomal protein N' (replication factor Y) FT (805 aa), fasta scores; opt: 566 z-score: 629.9 E(): FT 8.7e-28, 33.1% identity in 525 aa overlap. 45.6% identity FT to HP0387. Contains PS00017 ATP/GTP-binding site motif A FT (P-loop) and Pfam match to entry PF00271 FT helicase_C,Helicases conserved C-terminal domain" FT /note="Updated (2006) note: Pfam domains PF04851 Type III FT restriction enzyme, res subunit and PF00270 DEAD/DEAH box FT helicase were identified within CDS. Further support given FT to product function. Characterised within Bacillus subtilis FT with marginal identity score. Sequence alignment was only FT partial. Putative kept within product function. Functional FT classification - DNA replication,restriction/modification, FT recombination and repair" FT /note="PMID:9086272" FT /db_xref="GOA:Q0PAJ5" FT /db_xref="InterPro:IPR001650" FT /db_xref="InterPro:IPR005259" FT /db_xref="InterPro:IPR011545" FT /db_xref="InterPro:IPR014001" FT /db_xref="UniProtKB/TrEMBL:Q0PAJ5" FT /inference="protein motif:Pfam:PF00270" FT /inference="protein motif:Pfam:PF04851" FT /inference="protein motif:Pfam:PF00271" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34821.1" FT /translation="MQRSDIRYYELAICGLYLDNLTFHSFDEIKPLTQVLVDLKTKKNL FT KAIVLKECQKPDFKTVEIKEITEYFLTPLQFELANFIVYYYASKLGFVLGFFETSPKYE FT CHKMFFKDTPKLSNQQQNALSFLQKENNSLLFADTGSGKTEIYISLIKECLEQGKQALL FT LMPEIALTPQMQKRLEVYFKDNFFLWHSKISKKKKQEYLERFCKGEVLLVAGARSALFL FT PFRNLGLIVVDEEHDNSYKASNQPFINARDLALFLGQKNNIQVILGSATPSLTSFYKQK FT SFRLKGTFFESKKHFLYDENELGITPMLLSELEKSLKHQKQAIVFLPTRANFRQIICKD FT CGETIKCPFCSIAMSMHKKKNILKCHYCNYTSLIEQNCPSCKGEMLEARKIGTAELLEL FT LQNALPLAKIAKFDSDEITSVKKLNTILKNFNENKIDILIGTSMLAKGHDYHSVDLSVI FT LGLDEYLLRPSFRASEETLALAMQVAGRAGRKGEARVLLQTKNRAFFERYIENYDAFLK FT DELENRKDLYPPFKRLLRVLIEDKDQKSAQKLCEKFASQFRNIKQVELVGYGICGVEML FT YGKYRFYLLLRSENHKALVAIENYILQFKNASADIDPIDFV" FT misc_feature 636933..637415 FT /note="HMMPfam hit to PF04851, Type III restriction enzyme, FT res subunit, score 2e-06" FT /inference="protein motif:Pfam:PF04851" FT misc_feature 636939..637433 FT /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,score FT 9.2e-11" FT /inference="protein motif:Pfam:PF00270" FT misc_feature 637002..637025 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 637809..638066 FT /note="HMMPfam hit to PF00271, Helicase conserved FT C-terminal domain, score 2.2e-06" FT /inference="protein motif:Pfam:PF00271" FT CDS complement(638540..639892) FT /transl_table=11 FT /gene="cipA" FT /locus_tag="Cj0685c" FT /product="Invasion protein CipA" FT /note="Original (2000) note: Cj0685c, possible sugar FT transferase, len: 450 aa; no Hp match. Contains variable FT poly-G tract near C-terminus; G9 (consensus) allows FT complete translation, G10 would cause truncation at aa 233. FT Some similarity to Cj1421c (28.0% identity in 404 aa FT overlap) and Cj1422c (25.3% identity in 442 aa FT overlap),both of which contain variable polyG tracts, FT though in different positions. Putative functional FT assignment is based on family clustering (BLASTP) with FT other C. jejuni predicted sugar transferases e,g, Cj1434c, FT and Cj1438c" FT /note="Updated (2006) note: No specific characterisation FT carried out yet. Putative kept within product function. FT Original and updated annotation kept designation as FT putative sugar transferase. This gene has now been patented FT as encoding invasion protein of Campylobacter species. FT Also, work has been carried out within a PhD thesis. FT Functional classification - Surface polysaccharides, FT lipopolysaccharides and antigens" FT /note="http://www.freepatentsonline.com/6087105.html" FT /note="http://www.collectionscanada.ca/obj/s4/f2/dsk1/tape9/PQDD_0004/MQ46044.pdf#search=%22cipA%20AND%20campylobacter%22" FT /db_xref="InterPro:IPR021353" FT /db_xref="UniProtKB/TrEMBL:Q0PAJ4" FT /protein_id="CAL34822.1" FT /translation="MNYIYKLNTIKRGYMQNLLFYIKNNLTPTLAQILLQALKNSNNEK FT FFTFVLENIETICTWLNSNKFRDRYLSTKHPYPPLINPNFIEIDSSRHCAELAWDLNLP FT LPKHYKFIYISPHGVGAAAFLRYLNQCCDVTCFASWVLPPDSKERYCINYMCLNDNTIA FT QYAINISEINLPYFDKYLSLLDFNSKIICGVRDPIGLLKHSWGRDWSKVLRNYPPEFNL FT TYDWRYYINYLTHQNHKIKIDINELQQGVFIISYLLKYFNKDNVYYLDMEEIRQSKAFD FT TMNLLAINFNFTPPHKDKLDLFKIKEFRGYIRYLFPITLYANSKDINNTFYLNTPKNNK FT NFNIDRTSSIPIILDRKHINHEKIDVIQEIIKNDLCNDMGVYIDKNDFKQLEQNNLLFS FT TIKHYLYDFLYQIKITIDETESKMMKEKDVIDYFIKNKSLIYTFLIYLKMN" FT misc_feature complement(638948..638995) FT /note="PS00225 Crystallins beta and gamma 'Greek key' motif FT signature" FT /inference="protein motif:Prosite:PS00225" FT CDS 639998..641071 FT /transl_table=11 FT /gene="ispG" FT /locus_tag="Cj0686" FT /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate FT synthase" FT /EC_number="1.17.4.3" FT /note="Original (2000) note: Cj0686, gcpE, unknown, len: FT 357 aa; similar to e.g. GCPE_ECOLI GCPE protein (protein E) FT (372 aa), fasta scores; opt: 907 z-score: 1058.3 E(): 0, FT 41.7% identity in 345 aa overlap, and to Providencia FT stuartii TR:P72241 (EMBL:U67933) AARC (365 aa), involved in FT in density-dependent regulation of 2'-N-acetyltransferase, FT fasta scores; opt: 902 z-score: 1052.6 E(): 0, 40.6% FT identity in 352 aa overlap. 62.3% identity to HP0625" FT /note="Updated (2006) note: Pfam domain PF04551 GcpE FT protein was identified within CDS. Further support given to FT product function. Characterised within Escherichia coli FT with acceptable identity score. Product function modified FT to new family member based on characterisation papers. FT Putative not added to product function. EC number inserted FT and gene name updated. Functional classification - Misc" FT /note="PMID:16268586, PMID:12571359, FT PMID:11752431,PMID:1521767" FT /db_xref="GOA:Q9PPM1" FT /db_xref="InterPro:IPR004588" FT /db_xref="InterPro:IPR011005" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR016425" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPM1" FT /inference="protein motif:Pfam:PF04551" FT /protein_id="CAL34823.1" FT /translation="MEYKRFKTRQIKVGNVLIGGDAPISVQSMLFTKTRDIEGSLEQIN FT RLYFAGANIVRLACLDMADARALKEIKAKSPLPLIVDIHFNHNLAVYCAEFIDGVRINP FT GNIGSKENIKEVVKACKERGIPIRIGVNHGSIEKQFSDKFGYGVDAMLESAMYNIKLLE FT DLDFFDIKISMKTSDAQKTIEAYERLRPLCDYPFHLGVTEAGTKFHSTVKSSIALGNLL FT LKGIGDTMRVSMTGELEEEIRVARAILQDSGVQKSGVNIISCPTCGRIQSDLLSAIKIV FT EEKTKHIKEPLNISVMGCVVNALGEAKGADVAIAFGKNQGLVIRHGEVVAKLKESELVD FT RFLAEVEDEVKSRVVKE" FT misc_feature 640010..641059 FT /note="HMMPfam hit to PF04551, GcpE protein, score FT 7.5e-248" FT /inference="protein motif:Pfam:PF04551" FT CDS complement(641102..641800) FT /transl_table=11 FT /gene="flgH" FT /locus_tag="Cj0687c" FT /product="putative flagellar L-ring protein precursor" FT /note="Original (2000) note: Cj0687c, flgH, probable FT flagellar L-ring protein precursor, len: 232 aa; similar to FT e.g. FLGH_ECOLI flagellar L-ring protein precursor (basal FT body L-ring protein) (232 aa), fasta scores; opt: 305 FT z-score: 348.0 E(): 4.4e-12, 26.4% identity in 231 aa FT overlap. 39.3% identity to HP0325. Contains N-terminal FT signal sequence and appropriately positioned PS00013 FT Prokaryotic membrane lipoprotein lipid attachment site" FT /note="Updated (2006) note: Pfam domain PF02107 Flagellar FT L-ring protein was identified within CDS. Further support FT given to product function. Characterised within Salmonella FT typhimurium and Caulobacter crescentus with marginal FT identity scores. Putative kept within product function. FT Functional classification - Surface structures" FT /note="PMID:2544561, PMID:2211524" FT /db_xref="GOA:Q9PPM0" FT /db_xref="InterPro:IPR000527" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPM0" FT /inference="protein motif:Pfam:PF02107" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34824.1" FT /translation="MKKVLFYVLPFAFFGCSATVDPQISMKPPAYVEELAPKQSNNVES FT APGSLFGKGDNPLFSDKKAMNVNDLVTVVIQESTTQSTQANKATSRTNTSNLGGGALTG FT SSGVVANALNKVNAYSNIGFQTNSSNNYTGTGSQSRNESFNTTISTRVIKILSNGNYFI FT EGSRELLINGEKQIIQLSGVIRPYDIGQDNTIDSKYIADAKILYKTEGEVDRSTRKPWG FT SKVIEAIWPF" FT misc_feature complement(641108..641755) FT /note="HMMPfam hit to PF02107, Flagellar L-ring FT protein,score 2.3e-49" FT /inference="protein motif:Pfam:PF02107" FT sig_peptide complement(641705..641800) FT /note="Signal peptide predicted for flgH by SignalP 2.0 HMM FT (Signal peptide probability 0.848) with cleavage site FT probability 0.559 between residues 32 and 33" FT misc_feature complement(641753..641785) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 641890..643395 FT /transl_table=11 FT /gene="pta" FT /locus_tag="Cj0688" FT /product="putative phosphate acetyltransferase" FT /EC_number="2.3.1.8" FT /note="Original (2000) note: Cj0688, pta, probable FT phosphate acetyltransferase, len: 501 aa; highly similar in FT C-terminus to e.g. PTA_ECOLI phosphate acetyltransferase FT (EC 2.3.1.8) (713 aa), fasta scores; opt: 1012 z-score: FT 1161.8 E(): 0, 48.8% identity in 326 aa overlap. 24.8% FT identity in N-terminus to HP0905" FT /note="Updated (2006) note: Pfam domain PF01515 Phosphate FT acetyl/butaryl transferase was identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli with acceptable identity FT score,however, sequence alignment was only partial. FT Putative kept within product function. Literature search FT identified paper linking product function to biofilm FT formation (PMID:16436427). Functional classification - FT Degradation -Carbon compounds" FT /note="PMID:16436427, PMID:7883769" FT /db_xref="GOA:Q0PAJ1" FT /db_xref="InterPro:IPR002505" FT /db_xref="InterPro:IPR004614" FT /db_xref="UniProtKB/TrEMBL:Q0PAJ1" FT /inference="protein motif:Pfam:PF01515" FT /protein_id="CAL34825.1" FT /translation="MMANLYLMRSRSDELNTIISTNLLKNYSKIYKNIAIYCPVIYIHR FT VPVLQGWLEEFNINQTVKSAYGFTFREAMEEFSKDPHNFFNVILEEYEELKRKYDFVLV FT NSFCEFGILDGFDLSIKLAKNLNTPIAAIINDEDKLIAQKYFDHALDGRNYVLINENFN FT FEEVQKLKEYDFITPHRFKYELIKQSIKNKKTVVLPESNDERILKAAEILLKSKVVDLI FT LLGDEEKIKQDATRLSLDLSAMQIMNPLNSEYNQKFTSILYEARKSKGMSLEEAKMLVQ FT DKTYFGTLLIHTGKADAMVSGASTTTAETIRPALQLIKTKEGISSVSGIFFMGLEDQVL FT AFADCAVNPSPTAEQLATSAYVSAMTAKSFGLEPRIALLSYSSGDSGKGESVDLVKEAL FT KIAKEKYPELNIDGPMQFDCAYDPKTAAKKMPNSKIAGHANVYIFPDLNAANICYKAVQ FT RTANALAIGPILQGLKKPVNDLSRGCLVDDIVDTVILSAIQAQ" FT misc_feature 642427..643380 FT /note="HMMPfam hit to PF01515, Phosphate acetyl/butaryl FT transferase, score 2e-159" FT /inference="protein motif:Pfam:PF01515" FT CDS 643409..644599 FT /transl_table=11 FT /gene="ackA" FT /locus_tag="Cj0689" FT /product="acetate kinase" FT /EC_number="2.7.2.1" FT /note="Original (2000) note: Cj0689, ackA, probable acetate FT kinase, len: 396 aa; highly similar to e.g. ACKA_ECOLI FT acetate kinase (EC 2.7.2.1) (acetokinase) (400 aa), fasta FT scores; opt: 1048 z-score: 1254.5 E(): 0, 46.6% identity in FT 395 aa overlap. No Hp match. Contains PS01075 and PS01076 FT Acetate and butyrate kinases family signature 1 and 2, and FT Pfam match to entry PF00871 Acetate_kinase,Acetokinase FT family" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Energy metabolism - Electron transport" FT /note="PMID:7883769" FT /db_xref="GOA:Q9PPL8" FT /db_xref="InterPro:IPR000890" FT /db_xref="InterPro:IPR004372" FT /db_xref="InterPro:IPR023865" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPL8" FT /inference="protein motif:Pfam:PF00871" FT /inference="protein motif:Prosite:PS01076" FT /inference="protein motif:Prosite:PS01075" FT /protein_id="CAL34826.1" FT /translation="MKILVLNSGSSSIKFKFFDNKVVKASGLVEKIGEQNSKVVLKNTL FT NNESFERELTINNHEEGLSIVNELFKESGILADLNALDGCGHRIVHGGRNLSEHCLVDD FT YVLKEIDRVSIFAPLHNPAHLAGIKTMIKAAPSVANAAIFDTAFHRTMPDFAYMYALPY FT DFYDKHNIRRYGFHGTSHAYVSSRAAKFLQKDQNELNVISAHLGNGASVCAIEKGKSVD FT TSMGFTPLEGLVMGTRCGDLDPAILPFISHLKGLTIEEIDTLMNKKSGVYGICGYNDFR FT DIEREIEQGNDKARLALDMFCYRLVKYIGSYFAVLPKTDAIIFTGGIGENDSLVRQKVC FT ERLAHLGIELDFELNKQRISGERMINHANSKVKVLVIPTDEELEIARITEELIGKN" FT misc_feature 643412..644569 FT /note="HMMPfam hit to PF00871, Acetokinase family, score FT 1.4e-188" FT /inference="protein motif:Pfam:PF00871" FT misc_feature 643415..643450 FT /note="PS01075 Acetate and butyrate kinases family FT signature 1" FT /inference="protein motif:Prosite:PS01075" FT misc_feature 644009..644062 FT /note="PS01076 Acetate and butyrate kinases family FT signature 2" FT /inference="protein motif:Prosite:PS01076" FT CDS complement(644627..648379) FT /transl_table=11 FT /locus_tag="Cj0690c" FT /product="putative restriction/modification enzyme" FT /note="Original (2000) note: Cj0690c, possible FT restriction/modification enzyme, len: 1250 aa; similar to FT Borrelia burgdorferi plasmid TR:O50698 (EMBL:AE000785) FT hypotheticalprotein BBE02 (1277 aa), fasta scores; opt: FT 1517 z-score: 1607.6 E(): 0, 35.0% identity in 1304 aa FT overlap. Very weak similarity to T257_ECOLI type IIS FT restriction enzyme ECO57I (997 aa), fasta scores; opt: 156 FT z-score: 163.4 E(): 0.083, 19.6% identity in 981 aa FT overlap. No Hp ortholog. Some simlarity to Cj0031 (25.0% FT identity in 859 aa overlap). Contains PS00092 N-6 FT Adenine-specific DNA methylases signature" FT /note="Updated (2006) note: Pfam domain PF04313 Type I FT restriction enzyme R protein N terminal was identified FT within CDS. Further support given to product function. FT Probable replaced with putative. Product function modified FT to more specific family member based on motif match. No FT specific characterisation with acceptable identity score FT carried out yet. Putative kept within product function. FT Functional classification - DNA FT replication,restriction/modification, recombination and FT repair" FT /db_xref="GOA:Q0PAI9" FT /db_xref="InterPro:IPR002052" FT /db_xref="InterPro:IPR002296" FT /db_xref="InterPro:IPR011639" FT /db_xref="UniProtKB/TrEMBL:Q0PAI9" FT /inference="protein motif:Pfam:PF04313" FT /inference="protein motif:Prosite:PS00092" FT /protein_id="CAL34827.1" FT /translation="MNYYQELKKYLNNNLFTSYSLEIDFPKIYNFNANQKAFRDILTKI FT TKIYDKNKFIKQNEHQFEDEFISKVLEILGWCFVRQDEKIIQGKLEKPDFLLFSNDKLK FT SKYENLDKETKKSSNDFTIILESKAYNIEIDNKKVKDNPHFQILRYLGNLKKNYGFLTN FT GRFWRFYDNSILNSNKVFYEINLEKIIEDQNIEAFAYFYSVFSAFNFTEKEDHLEITLQ FT NNKLSKIKIEDDLKSIIYGTNGNESLFEFIGSRIYNKTKADLKLIYENSLYFIFRLLFI FT AYFEDKFEIILEKHKYFKSKISLRTLLENLQEDESSSGGFGELENIFNIYNKGKGNFDM FT PVFNGGLFDESKTALLSTPKIFNDKDLKFILNQLLNFKDKNLSFKRDYKTLSVEHLGTI FT YEGLLSYFFEIANEDIYYVSYKEKSKEIECYFDNYDFKILEKSKKVEKYTFYKKGQIYL FT KNTSNSRKASASFYTPQSIANFLIQSALKDKLNNENILKFKILDNACGSGHFLVGVLNA FT ITHIVLSDFDHFTNLKELYEEEKENILNHIKDFVQDYEVDESDILKRLLLKRIIYGVDL FT NPFSIELTKLSLWIDSFIFTTPLSFIEHHIKCGNALINSNLSDFKDLIKQNSSNLFTNS FT ITQEFEILQEVFEKLDNLKDTNEEQIKQSKQIYQNEITPKLNKLNLYLNYINTLHFVNK FT EELQILKALSQDDIQNLSQNEQAKAIISKYQKEFNFFNYELEFPEIVENQVFKGFDIII FT GNPPWDKTKFSDSDFFPQYKSDYRSLIASKKKEIQDNLLAKDYIKQNYEKQKAYINDLS FT EYYKKAYPLNKGSGDGNLFRLFVEKNLSLLKQDGNLAYVLPSALMFEDGSLILRKEILE FT NKTLEYFYSFENNKAIFIDVHRSYKFALMLIKNTQANHTHKIKMMFYKTDINSLKNKDE FT ILTLNLKDIKKLSPTHLALMELKDKQALEILRKSYNAFQNLSFDYIDFRRELDMTNDKD FT LFIEEFREGLLPLYEGKMIHQFDANFSQATYFLEKAKFDERLKSKELYRAKKATGKELN FT PKLIKYDREFFRLGYRKIASDTNERTLIASLLPKNCGGADSTYSNIPKQYVLKDDVICM FT DIVPYERILFVLALFNSLVVDFIIRNMVQINVSKSYLERIPLPQPSDEEIQNNEIYKTL FT AKNALLLQLYNDQNRHFDELKQEFNIKNEEIPKTKKAYDILRAKNDLLVKELYGLSDDE FT FSYMISTFKVLNEKQSEYITLLKTI" FT misc_feature complement(646106..646126) FT /note="PS00092 N-6 Adenine-specific DNA methylases FT signature" FT /inference="protein motif:Prosite:PS00092" FT misc_feature complement(647846..648214) FT /note="HMMPfam hit to PF04313, Type I restriction enzyme R FT protein N termin, score 3.1e-21" FT /inference="protein motif:Pfam:PF04313" FT CDS 648529..649020 FT /transl_table=11 FT /locus_tag="Cj0691" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0691, possible membrane FT protein, len: 163 aa; no Hp match. Contains two possible FT transmembrane domains. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PAI8" FT /protein_id="CAL34828.1" FT /translation="MKKFKEFSLRFLFKVSEQPVLIRDLLEANALFNDGMLVDPSKLNF FT NFKILNSYIYFGVFCAVILLPLLLITHYFLTKLDFHISIVSAVMVTACVFIGYDIFKVY FT TRKIISKKIIQKAWALHFPYFAYEKYSTMAGEFYKEALKEEIPKANLEQYVLDKIIHSK FT " FT misc_feature order(648685..648753,648766..648834) FT /note="2 probable transmembrane helices predicted for FT Cj0691 by TMHMM2.0 at aa 53-75 and 80-102" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 648775..648807 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(649008..649946) FT /transl_table=11 FT /locus_tag="Cj0692c" FT /product="putative membrane protein" FT /note="Original (2000) note: Cj0692c, possible membrane FT protein, len: 312 aa; 34.7% identity in N-terminus to FT HP0708 (114 aa). Contains one possible transmembrane FT domain. Functional classification - Membranes,lipoproteins FT and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PAI7" FT /protein_id="CAL34829.1" FT /translation="MLEDDFIKERQNIRQKMLKFSRAINQGKPLDDDLRDEISSDDILR FT RRFKKKTPNKFLEELDEEYESKHTKKSNIYLKEDLINVKLEEKQSLAKKIFSKMKERRK FT EENKKTKKNFLFSRKKANEIKNIQTKTQIQTKSNQATTQTKQEKKELTNSIEKIQKTET FT KIQKPLIIEKKLDVKNQPNIKKSLENLQKKITPQENKQELPKPSNQAQEKQQNDEDAQK FT AKNILLEGFSNATKEDRNLNFNHLLFAALLVSFALFLFAPQIYIRNQIYYLSREIATLR FT TEESVLNEENKDLKRRLENMRFQNQILDYLE" FT misc_feature complement(649152..649220) FT /note="1 probable transmembrane helix predicted for Cj0692c FT by TMHMM2.0 at aa 243-265" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(649946..650884) FT /transl_table=11 FT /gene="mraW" FT /locus_tag="Cj0693c" FT /product="S-adenosyl-methyltransferase" FT /EC_number="2.1.1.-" FT /note="Original (2000) note: Cj0693c, unknown, len: 312 aa; FT similar to members of the YABC/YLXA family of hypothetical FT proteins e.g. YLXA_BACSU (311 aa), fasta scores; opt: 584 FT z-score: 670.8 E(): 4.6e-30, 39.8% identity in 304 aa FT overlap. 47.4% identity to HP0707" FT /note="Updated (2006) note: Pfam domain PF01795 MraW FT methylase family was identified within CDS. Characterised FT within Escherichia coli with marginal identity score. FT Product modified to more specific family member based on FT motif and characterisation. Putative not added to product FT function. EC number and gene name added. Functional FT classification - Aminoacyl tRNA synthetases and their FT modification" FT /note="PMID:10572301" FT /db_xref="GOA:Q9PPL4" FT /db_xref="InterPro:IPR002903" FT /db_xref="InterPro:IPR023397" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPL4" FT /inference="protein motif:Pfam:PF01795" FT /protein_id="CAL34830.1" FT /translation="MILEIPHIPVLLNEVQEIFKNLKTGYFLDCTLGFGGHSEALLKNH FT PDLKFIACDQDQQALKFSKKRLKDFRNRITFMQSNFSEVLEKISHKEELRGILADIGVS FT SFQLDNNERGFSVNSDFLDMRMNQNSKISAYEIINTYTKEQLTSIFKDYGELHDAHFIA FT EKICLERSKNLIKSAKELYQIIGKGKQNHRKISKATLAFQAIRIEVNQELKVLKDFLEH FT LENLKPKNCILAIISFHSLEDRIVKQFFKKWSKNCICNEKIMRCECGNNHSLGQIITKK FT AISASKEELLKNSRSSCAKMRAFYFNNLDNK" FT misc_feature complement(649964..650875) FT /note="HMMPfam hit to PF01795, MraW methylase family,score FT 7.1e-110" FT /inference="protein motif:Pfam:PF01795" FT CDS 651043..652533 FT /transl_table=11 FT /locus_tag="Cj0694" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0694, probable periplasmic FT protein, len: 496 aa; C-terminus is almost identical to C. FT jejuni ORF TR:Q46115 (EMBL:X95910). 31.9% identity FT toHP0977. Contains probable N-terminal signal sequence" FT /note="Updated (2006) note: Literature search identified FT paper linking product function to glycoprotein. Functional FT classification - Miscellaneous periplasmic proteins" FT /note="PMID:12186869" FT /db_xref="GOA:Q0PAI5" FT /db_xref="InterPro:IPR008880" FT /db_xref="UniProtKB/TrEMBL:Q0PAI5" FT /protein_id="CAL34831.1" FT /translation="MLTWMQHHKKYLVVTIWVSTIAFVGAGFLGWGAYDFNLNRSSSVA FT TVGNEKIGFSEFDTRYRQILSYYNQISNGALTPENAEQLGIKNIALSSLVEDKLLLNFA FT KDLGIGVNENQILQKLANTREFQDPTGDFNKTIYYELLNANNLAPKDYETQLANEVITD FT KLNQIFNIPSKDEELKMLASSYFMQDALSIAKIDYDKKNIKINEEDLKKLWNEHKEDYK FT TKKIYEISTYFLPVSNEKIDDKELEKFYNQDENKLKYKDFAGKVMDFQSAKNEVAKDYA FT LMQLKNVANAKFLDLKNGKDNFQKDQNISESDVYYPIDLLNKAKNGDVLRPAPYNNGYI FT IVKLNKVDPIRNKTFEEAREEVLPMYLSEQARKNLEEKAKNSLVNFKGDDIGFVSRDSS FT RESVKVSDKILNDSEFAYFLMNVFNTDQNSSYVVINDNKAILYKINKQKLDMNSDKFEQ FT YKTMLEQNLQNLKANELKQELVDELKKIYPIKIYYKGN" FT misc_feature 651076..651144 FT /note="1 probable transmembrane helix predicted for Cj0694 FT by TMHMM2.0 at aa 12-34" FT /inference="protein motif:TMHMM:2.0" FT CDS 652530..653918 FT /transl_table=11 FT /gene="ftsA" FT /locus_tag="Cj0695" FT /product="cell division protein FtsA" FT /note="Original (2000) note: Cj0695, ftsA, probable cell FT division protein, len: 462; identical, except for a small FT frameshift, to C. jejuni ftsA TR:Q46116 (EMBL:X95910). FT Similar to many e.g. FTSA_ECOLI cell division protein FTSA FT (420 aa), fasta scores; opt: 570 z-score: 635.2 E(): FT 4.4e-28, 27.7% identity in 382 aa overlap. 37.2% identity FT to HP0978" FT /note="Updated (2006) note: Pfam domains PF02491 (x2) Cell FT division protein FtsA were identified within CDS. Further FT support given to product function. Characterisation work FT has been carried out within Campylobacter jejuni. Putative FT not added to product function. Functional classification FT -Cell division" FT /note="PMID:8807806" FT /db_xref="GOA:Q0PAI4" FT /db_xref="InterPro:IPR003494" FT /db_xref="InterPro:IPR020823" FT /db_xref="UniProtKB/TrEMBL:Q0PAI4" FT /inference="protein motif:Pfam:PF02491" FT /protein_id="CAL34832.1" FT /translation="MILNILGIDLGSTQTCAIIAQKDEDGLKIIGFSKSKTNGVKKGAI FT TNIELASKSIEEAVRSAEMMSGVHYDRVVVSISGAYTKSVDSIGVVNIPNHEIGIKEIH FT RAVSTAKHTANLPSGYEIIHVLPYNFKVNDLEHVDDPLGMSGNRLEVSTHIVISQESHI FT KNLKKAVELADLRVDNIVLSGYASAIACLDDSEKELGAVLIDMGGAICDMVVHTGNSIR FT YNDCLQIGSINITQDLSMALHTPLKEAEKIKLNYAALSQQPNTLIQIPSMGDERKVNEV FT SLDIISNVIYARAEETLMILAKILSDNRYANAIGGGVVLTGGMTKLAGIDELAPATFDN FT RSVRLATARKDLITGFSEIFNDPENTCAIGLCLYGAGYFTPYELDSNEKLRYKGEIENF FT NRQIKQDIVLQKDAESEIKSDFFDENLQENDTIAIQEQLDFKEPKEKKPSVFSNIWHKI FT MNQF" FT misc_feature 652542..653105 FT /note="HMMPfam hit to PF02491, Cell division protein FT FtsA,score 4.3e-31" FT /inference="protein motif:Pfam:PF02491" FT misc_feature 653070..653102 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 653109..653645 FT /note="HMMPfam hit to PF02491, Cell division protein FT FtsA,score 2.1e-21" FT /inference="protein motif:Pfam:PF02491" FT CDS 653934..655046 FT /transl_table=11 FT /gene="ftsZ" FT /locus_tag="Cj0696" FT /product="cell division protein FfsZ" FT /note="Original (2000) note: Cj0696, ftsZ, probable cell FT division protein, len: 370 aa; highly similar to many e.g. FT FTSZ_BACSU cell division protein FTSZ (382 aa), fasta FT scores; opt: 993 z-score: 1064.7 E(): 0, 45.9% identity in FT 340 aa overlap. 45.5% identity to HP0979. Contains PS01135 FT FtsZ protein signature 2" FT /note="Updated (2006) note: Pfam domains PF00091 FT Tubulin/FtsZ family, GTPase domain and PF03953 Tubulin/FtsZ FT family, C-terminal domain were identified within CDS. FT Further support given to product function. Characterised FT within Bacillus subtilis with acceptable identity score. FT Putative not added to product function. Functional FT classification - Cell division" FT /note="PMID:3139638" FT /db_xref="GOA:Q0PAI3" FT /db_xref="InterPro:IPR000158" FT /db_xref="InterPro:IPR003008" FT /db_xref="InterPro:IPR008280" FT /db_xref="InterPro:IPR018316" FT /db_xref="InterPro:IPR020805" FT /db_xref="InterPro:IPR024757" FT /db_xref="UniProtKB/TrEMBL:Q0PAI3" FT /inference="protein motif:Pfam:PF03953" FT /inference="protein motif:Pfam:PF00091" FT /inference="protein motif:Prosite:PS01135" FT /protein_id="CAL34833.1" FT /translation="MSEFLVEEMQHNKGAKIKVIGCGGGGGNMINHMVKMGLNDLDLIA FT ANTDAQAISISLAKTKIQLGEKKTKGLGAGMLPEVGAESARESFEEIKASLSQSDIVFI FT ASGFGGGTGTGATPVIAQAAKEIGALTVSVVTMPFAFEGKQRKKLAESGLLELKKESDS FT ILVIQNEKLLSIIDKKAGIKDAFRLVDDILARAVKGMVSILLDNGDINVDFADVRTIMS FT HRGLALMGVGSASGENAIEEALSNAIESPLLDGMDIKGAKGVILHFKTSSNCSLFEISA FT AANSIQEIVDENAKIIFGSTTDDSMEDRVEVTIIATGFEDKDTVAKKSTEEAQASKKNP FT YLSLKKVSGGYDEEIMAQIETPTFLRRQMD" FT misc_feature 653976..654557 FT /note="HMMPfam hit to PF00091, Tubulin/FtsZ family, GTPase FT domain, score 1.9e-81" FT /inference="protein motif:Pfam:PF00091" FT misc_feature 654231..654296 FT /note="PS01135 FtsZ protein signature 2" FT /inference="protein motif:Prosite:PS01135" FT misc_feature 654561..654929 FT /note="HMMPfam hit to PF03953, Tubulin/FtsZ FT family,C-terminal domain, score 4e-25" FT /inference="protein motif:Pfam:PF03953" FT CDS 655202..656014 FT /transl_table=11 FT /gene="flgG2" FT /locus_tag="Cj0697" FT /product="flagellar basal-body rod protein" FT /note="Original (2000) note: Cj0697, flgG2, probable FT flagellar basal-body rod protein, len: 270 aa; similar to FT e.g. FLGG_ECOLI flagellar basal-body rod protein FLGG (260 FT aa), fasta scores; opt: 290 z-score: 318.7 E(): FT 1.9e-10,28.7% identity in 272 aa overlap. 42.6% identity to FT HP1092. Also similar to downstream gene Cj0698 (flgG,29.9% FT identity in 281 aa overlap). Contains PS00588 Flagella FT basal body rod proteins signature and Pfam match to entry FT PF00460 flg_bb_rod, Flagella basal body rod proteins" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity score. FT Also,characterisation work within Campylobacter jejuni. FT Putative removed from product function. Functional FT classification - Surface structures" FT /note="PMID:9931471, PMID:15228533" FT /db_xref="GOA:Q0PAI2" FT /db_xref="InterPro:IPR001444" FT /db_xref="InterPro:IPR010930" FT /db_xref="InterPro:IPR019776" FT /db_xref="InterPro:IPR020013" FT /db_xref="UniProtKB/TrEMBL:Q0PAI2" FT /inference="protein motif:Pfam:PF00460" FT /inference="protein motif:Prosite:PS00588" FT /protein_id="CAL34834.1" FT /translation="MQNGYYQATGGMVTQFNKLDVITNNLANINTSGYKRDDVVIADFK FT RIFKETQDELPIENHTRDASRFVNTTIDGIPQVSQEYTDFSLGSLKATNNPLDLAMTRE FT DAFYLVQTKDGEVRLTKDGNFQLDDEGYLVNKQGYKVLSSDYFNNPQNAGIRIPNGAVQ FT ISVDKNGSIEVDGAQNARLFVAQVDDIRALQKDGDNVYKIDDLTRIRDLKNSNAIRQGF FT SQGSNVNPVTEMVGLIEANRMVEMYQKVMTAHMDDLNQEAINKLAAVK" FT misc_feature 655214..655306 FT /note="HMMPfam hit to PF00460, Flagella basal body rod FT protein, score 9.9e-09" FT /inference="protein motif:Pfam:PF00460" FT misc_feature 655232..655294 FT /note="PS00588 Flagella basal body rod proteins signature" FT /inference="protein motif:Prosite:PS00588" FT misc_feature 655877..655996 FT /note="HMMPfam hit to PF06429, Domain of unknown function FT (DUF1078), score 0.0011" FT /inference="protein motif:Pfam:PF06429" FT CDS 656043..656834 FT /transl_table=11 FT /gene="flgG" FT /locus_tag="Cj0698" FT /product="flagellar basal-body rod protein" FT /note="Original (2000) note: Cj0698, flgG, probable FT flagellar basal-body rod protein, len: 263 aa; highly FT similar to e.g. FLGG_ECOLI flagellar basal-body rod protein FT FLGG (260 aa), fasta scores; opt: 825 z-score: 886.8 E(): FT 0, 46.4% identity in 261 aa overlap. 62.0% identity to FT HP1585; also similar to upstream gene Cj0697 (flgG2, 29.4% FT identity in 279 aa overlap). Contains PS00588 Flagella FT basal body rod proteins signature and Pfam match to entry FT PF00460 flg_bb_rod, Flagella basal body rod proteins" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. FT Also,characterisation work within Campylobacter jejuni. FT Putative not added to product function. Functional FT classification - Surface structures" FT /note="PMID:9931471, PMID:15228533" FT /db_xref="GOA:Q0PAI1" FT /db_xref="InterPro:IPR001444" FT /db_xref="InterPro:IPR010930" FT /db_xref="InterPro:IPR012834" FT /db_xref="InterPro:IPR019776" FT /db_xref="InterPro:IPR020013" FT /db_xref="UniProtKB/TrEMBL:Q0PAI1" FT /inference="protein motif:Pfam:PF00460" FT /inference="protein motif:Prosite:PS00588" FT /protein_id="CAL34835.1" FT /translation="MMRSLHTAATGMVAQQTQIDVTSNNIANVNTAGFKKSRAEFADLM FT YQVMKYAGTSTSATTLSPSGIEVGVGVRPTAVTKVFTEGNLKSTSTDGLDMAIAGNGFF FT QIQLPDGTIGYTRNGQFTKDNEGNIVNSDGYRLLPEMTIPEGATAINVATDGTVSVMLP FT GEQQETQIGQVELVQFINPAGLHSMGDNLYLETGASGAPVAGIAGQDGLGTIRHGFIEL FT SNVQLVEEMTDLITGQRAYEAGSKAITTSDDMLGIVNQLKR" FT misc_feature 656055..656147 FT /note="HMMPfam hit to PF00460, Flagella basal body rod FT protein, score 5.6e-13" FT /inference="protein motif:Pfam:PF00460" FT misc_feature 656073..656135 FT /note="PS00588 Flagella basal body rod proteins signature" FT /inference="protein motif:Prosite:PS00588" FT misc_feature 656709..656825 FT /note="HMMPfam hit to PF06429, Domain of unknown function FT (DUF1078), score 1.2e-19" FT /inference="protein motif:Pfam:PF06429" FT CDS complement(656901..658331) FT /transl_table=11 FT /gene="glnA" FT /locus_tag="Cj0699c" FT /product="glutamine synthetase" FT /EC_number="6.3.1.2" FT /note="Original (2000) note: Cj0699c, glnA, probable FT glutamine synthetase, len: 476 aa; highly similar to many FT e.g. GLNA_ECOLI glutamine synthetase (EC 6.3.1.2) (468 aa), FT fasta scores; opt: 1529 z-score: 1812.8 E(): 0,51.5% FT identity in 462 aa overlap. 63.6% identity to HP0512. FT Contains PS00180 Glutamine synthetase signature 1,PS00181 FT Glutamine synthetase putative ATP-binding region signature, FT and Pfam match to entry PF00120 gln-synt" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Amino acid biosynthesis - Glutamate family" FT /note="PMID:2882477" FT /db_xref="GOA:Q0PAI0" FT /db_xref="InterPro:IPR004809" FT /db_xref="InterPro:IPR008146" FT /db_xref="InterPro:IPR008147" FT /db_xref="InterPro:IPR014746" FT /db_xref="UniProtKB/TrEMBL:Q0PAI0" FT /inference="protein motif:Pfam:PF00120" FT /inference="protein motif:Prosite:PS00181" FT /inference="protein motif:Prosite:PS00180" FT /protein_id="CAL34836.1" FT /translation="MGKFVNNIDDFFKFCKQNEVLFVDFRFTDMIGTWHHITYNLHAIN FT EETFQTGIPFDGSSIHGWQPIEKSDMILKPDAQSAFLDPFTADPTIIVFCDVYDIYKGQ FT MYEKCPRSIAKKAIEHLKNSGIADTAYFGPENEFFVFDSVKIVDTTHCSKYEVDTEEGE FT WNDDREFTDSYNTGHRPRNKGGYFPVQPIDSLVDIRSEMVQTLEKVGLKTFVHHHEVAQ FT GQAEIGVNFGTLVEAADNVQIYKYVVKMVAHLNGKTATFMPKPLYGDNGNGMHVHMSLW FT KNGVNLFYDKDGYSGLSQTAINYIGGILKNARSVAAFTNPSSNSYKRIVPGFEAPCILT FT YSCQNRSASCRVPYGIGKNSARIEIRFPDSTANPYLAFVSLLMAGLDGIKNKTIPVGPM FT DENLFDLTLDEIREKGIEQLPHTLRGSLEALIRHNSYLKPVMSDIFIDDYQHLKFETQV FT WPVEARPTAYEFKTCYSC" FT misc_feature complement(657165..658013) FT /note="HMMPfam hit to PF00120, Glutamine FT synthetase,catalytic domain, score 8.5e-160" FT /inference="protein motif:Pfam:PF00120" FT misc_feature complement(657495..657542) FT /note="PS00181 Glutamine synthetase putative ATP-binding FT region signature" FT /inference="protein motif:Prosite:PS00181" FT misc_feature complement(658029..658277) FT /note="HMMPfam hit to PF03951, Glutamine FT synthetase,beta-Grasp domain, score 6e-42" FT /inference="protein motif:Pfam:PF03951" FT misc_feature complement(658113..658169) FT /note="PS00180 Glutamine synthetase signature 1" FT /inference="protein motif:Prosite:PS00180" FT CDS 658534..659229 FT /transl_table=11 FT /locus_tag="Cj0700" FT /product="hypothetical protein Cj0700" FT /note="Original (2000) note: Cj0700, unknown, len: 231 aa; FT 49.4% identity to HP0170. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAH9" FT /protein_id="CAL34837.1" FT /translation="MTQEELDALMNGDVDLDSETEAEVKTEESNTEEDALMLEDVKIAD FT YKPNPSVVWPPPPPNQEHKVVHQLDDVTKDSELKATEMMDKLESINNFFADSESLLKEI FT NKAIEKNIDIFSKLNEKFPNVESFSEALELNNQAKKSSKEIVGNLQSGQDEVMMAMDAM FT QYQDIHRQKIERVINVMRALSRYMSSLFEGKIDDKKRVSSAVHIEGDSTADVVSNDDIE FT ALIASLGQK" FT CDS 659226..660479 FT /transl_table=11 FT /locus_tag="Cj0701" FT /product="putative protease" FT /note="Original (2000) note: Cj0701, probable protease,len: FT 417 aa; similar to many putative proteases belonging to the FT peptidase family U32, e.g. YEGQ_ECOLI putative protease in FT baer-ogrk intergenic Region (453 aa), fasta scores; opt: FT 567 z-score: 648.6 E(): 7.9e-29, 34.9% identity in 404 aa FT overlap. 55.5% identity to HP0169. Contains PS01276 FT Peptidase family U32 signature and Pfam match to entry FT PF01136 Peptidase_U32" FT /note="Updated (2006) note: Similar to many with marginal FT identity scores. Putative kept within product function. FT Functional classification - Degradation of macromolecules - FT Proteins, peptides and glycopeptides" FT /db_xref="GOA:Q0PAH8" FT /db_xref="InterPro:IPR001539" FT /db_xref="InterPro:IPR013785" FT /db_xref="UniProtKB/TrEMBL:Q0PAH8" FT /inference="protein motif:Pfam:PF01136" FT /inference="protein motif:Prosite:PS01276" FT /protein_id="CAL34838.1" FT /translation="MIIPEIVAPAGNFTKLKIALAYGADAVYAGVNNFSLRSRTAREFN FT YESFEEAIKYTHERGKKIYVTLNGFHLSSQIEGLKRHILKLREMKPDAFIVASVGAMRL FT VKELAPEISLHVSTQANILNYLDAQVYKDMGAKRVVIARELGLKDAKALKENCDIELEA FT FVHGSMCFAYSGRCLISSVQSGRMSNRGSCANDCRFNYELYAKNPENGTLFRLEEDENG FT THIFNSKDLNLCSYIEKIMQENCISAFKIEGRTKSEYYVALTTRTYKMAIQDALEGKFE FT SSKYEKEIATLKNRGFTDGYLVSRPLEKTDTQNHNTSIEEGSHQVHAISEDGRFFKCKG FT KIVLNTPYEILTPLGDVIQTCDNELGKIYQKEGKYFIEFKKLIAKNNKEFSEIHSGNEH FT EIQLPNKISALSFLRKEI" FT misc_feature 659451..660149 FT /note="HMMPfam hit to PF01136, Peptidase family U32, score FT 8.5e-117" FT /inference="protein motif:Pfam:PF01136" FT misc_feature 659709..659765 FT /note="PS01276 Peptidase family U32 signature" FT /inference="protein motif:Prosite:PS01276" FT CDS 660480..660974 FT /transl_table=11 FT /gene="purE" FT /locus_tag="Cj0702" FT /product="phosphoribosylaminoimidazole carboxylase FT catalytic subunit" FT /EC_number="4.1.1.21" FT /note="Original (2000) note: Cj0702, purE, probable FT phosphoribosylaminoimidazole carboxylase catalytic subunit, FT len: 164 aa; similar to many e.g. PUR6_ECOLI FT phosphoribosylaminoimidazole carboxylase catalytic subunit FT (EC 4.1.1.21) (168 aa), fasta scores; opt: 485 z-score: FT 562.6 E(): 4.9e-24, 55.2% identity in 143 aa overlap. No Hp FT match. Contains Pfam match to entry PF00731 AIRC, AIR FT carboxylase" FT /note="Updated (2006) note: Characterised within FT Escherichia coli and Bacillus subtilus with acceptable FT identity scores. Putative not added to product function. FT Functional classification - Purine ribonucleotide FT biosynthesis" FT /note="PMID:10074353, PMID:2464576" FT /db_xref="GOA:Q0PAH7" FT /db_xref="InterPro:IPR000031" FT /db_xref="InterPro:IPR024694" FT /db_xref="UniProtKB/TrEMBL:Q0PAH7" FT /inference="protein motif:Pfam:PF00731" FT /protein_id="CAL34839.1" FT /translation="MNFVSILMGSKSDYETMKEAAKTLESFGVKYELIISSAHRSPKRT FT KEYIANAEEKGVKVFIAAAGMAAHLAGAVAAYTTKPVLGVPMSGSNLASMDSLFSTVQM FT PSGIPVGTLAIGKAGAINAAYLAMQILAIYDVDLAQKLKEDRLEKEKKLVSDSKEVEVL FT L" FT misc_feature 660489..660959 FT /note="HMMPfam hit to PF00731, AIR carboxylase, score FT 1.1e-72" FT /inference="protein motif:Pfam:PF00731" FT CDS 660984..661520 FT /transl_table=11 FT /locus_tag="Cj0703" FT /product="hypothetical protein Cj0703" FT /note="Original (2000) note: Cj0703, unknown, len: 178 aa; FT 51.0% identity to HP0406. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAH6" FT /protein_id="CAL34840.1" FT /translation="MQTYLELEEFCKLVHLNEDVVKGMMANGALNFKEEEGKIYIEAHQ FT GTFSVVPSSAKSQTAMVNSMTLAGESFVEKTIGTILNLHEKVLDAKDETLEALKNENKF FT LKDALYSMQELYDEDRKTIETLNNELKHAREEIEFLKRKYKLMWSKTAEIFGAKTEPDL FT EMNKNLEKPIENMEQ" FT CDS 661532..662395 FT /transl_table=11 FT /gene="glyQ" FT /locus_tag="Cj0704" FT /product="glycyl-tRNA synthetase alpha chain" FT /EC_number="6.1.1.14" FT /note="Original (2000) note: Cj0704, glyQ, probable FT glycyl-tRNA synthetase alpha chain, len: 287 aa; similar to FT many e.g. SYGA_ECOLI glycyl-tRNA synthetase alpha chain (EC FT 6.1.1.14) (303 aa), fasta scores; opt: 1228 z-score: 1442.3 FT E(): 0, 66.1% identity in 280 aa overlap. 69.1% identity to FT HP0960. Contains PS00339 Aminoacyl-transfer RNA synthetases FT class-II signature 2" FT /note="Updated (2006) note: Pfam domain PF02091 Glycyl-tRNA FT synthetase alpha subunit identified within CDS. Further FT support given to product function. Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification - FT Aminoacyl tRNA synthetases and their modification" FT /db_xref="GOA:Q9PPK3" FT /db_xref="InterPro:IPR002310" FT /db_xref="InterPro:IPR006194" FT /db_xref="PDB:3RGL" FT /db_xref="PDB:3UFG" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPK3" FT /inference="protein motif:Pfam:PF02091" FT /inference="protein motif:Prosite:PS00339" FT /protein_id="CAL34841.1" FT /translation="MTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGK FT KPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLK FT SHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLER FT IAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYK FT ECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKK FT NLNEAE" FT misc_feature 661538..662392 FT /note="HMMPfam hit to PF02091, Glycyl-tRNA synthetase alpha FT subunit, score 4.8e-203" FT /inference="protein motif:Pfam:PF02091" FT misc_feature 662003..662032 FT /note="PS00339 Aminoacyl-transfer RNA synthetases class-II FT signature 2" FT /inference="protein motif:Prosite:PS00339" FT CDS 662382..663107 FT /transl_table=11 FT /locus_tag="Cj0705" FT /product="conserved hypothetical protein Cj0705" FT /note="Original (2000) note: Cj0705, unknown, len: 241 aa; FT similar to hypothetical proteins e.g. TR:O51424 FT (EMBL:AE001151) Borrelia burgdorferi BB0468 (248 aa),fasta FT scores; opt: 240 z-score: 292.4 E(): 5.5e-09, 27.0% FT identity in 244 aa overlap. 42.7% identity to HP0959" FT /note="Updated (2006) note: Pfam domain PF01784 NIF3 (NGG1p FT interacting factor 3) identified within CDS. Conserved FT added to product function. Functional classification - FT Conserved hypothetical proteins" FT /db_xref="InterPro:IPR002678" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPK2" FT /inference="protein motif:Pfam:PF01784" FT /protein_id="CAL34842.1" FT /translation="MKLSEIYNFLDQLSPFNIQESWDNSGILLGDRDSEISTVYLSLDI FT DENIIKEASENSLIITHHPLIFKGLKDLYDKTYPRAFIKEMIYKNISLISMHTNYDLSH FT LNTYFTEEILGFKISFKDKFLIYVENSMSFEALCDWVKKKLNLQILRVSDCGKKDIKRI FT AICTGSGGDLISKVDADCFLSGDFKYHQALEALSNQISLIDLGHFESERYFSQCLAKDL FT KNLPLQVIITVSKNPFQYF" FT misc_feature 662409..663083 FT /note="HMMPfam hit to PF01784, NIF3 (NGG1p interacting FT factor 3), score 3.6e-81" FT /inference="protein motif:Pfam:PF01784" FT CDS 663117..663833 FT /transl_table=11 FT /locus_tag="Cj0706" FT /product="conserved hypothetical protein Cj0706" FT /note="Original (2000) note: Cj0706, unknown, len: 238 aa; FT similar to hypothetical proteins e.g. TR:O67273 FT (EMBL:AE000729) Aquifex aeolicus AQ_1223 (235 aa), fasta FT scores; opt: 298 z-score: 287.3 E(): 1.1e-08, 30.1% FT identity in 236 aa overlap. 37.4% identity to HP0958" FT /note="Updated (2006) note: Pfam domain PF02591 FT Uncharacterized ACR, COG1579 identified within CDS. FT Conserved added to product function. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="GOA:Q0PAH3" FT /db_xref="InterPro:IPR003743" FT /db_xref="UniProtKB/TrEMBL:Q0PAH3" FT /inference="protein motif:Pfam:PF02591" FT /protein_id="CAL34843.1" FT /translation="MNKYLEQLVLLSKIDQEIDSYEPKIDSINKTLKDAELKIEKINAD FT LEKIDEEIKDIENQKIQNNAHISEFSAKIKDLSKKSGVVKTEKEANALKIEEDIAKEQL FT DAANDEIVRLDKILENKETYKKELEEEKIKQEQNINEIRVSIKSEMEVLEKDRMSVYDK FT KTKLVSEMNQKVLSFYEKIRKWAKNTAVVPVKKQACYGCFMKIYDKTYLSVVKGEEIVT FT CPHCGRILYKEQEEQN" FT misc_feature 663117..663818 FT /note="HMMPfam hit to PF02591, Uncharacterized ACR,COG1579, FT score 8.4e-50" FT /inference="protein motif:Pfam:PF02591" FT CDS 663830..664987 FT /transl_table=11 FT /gene="kdtA" FT /locus_tag="Cj0707" FT /product="3-deoxy-D-manno-octulosonic-acid transferase" FT /note="Original (2000) note: Cj0707, kdtA, probable FT 3-deoxy-D-manno-octulosonic-acid transferase, len: 385 aa; FT similar to many e.g. KDTA_ECOLI FT 3-deoxy-D-manno-octulosonic-acid transferase (425 aa),fasta FT scores; opt: 186 z-score: 218.1 E(): 7.5e-05, 31.0% FT identity in 339 aa overlap. 45.7% identity to HP0957" FT /note="Updated (2006) note: Pfam domain PF04413 FT 3-Deoxy-D-manno-octulosonic-acid transferase identified FT within CDS. Also two probable transmembrane helices FT predicted by TMHMM2.0. Further support given to product FT function. Putative not added to product function. FT Functional classification - Surface FT polysaccharides,lipopolysaccharides and antigens" FT /note="PMID:10952982, PMID:1577828, PMID:7499229" FT /db_xref="GOA:Q0PAH2" FT /db_xref="InterPro:IPR007507" FT /db_xref="UniProtKB/TrEMBL:Q0PAH2" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF04413" FT /protein_id="CAL34844.1" FT /translation="MIFFYYFLTWTAFLFCAVFILLLSFLKSKYKISLKSRFFLYKNLH FT QEKADVHFHACSYGEVRSIKALVLKFDSRITTITQTGFECAKEFCKKVNYLAFENFLPF FT WLKPCKVLVIFEAEYWLMLVFMARIYKAKIILLNARISDKSYHSYQRFSFFYKKIFSYI FT DEVFAQSDLDKARLESLGAKNVKIFKNIKANLEIKNNKIYTKPKEKLIIFASTHKDEEE FT LLLDHFKLEENEKLIIAPRHPERFKEVENLLLNKGLEFEKFSSLKDENKKFSKKILLLD FT ALGELVNFYAISDVVVLGGSFIEGIGGHNPIEAAYFDNVLISGKFIHNQKVLFEEVENV FT YFCEKLKDLNDKVHYLNLKAKISKKENLDLIIQTIQKGIDARKSL" FT sig_peptide 663830..663907 FT /note="Signal peptide predicted for kdtA by SignalP 2.0 HMM FT (Signal peptide probability 0.942) with cleavage site FT probability 0.414 between residues 26 and 27" FT misc_feature order(663839..663907,664160..664219) FT /note="2 probable transmembrane helices predicted for FT Cj0707 by TMHMM2.0 at aa 4-26 and 111-130" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 663917..664444 FT /note="HMMPfam hit to FT PF04413,3-Deoxy-D-manno-octulosonic-acid tran, score FT 7.3e-80" FT /inference="protein motif:Pfam:PF04413" FT CDS 664968..665720 FT /transl_table=11 FT /locus_tag="Cj0708" FT /product="putative ribosomal pseudouridine synthase" FT /EC_number="4.2.1.70" FT /note="Original (2000) note: Cj0708, possible ribosomal FT pseudouridine synthase, len: 250 aa; similar to many FT hypothetical proteins and to e.g. RLUC_ECOLI ribosomal FT large subunit pseudouridine synthase D (EC 4.2.1.70) (319 FT aa), fasta scores; opt: 202 z-score: 252.9 E(): FT 8.6e-07,29.7% identity in 175 aa overlap. 47.0% identity to FT HP0956. Contains PS01129 Hypothetical yabO/yceC/sfhB family FT signature and Pfam match to entry PF00849 YABO,Hypothetical FT yabO/yceC/sfhB family. Also similar to Cj1280c (26.9% FT identity in 223 aa overlap) and Cj0022c (27.6% identity in FT 275 aa overlap)" FT /note="Updated (2006) note: Pfam domain now updated to RNA FT pseudouridylate synthase. No specific characterisation with FT acceptable identity score carried out yet. Putative kept FT within product function. Functional classification FT -Ribosome maturation and modification" FT /note="PMID:10089432" FT /db_xref="GOA:Q0PAH1" FT /db_xref="InterPro:IPR006145" FT /db_xref="InterPro:IPR006224" FT /db_xref="InterPro:IPR020103" FT /db_xref="UniProtKB/TrEMBL:Q0PAH1" FT /inference="protein motif:Pfam:PF00849" FT /inference="protein motif:Prosite:PS01129" FT /protein_id="CAL34845.1" FT /translation="MQEKAYKLLALQEKISNREAKDLIDKGCVFSYGKKVVVARALMSD FT KARFNVIKAKNPQIIFEDDKIIAINKPYAYVSEDLEKKFNAKLLNRLDKETSGVILLCK FT DEDFRKLCIEEFKKHRVYKSYIAVLDGVLAEEVEVNEPIFTIKVKGGALSKVSKDGLSA FT LSIITPIMMQSKKTLAKIVIQTGRTHQIRVHAKFIKHGVVGDEKYAKISSDRMYLHSYE FT IKIFNYHFRANLDSGFAKFGFDIKNLDF" FT misc_feature 665160..665558 FT /note="HMMPfam hit to PF00849, RNA pseudouridylate FT synthase, score 1.7e-20" FT /inference="protein motif:Pfam:PF00849" FT misc_feature 665232..665276 FT /note="PS01129 Rlu family of pseudouridine synthase FT signature" FT /inference="protein motif:Prosite:PS01129" FT CDS 665788..667125 FT /transl_table=11 FT /gene="ffh" FT /locus_tag="Cj0709" FT /product="signal recognition particle protein" FT /note="Original (2000) note: Cj0709, ffh, probable signal FT recognition particle protein, len: 445 aa; highly similar FT to many e.g. SR54_ECOLI signal recognition particle protein FT (453 aa), fasta scores; opt: 1136 z-score: 1195.2 E(): 0, FT 41.5% identity in 441 aa overlap. 61.0% identity to HP1152. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop), FT PS00300 SRP54-type proteins GTP-binding domain signature, FT and Pfam match to entry PF00448 SRP54,SRP54-type protein" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Protein and peptide secretion" FT /note="PMID:1331806, PMID:11976293" FT /db_xref="GOA:Q0PAH0" FT /db_xref="InterPro:IPR000897" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR004125" FT /db_xref="InterPro:IPR004780" FT /db_xref="InterPro:IPR013822" FT /db_xref="UniProtKB/TrEMBL:Q0PAH0" FT /inference="protein motif:Pfam:PF00448" FT /inference="protein motif:Prosite:PS00300" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34846.1" FT /translation="MFELVSESFKSAINKLRFVDDEKALKNALETLKKALLKADVHHKV FT TKELLTLIEEDAKQNGIGQKQFLNAIKINLENILSVNGKNQGFVFASKPPTVVLMAGLQ FT GGGKTTSTIKLANYLKLRNKKVLVAACDLQRLAAVEQLRQLCEANEIELFFIENEKDPI FT RVAKEALKKAESSMVDVLLVDTAGRLAIDEALMDELRAVKDVLNPDEIFYVADAMSGQD FT GVKTAASFNEVLGISGVILSKFDADTKGGVALGIAKQIGIPLRFIGVGEKVADLEVFIP FT DRIVSRIMGEGDLATLAEKTAAIIDEKEAKKLNQKIKKGEFNFNDFLNQMESIKKLGSM FT KSLIGMIPGLGGMANAVKDIDLDNSKEIIRIKAMISSMTPKERENPDLLNNARKRRIAE FT GAGLSQVEVNRFLKQFSNAAKLAKRFSGKKGMESLTQMMSQARRQF" FT misc_feature 665791..666027 FT /note="HMMPfam hit to PF02881, SRP54-type protein, helical FT bundle domain, score 2.4e-08" FT /inference="protein motif:Pfam:PF02881" FT misc_feature 666067..666657 FT /note="HMMPfam hit to PF00448, SRP54-type protein, GTPase FT domain, score 9.5e-103" FT /inference="protein motif:Pfam:PF00448" FT misc_feature 666091..666114 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 666574..666615 FT /note="PS00300 SRP54-type proteins GTP-binding domain FT signature" FT /inference="protein motif:Prosite:PS00300" FT misc_feature 666748..667053 FT /note="HMMPfam hit to PF02978, Signal peptide binding FT domain, score 4.4e-45" FT /inference="protein motif:Pfam:PF02978" FT stem_loop 667124..667169 FT CDS 667190..667417 FT /transl_table=11 FT /gene="rpsP" FT /locus_tag="Cj0710" FT /product="30S ribosomal protein S16" FT /note="Original (2000) note: Cj0710, rpsP, 30S ribosomal FT protein S16, len: 75 aa; highly similar to many e.g. FT RS16_ECOLI 30S ribosomal protein S16 (82 aa), fasta scores; FT opt: 238 z-score: 352.6 E(): 2.4e-12, 45.9% identity in 74 FT aa overlap. 73.3% identity to HP1151. Contains PS00732 FT Ribosomal protein S16 signature, and Pfam match to entry FT PF00886 Ribosomal_S16" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Ribosomal protein synthesis and modification" FT /note="PMID:336510" FT /db_xref="GOA:Q9PPJ7" FT /db_xref="InterPro:IPR000307" FT /db_xref="InterPro:IPR020592" FT /db_xref="InterPro:IPR023803" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPJ7" FT /inference="protein motif:Pfam:PF00886" FT /inference="protein motif:Prosite:PS00732" FT /protein_id="CAL34847.1" FT /translation="MTVIRLTRMGRTKRPFYRIVVTDSRKRRDGGWIESIGYYNPMVEP FT EVIKVDAERLAYWKSVGAKLSDKVASITSK" FT misc_feature 667193..667222 FT /note="PS00732 Ribosomal protein S16 signature" FT /inference="protein motif:Prosite:PS00732" FT misc_feature 667211..667387 FT /note="HMMPfam hit to PF00886, Ribosomal protein S16,score FT 5.6e-33" FT /inference="protein motif:Pfam:PF00886" FT CDS 667420..667662 FT /transl_table=11 FT /locus_tag="Cj0711" FT /product="hypothetical protein Cj0711" FT /note="Original (2000) note: Cj0711, unknown, len: 80 aa; FT simlar to small hypothetical proteins downstream of rpsP in FT many organisms e.g. TR:O31738 (EMBL:Z99112) Bacillus FT subtilis YLQC (81 aa), fasta scores; opt: 115 z-score: FT 178.5 E(): 0.012, 32.3% identity in 62 aa overlap. 37.7% FT identity to HP1150. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAG8" FT /protein_id="CAL34848.1" FT /translation="MVENFLREYAKLIADYPEQIDTQKIELSENFFEIVLFAHKVDTGK FT LIGKNGKMINAIKTVISAYKSKDASSYRVTVKALE" FT CDS 667655..668194 FT /transl_table=11 FT /gene="rimM" FT /locus_tag="Cj0712" FT /product="putative 16S rRNA processing protein" FT /note="Original (2000) note: Cj0712, rimM, possible 16S FT rRNA processing protein, len: 179 aa; similar to e.g. FT RIMM_ECOLI 16S rRNA processing protein RIMM (185 aa),fasta FT scores; opt: 202 z-score: 255.1 E(): 6.6e-07, 24.1% FT identity in 174 aa overlap. 37.8% identity to HP1149" FT /note="Updated (2006) note: Pfam domains PF01782 RimM FT N-terminal domain and PF05239 PRC-barrel domain were FT identified within CDS. Further support given to product FT function. Characterised within Escherichia coli with FT marginal identity score. Putative kept within product FT function. Functional classification - Ribosome maturation FT and modification" FT /note="PMID:9422595" FT /db_xref="GOA:Q9PPJ5" FT /db_xref="InterPro:IPR002676" FT /db_xref="InterPro:IPR007903" FT /db_xref="InterPro:IPR009000" FT /db_xref="InterPro:IPR011033" FT /db_xref="InterPro:IPR011961" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPJ5" FT /inference="protein motif:Pfam:PF05239" FT /inference="protein motif:Pfam:PF01782" FT /protein_id="CAL34849.1" FT /translation="MSEKDFVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNT FT KEMLKIKHYNANNSTVLFENYEDIEKAKELTNLILFQSIEKSRQTCKLKKDEFFYFDIL FT ECEVFEEDKRLGKVVDILETGASYLFEIQSDEKWVEKKYPKIFFIPYLDKFVKNIDIEK FT RQIFCTQDAFLILENS" FT misc_feature 667676..667912 FT /note="HMMPfam hit to PF01782, RimM N-terminal domain,score FT 2.2e-20" FT /inference="protein motif:Pfam:PF01782" FT misc_feature 667937..668179 FT /note="HMMPfam hit to PF05239, PRC-barrel domain, score FT 1.2e-15" FT /inference="protein motif:Pfam:PF05239" FT CDS 668191..668895 FT /transl_table=11 FT /gene="trmD" FT /locus_tag="Cj0713" FT /product="tRNA (guanine-N1)-methyltransferase" FT /EC_number="2.1.1.31" FT /note="Original (2000) note: Cj0713, trmD, probable tRNA FT (guanine-N1)-methyltransferase, len: 234 aa; similar to FT many e.g. TRMD_ECOLI tRNA (guanine-N1)-methyltransferase FT (EC 2.1.1.31) (255 aa), fasta scores; opt: 541 z-score: FT 674.0 E(): 3e-30, 34.6% identity in 228 aa overlap. 53.7% FT identity to HP1148" FT /note="Updated (2006) note: Pfam domains PF01746 tRNA FT (Guanine-1)-methyltransferase was identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli with marginal identity score. FT Putative not added to product function. Functional FT classification - Aminoacyl tRNA synthetases and their FT modification" FT /db_xref="GOA:Q9PPJ4" FT /db_xref="InterPro:IPR002649" FT /db_xref="InterPro:IPR016009" FT /db_xref="InterPro:IPR023148" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPJ4" FT /inference="protein motif:Pfam:PF01746" FT /protein_id="CAL34850.1" FT /translation="MKFSFVSLFPNLMEFYFQDSILARAKEKKLFKLNFYNPRDFSKNS FT YHKVDDYKIGGGAGLLMQAEPMYEVLRSIQEKKENPYFIFLNPSGKTFNQKDAKRLSKK FT EHIVFVCGRYEGIDERVLEIFANEVFSIGDFILTGGELPALVMCDAILRNVNGVLGNME FT SLEEESFENNLLEAPAFSKPFIFEKKNKKFYTPSEFLKGNHARIASLKTTLASCKTKFF FT RPDLFLEHERKK" FT misc_feature 668254..668892 FT /note="HMMPfam hit to PF01746, tRNA FT (Guanine-1)-methyltransferase, score 1.3e-82" FT /inference="protein motif:Pfam:PF01746" FT CDS 668906..669262 FT /transl_table=11 FT /gene="rplS" FT /locus_tag="Cj0714" FT /product="50S ribosomal protein L19" FT /note="Original (2000) note: Cj0714, rplS, 50S ribosomal FT protein L19, len: 118 aa; highly similar to many e.g. FT RL19_ECOLI 50S ribosomal protein L19 (114 aa), fasta FT scores; opt: 362 z-score: 475.0 E(): 3.7e-19, 51.8% FT identity in 110 aa overlap. 71.8% identity to HP1147. FT Contains Pfam match to entry PF01245 Ribosomal_L19" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Aminoacyl tRNA synthetases and their modification" FT /note="PMID:339951" FT /db_xref="GOA:Q9PPJ3" FT /db_xref="InterPro:IPR001857" FT /db_xref="InterPro:IPR008991" FT /db_xref="InterPro:IPR018257" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPJ3" FT /inference="protein motif:Pfam:PF01245" FT /protein_id="CAL34851.1" FT /translation="MKNKYIEQFEAKQIEGKNVPDFRAGDTLKLAIRIKEGDKTRIQNF FT EGICIARRGNGVSETFIVRKIGANNVGVERIFPIYSESLESITVLRRGRVRRARLFYLR FT DRRGKAARIKELKK" FT misc_feature 668912..669256 FT /note="HMMPfam hit to PF01245, Ribosomal protein L19,score FT 5.1e-63" FT /inference="protein motif:Pfam:PF01245" FT CDS 669395..669808 FT /transl_table=11 FT /locus_tag="Cj0715" FT /product="transthyretin-like periplasmic protein" FT /note="Original (2000) note: Cj0715, transthyretin-like FT periplasmic protein, len: 137 aa; similar to members of the FT transthyretin family e.g. YEDX_ECOLI hypothetical FT transthyretin-like protein precursor (137 aa), fasta FT scores; opt: 305 z-score: 409.7 E(): 1.6e-15, 38.9% FT identity in 126 aa overlap, and TTHY_BOVIN Cow FT transthyretin precursor (prealbumin) (147 aa), fasta FT scores; opt: 205 z-score: 279.8 E(): 2.8e-08, 33.8% FT identity in 142 aa overlap. No Hp match. Contains Pfam FT match to entry PF00576 Transthyretin and probable FT N-terminal signal sequence" FT /note="Updated (2006) note: Prosite domains PS00768 FT TRANSTHYRETIN_1, Transthyretin and PS00769 TRANSTHYRETIN_2, FT Transthyretin were identified within CDS. Further support FT given to product function. No specific characterisation FT with acceptable identity score carried out yet. Product FT function unchanged. Functional classification - FT Miscellaneous periplasmic proteins" FT /note="PMID:12186869" FT /db_xref="GOA:Q0PAG4" FT /db_xref="InterPro:IPR000895" FT /db_xref="InterPro:IPR014306" FT /db_xref="InterPro:IPR023416" FT /db_xref="InterPro:IPR023418" FT /db_xref="InterPro:IPR023419" FT /db_xref="UniProtKB/TrEMBL:Q0PAG4" FT /inference="protein motif:Pfam:PF00576" FT /inference="protein motif:Prosite:PS00769" FT /inference="protein motif:Prosite:PS00768" FT /protein_id="CAL34852.1" FT /translation="MFSIKKTLLILASVPMFLSATEYQLSTHVLDITSGQPAPKVKVEL FT YKLEANQQWKKVSEEFTEENGRIGDLLPYEKAENRAFGIYKLKFFTKDYYTSHKINTFY FT PFVEVSFELSKDQKHYHVPITLSPFGYSTYRGS" FT sig_peptide 669395..669451 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000331_669395_669808 by SignalP 2.0 FT HMM (Signal peptide probability 0.970) with cleavage site FT probability 0.273 between residues 19 and 20" FT misc_feature 669461..669802 FT /note="HMMPfam hit to PF00576, Transthyretin precursor FT (formerly preal, score 7.3e-62" FT /inference="protein motif:Pfam:PF00576" FT misc_feature 669476..669523 FT /note="PS00768 Transthyretin signature 1" FT /inference="protein motif:Prosite:PS00768" FT misc_feature 669752..669790 FT /note="PS00769 Transthyretin signature 2" FT /inference="protein motif:Prosite:PS00769" FT CDS 669832..671172 FT /transl_table=11 FT /locus_tag="Cj0716" FT /product="putative phospho-2-dehydro-3-deoxyheptonate FT aldolase" FT /EC_number="2.5.1.54" FT /note="Original (2000) note: Cj0716, probable FT phospho-2-dehydro-3-deoxyheptonate aldolase, len: 446 aa; FT similar to enzymes from plants e.g. AROF_ARATH FT phospho-2-dehydro-3-deoxyheptonate aldolase (EC 4.1.2.15) FT (525 aa), fasta scores; opt: 1680 z-score: 1935.9 E(): FT 0,54.2% identity in 445 aa overlap. 59.6% identity to FT HP0134" FT /note="Updated (2006) note: Pfam domain PF01474 Class-II FT DAHP synthetase family identified within CDS. Product FT function kept the same (along with putative), as no FT specific characterisation within related bacteria has been FT carried out. Functional classification - Amino acid FT biosynthesis - Aromatic amino acid family" FT /db_xref="GOA:Q0PAG3" FT /db_xref="InterPro:IPR002480" FT /db_xref="UniProtKB/TrEMBL:Q0PAG3" FT /inference="protein motif:Pfam:PF01474" FT /protein_id="CAL34853.1" FT /translation="MWAKNSWKNYPIKQQPIYPDQEEMNRVLARLEKLPPLVFAGEVRN FT LQKSLARVCKKEAFLLQGGDCAESFENFGAVNIRDMFKILLQMAIVLTFAGGCPVIKIG FT RIAGQFAKPRSSDFEELDGISLPSYRGDIINGFEFSEQARIPDPHRMLEAYYQSAITLN FT LLRGFAKGGLADLHEVHRWNLGFLKKSELHKQYTDISEKISQALAFMEACGINTSNTPS FT LREVSVYTSHEALLLPYEEALTRVDSLSGEIYDCSAHMLWIGERTRALDEAHVHFLSGV FT KNPLGVKIGPSASADDIIALANVLNPNNEEGRLNIIIRMGADKIINNLPKIFSKLKSEG FT LNLVYSIDPMHGNTVKAGNFKTREFDKIMQEVRSFFEIAISEGVYPGGVHLEMTGKDVT FT ECTGGASNVTAQSLEDRYETQCDPRLNADQALELAFLIADLVKKTRK" FT misc_feature 669832..671145 FT /note="HMMPfam hit to PF01474, Class-II DAHP synthetase FT family, score 8.4e-246" FT /inference="protein motif:Pfam:PF01474" FT misc_feature 670093..670125 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 671169..671498 FT /transl_table=11 FT /locus_tag="Cj0717" FT /product="putative ArsC family protein" FT /note="Original (2000) note: Cj0717, unknown, len: aa; FT similar to hypothetical proteins e.g. YFFB_ECOLI (118 FT aa),fasta scores; opt: 164 z-score: 215.8 E(): 0.0001, FT 32.3% identity in 93 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF03960 ArsC family FT identified within CDS. Product modified to more specific FT family member due to motif match. ArsC is thought to FT catalyze the reduction of arsenate to arsenite. No specific FT characterisation has been carried out. Putative kept within FT product function. Functional classification -Misc" FT /note="PMID:1704144" FT /db_xref="InterPro:IPR006660" FT /db_xref="InterPro:IPR012336" FT /db_xref="UniProtKB/TrEMBL:Q0PAG2" FT /inference="protein motif:Pfam:PF03960" FT /protein_id="CAL34854.1" FT /translation="MKLYGIKNCNSVKKAMDALTQKGIVFDFMDIKKINQDILYTWLKQ FT KSFEELINTAGLTSKKLGLNKEKVKNLNEKELEKIVLENPSCIKRPIIEYEQNIYIGKE FT YEKML" FT misc_feature 671178..671489 FT /note="HMMPfam hit to PF03960, ArsC family, score 6.9e-34" FT /inference="protein motif:Pfam:PF03960" FT CDS 671946..675548 FT /transl_table=11 FT /gene="dnaE" FT /locus_tag="Cj0718" FT /product="DNA polymerase III, alpha chain" FT /EC_number="2.7.7.7" FT /note="Original (2000) note: Cj0718, dnaE, probable DNA FT polymerase III, alpha chain, len: 1200 aa; similar to many FT e.g. DP3A_ECOLI DNA polymerase III, alpha chain (EC FT 2.7.7.7) (1160 aa), fasta scores; opt: 2115 z-score: 2263.1 FT E(): 0, 40.6% identity in 1087 aa overlap. 52.7% identity FT to HP1460" FT /note="Updated (2006) note: Pfam domain PF07733 Bacterial FT DNA polymerase III alpha subunit identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli with acceptable identity score. FT Putative not added to product function. Functional FT classification - DNA replication,restriction/modification, FT recombination and repair" FT /note="PMID:8375647" FT /db_xref="GOA:Q9PPI9" FT /db_xref="InterPro:IPR003141" FT /db_xref="InterPro:IPR004013" FT /db_xref="InterPro:IPR004805" FT /db_xref="InterPro:IPR011708" FT /db_xref="InterPro:IPR016195" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPI9" FT /inference="protein motif:Pfam:PF07733" FT /protein_id="CAL34855.1" FT /translation="MSQFTHLHLHTEYSLLDGANKLKELALTLKEQGATSVAMTDHGNM FT FGAIDFYQTMKAQGLKPIIGIEAYLHNHDELDDKSSRQRFHLCLYAKNEIGYQNLMYLS FT SQSYIKGLYYYPRINKKLLEDYSEGLICSSACLQGEVNWHLNTYSERNVRFGAKGYEAA FT KEAALWYKKVFKDDFYFEIMRHGIGDQRMIDDDIIRLSKELNIKIIATNDTHYTFKERA FT AAHEVFMCIAMGKKLNDPDRMRHSVHEFYVKSPEQMSELFADIPEAIENTQEIAQKCNL FT ELNLGNPTPPNFKFTREYAKDHNIILPEETKEFSFDNDDMVFEELCKKGLEERLKFIDE FT SKHEEYKQRLEVEINIIKNMKFSGYMLIVHDFIKVAKDKGIPVGPGRGSAAGSLVSYCL FT RITDLDPIPYSLLFERFLNPERVSMPDIDVDFCQDRRAEVIDYVIDKYGADKVAQVITF FT GKLLAKGVIRDVARVCDMSIQDADELAKLVPEELKITLDAAYEKEPKIKEFIDRHPKGL FT EVWEYARALEGLNRNAGMHAAGVVISNESLWKKTPLFRQSKNDERHLVTQYSKDHLEDV FT DLIKFDFLGLKTLTVINNAIKLIKKRYNKDIIWETIDVNDSKVYKTIQSGNTLGIFQIE FT SGGMQSLNARLKPERFEDIIAVLALYRPGPMESGMLDDFIDRKHGLKSIEYPFDSLEKV FT LEPTYGVIVYQEQVMQIVQIIGGFSLGGADVVRRAMGKKDPEKMKKLKTDFADGAEKQG FT YDRAKAEDLWELIVKFAGYGFNKSHSAAYALITFQTAYLKTYYPSEFMAALLTSEENNV FT DKIAVYIDEMKKMNIKLLPPSINKAIREFSALEQDGKDAIIYGLGAIKSVGIPAVENLL FT EARQDGEFKDINDFLGKIDPTKINRRTLESLIKAGAFDEFGFTRKALFDNMENLSEASR FT KMAEVRKNAASSLFGEEELTSGVQVNFTPKNEEFEVMEKLGYEKEILGIYVSGHPLDRF FT YEQINAIDYVKSLDFESLKNNGEILSIGKIEDFKSMMSKNNKRYGRIEILDYYSSFDAT FT VFESNVEEIENIIKDENLKNNAYGFVLGFKAEGGEKPSFFLKAIKDLQSLEDGEIKAIK FT KFGAKKDFKNKEENHFTAEPKEFEKNIIELDLTRLNRELIYEIHEIARNAHNPNEKNNK FT KLVLKVISAGSCLLYHTDFIISDSIVEEISNKYA" FT misc_feature 671958..672155 FT /note="HMMPfam hit to PF02231, PHP domain N-terminal FT region, score 4.7e-29" FT /inference="protein motif:Pfam:PF02231" FT misc_feature 672192..672614 FT /note="HMMPfam hit to PF02811, PHP domain C-terminal FT region, score 1.6e-34" FT /inference="protein motif:Pfam:PF02811" FT misc_feature 672693..674204 FT /note="HMMPfam hit to PF07733, Bacterial DNA polymerase III FT alpha sub, score 2.2e-295" FT /inference="protein motif:Pfam:PF07733" FT CDS complement(675560..676192) FT /transl_table=11 FT /locus_tag="Cj0719c" FT /product="conserved hypothetical protein Cj0719c" FT /note="Original (2000) note: Cj0719c, unknown, len: 210 aa; FT similar to hypothetical proteins from many organisms e.g. FT YGGS_ECOLI (234 aa), fasta scores; opt: 307 z-score: 380.4 FT E(): 6.9e-14, 34.0% identity in 206 aa overlap. 47.5% FT identity to HP0395. Contains PS01211 Uncharacterized FT protein family UPF0001 signature and Pfam match to entry FT PF01168 UPF0001" FT /note="Updated (2006) note: Pfam domain PF01168 Alanine FT racemase, N-terminal domain identified within CDS. This is FT an uncharacterised motif that has some conserved regions. FT Conserved added due to identification of motif. Literature FT search identified paper giving further information on FT product function. Functional classification - Conserved FT hypothetical proteins" FT /note="PMID:15228533" FT /db_xref="InterPro:IPR001608" FT /db_xref="InterPro:IPR011078" FT /db_xref="UniProtKB/TrEMBL:Q0PAG0" FT /inference="protein motif:Pfam:PF01168" FT /inference="protein motif:Prosite:PS01211" FT /protein_id="CAL34856.1" FT /translation="MTLEQILEKTKNVRLVAASKYVDASIIEKLFDQGIVEFGENQVQA FT LAQKKENLDEKKLDIKWHFIGTLQSNKINLLIKQKPILWHSCNGIKIAKAMDKRLDYKL FT NTLLEINSANENSKSGLDPNQAVEEYLQIQEECSNLNLCGVMSIGSHSQDKENIIKSFE FT TTFKIYEILQKHGAKICSMGMSNDFEIAIKCGSNLVRLGSILFKNLK" FT misc_feature complement(675566..676192) FT /note="HMMPfam hit to PF01168, Alanine racemase,N-terminal FT domain, score 2e-05" FT /inference="protein motif:Pfam:PF01168" FT misc_feature complement(675965..676009) FT /note="PS01211 Uncharacterized protein family UPF0001 FT signature" FT /inference="protein motif:Prosite:PS01211" FT CDS complement(676227..676976) FT /transl_table=11 FT /gene="flaC" FT /locus_tag="Cj0720c" FT /product="flagellin" FT /note="Original (2000) note: Cj0720c, flaC, flagellin,len: FT 249 aa; 99.6% identical to TR:P96747 (EMBL:U85622) C. FT jejuni flaC, and similar to the N-terminus of e.g. FT FLAB_CAMJE flagellin B (CJ1338) (575 aa), fasta scores; FT opt: 236 z-score: 261.7 E(): 2.8e-07, 27.2% identity in 202 FT aa overlap. No Hp ortholog" FT /note="Updated (2006) note: Pfam domain PF00669 Bacterial FT flagellin N-terminus identified within CDS. Further support FT given to product function. Characterised in Campylobacter FT and Escherichia coli with acceptable identity score. FT Putative not added to product function. Literature search FT identified paper linking product function to adhesion and FT to play an important role in cell adhesion. Functional FT classification - Surface structures" FT /note="PMID:15228533, PMID:16740937" FT /db_xref="GOA:P96747" FT /db_xref="InterPro:IPR001029" FT /db_xref="UniProtKB/Swiss-Prot:P96747" FT /inference="protein motif:Pfam:PF00669" FT /protein_id="CAL34857.1" FT /translation="MMISDATMMQQNYYLNNAQKASDKALENIAAVRAISGVDSANLAI FT ADSLRSQSSTIDQGVANAYDAIGVLQIADASLTNISQSADRLNELSVKMNNAALNDSQK FT GMLRTEATRIQESINDSFNNATYNGKNVFQTMNFVVGSGTETTNLNPLATDGLSIDSQD FT SITNFMDQLGSLRSEIGSGINAITSNINASVQNSINSKAAENNLLNNDMAKNVNDFNAN FT YLKENAAAFVAAQSNMQLQSKIANLLQ" FT misc_feature complement(676479..676871) FT /note="HMMPfam hit to PF00669, Bacterial flagellin FT N-terminus, score 6.9e-05" FT /inference="protein motif:Pfam:PF00669" FT CDS complement(677015..677485) FT /transl_table=11 FT /locus_tag="Cj0721c" FT /product="putative integral membrane protein. Functional FT classification-Membranes, lipoproteins and porins" FT /note="Original (2000) note: Cj0721c, probable integral FT membrane protein, len: 156 aa; 35.9% identity to HP0288" FT /note="Updated (2006) note: Four probable transmembrane FT helices predicted by TMHMM2.0" FT /db_xref="UniProtKB/TrEMBL:Q0PAF8" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34858.1" FT /translation="MKAVNLFLLASIIGVELILGIVVAPTIFFPQNLIGEGVLSHFQSG FT LMMTQIFIKMGYLLIFVSVVNFLYEIYSLIKDEMKFQIKFSKFMLSLLILILSLIFVFY FT FTNTIIELQNLGENATKTQEFISIHNASEVVIKIILIMQVFLYFLSFKIAKK" FT misc_feature complement(join(677399..677467,677282..677341, FT 677156..677224,677045..677113)) FT /note="4 probable transmembrane helices predicted for FT Cj0721c by TMHMM2.0 at aa 7-29, 49-68, 88-110 and 125-147" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(677498..678313) FT /transl_table=11 FT /locus_tag="Cj0722c" FT /product="putative DNA methylase" FT /note="Original (2000) note: Cj0722c, probable DNA FT methylase, len: 271 aa; similar to members of the hemK FT family of methylases, e.g. HEMK_ECOLI HEMK protein (277 FT aa), fasta scores; opt: 262 z-score: 315.7 E(): FT 2.7e-10,26.1% identity in 276 aa overlap. 36.9% identity to FT HP0381. Contains PS00092 N-6 Adenine-specific DNA FT methylases signature" FT /note="Updated (2006) note: Prosite domain PS50193 FT SAM_BIND, SAM (and some other nucleotide) binding motif FT identified within CDS. Further support given to product FT function. No specific characterisation with acceptable FT identity score carried out yet. Putative kept within FT product function. Functional classification - DNA FT replication, restriction/modification, recombination and FT repair" FT /db_xref="GOA:Q0PAF7" FT /db_xref="InterPro:IPR002052" FT /db_xref="InterPro:IPR004556" FT /db_xref="InterPro:IPR007848" FT /db_xref="UniProtKB/TrEMBL:Q0PAF7" FT /inference="protein motif:Prosite:PS00092" FT /inference="protein motif:Prosite:PS50193" FT /protein_id="CAL34859.1" FT /translation="MTIKNALMEAKSSLKGYENEAVFILCEYLKKDKAWLFLNQDIKID FT HEPYFELIKRFKSGEPFEYIFEKVDFWGLEFKIKKGILIPRYDSEILLFQILNLCKKNT FT FNGILEIGFGSGILSIVLAKELGLKITACDINPKALELALENAQLHKVDHLIDFKLCNF FT KQIKENYDFIFSNPPYIKNSYPIDIWVQKEPKEALFGGEKGYEILEEIIHFSLDKKVKF FT LACEFGYDQKEILEKILYQNNFIVDFFKDEQGYNRAFIAKFTNMRYDKK" FT misc_feature complement(677777..677797) FT /note="PS00092 N-6 Adenine-specific DNA methylases FT signature" FT /inference="protein motif:Prosite:PS00092" FT CDS complement(678310..679497) FT /transl_table=11 FT /locus_tag="Cj0723c" FT /product="putative integral membrane zinc-metalloprotease" FT /note="Original (2000) note: Cj0723c, probable integral FT membrane zinc-metalloprotease, len: 395 aa; simimlar to FT yeast proteases e.g. ST24_YEAST CAAX prenyl protease 1 (453 FT aa), fasta scores; opt: 494 z-score: 565.5 E(): 3.4e-24, FT 31.6% identity in 430 aa overlap, and to prokaryotic htpX, FT e.g. HTPX_ECOLI heat shock protein HTPX (293 aa), fasta FT scores; opt: 183 z-score: 216.0 E(): 9.9e-05, 24.1% FT identity in 295 aa overlap. 38.6% identity to HP0382. FT Contains PS00142 Neutral zinc metallopeptidases, FT zinc-binding region signature" FT /note="Updated (2006) note: Pfam domain PF01435 Peptidase FT family M48 and Prosite domain PS00142 FT ZINC_PROTEASE,Peptidase M, neutral zinc metallopeptidases, FT zinc-binding site were identified within CDS. Also, Seven FT probable transmembrane helices predicted by TMHMM2.0. FT Further support given to product function. No specific FT characterisation carried out yet. Putative kept within FT product function. Functional classification - FT Proteins,peptides and glycopeptides" FT /db_xref="GOA:Q0PAF6" FT /db_xref="InterPro:IPR001915" FT /db_xref="UniProtKB/TrEMBL:Q0PAF6" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01435" FT /inference="protein motif:Prosite:PS00142" FT /protein_id="CAL34860.1" FT /translation="MTLIAILCLYTALLSWISYAQIRFLEREKDKQAQILSEKDYQNAA FT DIAIENEKFKLFSNFYNLIISIAWIGFGFLYLKELLILNNTRFENTLFLLSFLIITSIL FT NLPLSIYESFIKDKAHGFSNMTVKLFIKDTMKSLILTLIFGFLILYTLLFCYDFFGTFW FT WIAAFIFAFCIIVIINLIYPTLIAPIFNKMKKLDDENLLKKISSLMKQCGFSANGVYVI FT DASKRDKRLNAYFGGLFKSKRVVLFDTLLKALNERELLAVLGHELGHFVHKDIIKALFN FT GAITMFLLFFVFANLPEFVYLESHLEGVNGGVFALLFILANIFSFLISPMLNALSRKNE FT FAADQHGAKVTSKEDMKNALIALARENKAFIKTSKIYTFFYLSHPSISDRIKALS" FT misc_feature complement(678313..678885) FT /note="HMMPfam hit to PF01435, Peptidase family M48, score FT 1.9e-43" FT /inference="protein motif:Pfam:PF01435" FT misc_feature complement(join(679420..679488,679249..679317, FT 679153..679221,679018..679086,678940..679008, FT 678595..678663,678499..678567)) FT /note="7 probable transmembrane helices predicted for FT Cj0723c by TMHMM2.0 at aa 4-26, 61-83, 93-115, FT 138-160,164-186, 279-301 and 311-333" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(678685..678714) FT /note="PS00142 Neutral zinc metallopeptidases,zinc-binding FT region signature" FT /inference="protein motif:Prosite:PS00142" FT CDS 679624..679809 FT /transl_table=11 FT /locus_tag="Cj0724" FT /product="hypothetical protein Cj0724" FT /note="Original (2000) note: Cj0724, unknown, len: 61 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAF5" FT /protein_id="CAL34861.1" FT /translation="MFFKKKISQKQKEKPKIPINDVILDDRLCKFKNKVQKISKDEASA FT SLLARQLSRLIRANKF" FT CDS complement(679806..680348) FT /transl_table=11 FT /locus_tag="Cj0725c" FT /product="molybdopterin biosynthesis protein" FT /note="Original (2000) note: Cj0725c, mog, probable FT molybdopterin biosynthesis protein, len: 180 aa; similar to FT e.g. MOG_ECOLI molybdopterin biosynthesis MOG protein (195 FT aa), fasta scores; opt: 506 z-score: 615.6 E(): 5.5e-27, FT 50.8% identity in 187 aa overlap. 65.3% identity to HP0799" FT /note="Updated (2006) note: Pfam domain PF00994 Probable FT molybdopterin binding domain found within CDS. FT Characterised within Escherichia coli with acceptable FT identity score. Putative not added to product function. FT Functional classification - Biosynthesis of FT cofactors,prosthetic groups and carriers - Molybdopterin" FT /note="PMID:12006571" FT /db_xref="GOA:Q0PAF4" FT /db_xref="InterPro:IPR001453" FT /db_xref="InterPro:IPR020817" FT /db_xref="UniProtKB/TrEMBL:Q0PAF4" FT /inference="protein motif:Pfam:PF00994" FT /protein_id="CAL34862.1" FT /translation="MDTINIGILTLSDRASSGIYEDKATAEIERVLNSYIKNDIIYHKE FT LIPDDYDLIIKKLLYLADEKKCDLIVTSGGTGPALRDVTPEATEAVCDKMMPGFGELMR FT LESLKYVPTAILSRQSAGIRNKSFIINLPGNPKAIKECLEPVFPAIPYCIDLIEGAYIE FT ANDEVIKVFRPKKKCQN" FT misc_feature complement(679911..680339) FT /note="HMMPfam hit to PF00994, Probable molybdopterin FT binding domain, score 6.3e-45" FT /inference="protein motif:Pfam:PF00994" FT CDS complement(680369..681352) FT /transl_table=11 FT /gene="corA" FT /locus_tag="Cj0726c" FT /product="magnesium and cobalt transport protein" FT /note="Original (2000) note: Cj0726c, corA, probable FT magnesium and cobalt transport protein, len: 327 aa; FT similar to e.g. CORA_ECOLI magnesium and cobalt transport FT protein CORA (316 aa), fasta scores; opt: 559 z-score: FT 616.2 E(): 5.1e-27, 31.3% identity in 329 aa overlap. 49.4% FT identity to HP1344" FT /note="Updated (2006) note: Pfam domain PF01544 CorA-like FT Mg2+ transporter protein identified within CDS. Also, two FT probable transmembrane helices predicted for TMHMM2.0. FT Further support given to product function. Characterised FT within Escherichia coli and Salmonella typhimurium with FT marginal identity scores. Putative not added to product FT function. Functional classification - Transport/binding FT proteins - Cations" FT /note="PMID:1779764, PMID:9775386" FT /db_xref="GOA:Q9PPI1" FT /db_xref="InterPro:IPR002523" FT /db_xref="InterPro:IPR004488" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPI1" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01544" FT /protein_id="CAL34863.1" FT /translation="MLYIYIKTQNALVQRINFNLDSQELPQNILWIDLLHPSAAEIAFI FT SSEFNLEFPTKEEREEIELSAKYWEDNATITINAHFLVRDLKSDEEDRNLIKLRTEIVT FT FATAKNILFTIRYNEFSTFEEIQARILASPKNFEDGFDIIDKMFEVRVEKDADLLEWID FT KEARRLRTSVLEKKDEYSYDEMLKDISSLQELNMRVRDSLFDKRRAMTSLLKSDKIDKD FT IKQNLTIVLKDLNSLVEFSVSQLNILDNIQTILASQINIEQNKVIKIFTVATVAMMPPT FT LIGTVYGMNFKFMPELELHYAYPIVLGVMVISIILPLVVFKKKGWL" FT misc_feature complement(680372..681277) FT /note="HMMPfam hit to PF01544, CorA-like Mg2+ transporter FT protein, score 1.6e-61" FT /inference="protein motif:Pfam:PF01544" FT misc_feature complement(join(680486..680554,680390..680458)) FT /note="2 probable transmembrane helices predicted for FT Cj0726c by TMHMM2.0 at aa 267-289 and 299-321" FT /inference="protein motif:TMHMM:2.0" FT CDS 681469..682515 FT /transl_table=11 FT /locus_tag="Cj0727" FT /product="putative periplasmic solute-binding protein" FT /note="Original (2000) note: Cj0727, probable periplasmic FT solute-binding protein, len: 348 aa; similar to e.g. FT SUBI_ECOLI sulfate-binding protein precursor (329 aa),fasta FT scores; opt: 220 z-score: 256.1 E(): 5.8e-07, 25.0% FT identity in 220 aa overlap. No Hp match. Contains FT N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF01547 Bacterial FT extracellular solute-binding protein identified within CDS. FT Further support given to product function. Characterised FT within Escherichia coli, however, identity scores were FT unnacceptable. Putative kept within product function. FT Functional classification - Transport/binding proteins - FT Other" FT /db_xref="InterPro:IPR006059" FT /db_xref="UniProtKB/TrEMBL:Q0PAF2" FT /inference="protein motif:Pfam:PF01547" FT /protein_id="CAL34864.1" FT /translation="MSKKFFLSLGLVALLFSNSQAIDENLIKAAQAEGRVNSLAMPDTW FT ANWKDTWADLKNLYDIEHSDTDMSSAQEIAKFKTEKKNASGDIGDVGASFGEIAVKQGV FT AQPFKTSYWDQIPTWAKDKDGNWLLAYTGTIAFIVNKDVVKDIPKTWQDLLKGNYKITV FT GDVSVAAQAVSAVLAANYALGGDEKDLSPALAFFNTLAKQGRLVNNDVSIANLEKGEVE FT VGLVWDFNGLGYRDKVGKDRYEVLIPADGSVISGYTTIINKYAKHPNAAKLAREFILSD FT KGQINLAKGYARPIRIDHITLPDDIKAKLLPSEQYKNARAIKDQKAWEKSAKELPQLWQ FT EKVIVDMK" FT sig_peptide 681469..681531 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000340_681469_682515 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.597 between residues 21 and 22" FT misc_feature 681487..682323 FT /note="HMMPfam hit to PF01547, Bacterial extracellular FT solute-binding prot, score 0.0028" FT /inference="protein motif:Pfam:PF01547" FT CDS 682526..683851 FT /transl_table=11 FT /locus_tag="Cj0728" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0728, probable periplasmic FT protein, len: 441 aa; no Hp match. Contains probable FT N-terminal signal sequence. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAF1" FT /protein_id="CAL34865.1" FT /translation="MKKVILTSAMLCSVLFGVQEYEANLAGHIIIDSKSTVKPPKDAPD FT FFKTYGKFANIAREEKIGTFKSKGNRETDFYLPFKNQPIQGHSGIKYIPKKDVFWVISD FT NGLGKKYNSYDAMLYAHEFKFDFKNSKYELLKTVFFKDSDKKYPYPITTETTKERYLSG FT VDFDTESIQVINDEFYIGDEFGPYLLHFDKNGNLKEVFDVYVEGKKLISPDNPSLKFSD FT KPDGENEKFNIKRSKGFEAMASSKDGSKLYLLLEGSIYNNNAYENEKGKEYLRIIEFNV FT KNKKFTGKTYKYFLEDKSHSIGDFNMIDDKYGIIIERDQKEGTKDKACKEGEDTKHCFN FT NVAQFKRIYKVKLDDKTHEAQKISYIDLLNIKDRNKISKKPLVNDKFVFPFETIEGVDI FT VDDSHIVVENDNNFPYSSSREPNKTDDNEFILLEVKDFLKSK" FT sig_peptide 682526..682591 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000341_682526_683851 by SignalP 2.0 FT HMM (Signal peptide probability 0.965) with cleavage site FT probability 0.429 between residues 22 and 23" FT CDS 683848..684657 FT /transl_table=11 FT /locus_tag="Cj0729" FT /product="putative type I phosphodiesterase/nucleotide FT pyrophosphatase" FT /note="Original (2000) note: Cj0729, unknown, len: 269 aa; FT no Hp match" FT /note="Updated (2006) note: Pfam domain PF01663 Type I FT phosphodiesterase / nucleotide pyrophosphatase identified FT within CDS. Product modified to more specific family member FT due to motif match. No specific characterisation has been FT carried out yet, so putative kept within product function. FT Functional classification - Purines,pyrimidines, FT nucleosides and nucleotides - Miscellaneous FT nucleoside/nucleotide reactions" FT /db_xref="GOA:Q0PAF0" FT /db_xref="InterPro:IPR002591" FT /db_xref="InterPro:IPR017849" FT /db_xref="InterPro:IPR017850" FT /db_xref="UniProtKB/TrEMBL:Q0PAF0" FT /inference="protein motif:Pfam:PF01663" FT /protein_id="CAL34866.1" FT /translation="MMSKAILVVLDGLNCKSASINMGYLNALCKENLGKFYSLECELPS FT MSRPLYECLLTGVKPVLSGIINNKLSFSKQTSIFDLCKEQGLKAGGAAYHWVFELYNKK FT EFIPSLHRHIEDENLTLPYGHFYYEDDYLDSHLFADGEHLRNKYNLDFTLIHSMNIDDA FT GHKFGSHSIEYANKTKKVDILISEYLPTWLEQGINVIITSDHGMTEGKSHGGLSEDEIL FT VPFFTFGSAFSYENAKIKQDEICGSICEILGLKHDKRYNDEILKAKK" FT CDS 684654..685493 FT /transl_table=11 FT /locus_tag="Cj0730" FT /product="putative ABC transport system permease" FT /note="Original (2000) note: Cj0730, probable ABC transport FT system permease, len: 279 aa; similar to members of the FT binding protein-dependent permease family e.g. UGPA_ECOLI FT SN-glycerol-3-phosphate transport system permease (295 aa), FT fasta scores; opt: 273 z-score: 324.4 E(): 9.1e-11, 25.0% FT identity in 280 aa overlap. No Hp match. Contains Pfam FT match to entry PF00528 BPD_transp,Binding-protein-dependent FT transport systems inner membrane component" FT /note="Updated (2006) note: Six probable transmembrane FT helices predicted by TMHMM2.0. Further support given to FT product function. No specific characterisation with FT acceptable identity score has been carried out yet. FT Putative kept within product function. Functional FT classification - Transport/binding proteins - Other" FT /db_xref="GOA:Q0PAE9" FT /db_xref="InterPro:IPR000515" FT /db_xref="UniProtKB/TrEMBL:Q0PAE9" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00528" FT /protein_id="CAL34867.1" FT /translation="MKEKFLAFLSILPFFIVFTFFMIAPLIWIVFNAFYVEEDEIYSLA FT NFIHIFESKFYLQSIINSLQISFISSIFGLLIGLLASYSLFVLAPSKICKFLFSLNTMI FT SNFSGVPLAFAFIIVLGSNGVVNVFLKNLGIEPFVSVYANFGVNIVYVYFQIPLAILLL FT LPAFKSLENSHLNACKMLGGGNFLYWLKIALPLLAPALFGVFVILFANAFGAYATIYAL FT SSGNFNVAPVRIAALIAGDINLDPYMASALSIIITIIMLVVTFIANFLSKKYNFKVL" FT sig_peptide 684654..684758 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000343_684654_685493 by SignalP 2.0 FT HMM (Signal peptide probability 0.781) with cleavage site FT probability 0.331 between residues 35 and 36" FT misc_feature order(684672..684740,684849..684917,684975..685043, FT 685086..685154,685212..685280,685395..685463) FT /note="6 probable transmembrane helices predicted for FT Cj0730 by TMHMM2.0 at aa 7-29, 66-88, 108-130, FT 145-167,187-209 and 248-270" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 684819..685490 FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 0.0008" FT /inference="protein motif:Pfam:PF00528" FT CDS 685494..686273 FT /transl_table=11 FT /locus_tag="Cj0731" FT /product="putative ABC transport system permease" FT /note="Original (2000) note: Cj0731, probable ABC transport FT system permease, len: 259 aa; similar to members of the FT binding protein-dependent permease family e.g. POTC_ECOLI FT spermidine/putrescine transport system permease (264 aa), FT fasta scores; opt: 271 z-score: 337.3 E(): 1.7e-11, 24.1% FT identity in 241 aa overlap. No Hp ortholog. Contains Pfam FT match to entry PF00528 BPD_transp,Binding-protein-dependent FT transport systems inner membrane component" FT /note="Updated (2006) note: Seven probable transmembrane FT helices predicted by TMHMM2.0. Further support given to FT product function. No specific characterisation with FT acceptable identity score has been carried out yet. FT Putative kept within product function. Functional FT classification - Transport/binding proteins - Other" FT /db_xref="GOA:Q0PAE8" FT /db_xref="InterPro:IPR000515" FT /db_xref="UniProtKB/TrEMBL:Q0PAE8" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00528" FT /protein_id="CAL34868.1" FT /translation="MNENLSLKAKIYHYAVLFLVFLFLALPLMATFLYSISTSWGVSVL FT PDDLTLKWYQELFHDERFLLALWHSLLVCVGSILLSVILVFPLVFVLNYYFLKLKAFVN FT ILIIMPFAVPPIVSCVGLLQLYADNIGGTAWILIFTYFTIALPFIYRALDNAISNVNLN FT ELITSNAMLGGSLMGAIFKLILPNLRNGILVAVFLSFSFLIGEFLYANILVGSAYETLQ FT VYLYNIKNQSGHYSSALVIVYFVLIFITTFIASLIKE" FT sig_peptide 685494..685598 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000344_685494_686273 by SignalP 2.0 FT HMM (Signal peptide probability 0.984) with cleavage site FT probability 0.536 between residues 35 and 36" FT misc_feature order(685527..685595,685716..685784,685803..685871, FT 685884..685952,685986..686054,686067..686135, FT 686196..686264) FT /note="7 probable transmembrane helices predicted for FT Cj0731 by TMHMM2.0 at aa 12-34, 75-97, 104-126, FT 131-153,165-187, 192-214 and 235-257" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 685692..686270 FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 0.0085" FT /inference="protein motif:Pfam:PF00528" FT CDS 686277..687266 FT /transl_table=11 FT /locus_tag="Cj0732" FT /product="ABC transport system ATP-binding protein" FT /note="Original (2000) note: Cj0732, probable ABC transport FT system ATP-binding protein, len: 329 aa; similar to many FT e.g. POTA_ECOLI spermidine/putrescine transport ATP-binding FT protein (378 aa), fasta scores; opt: 802 z-score: 857.8 FT E(): 0, 43.2% identity in 292 aa overlap. No Hp otholog. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop), FT PS00211 ABC transporters family signature and Pfam match to FT entry PF00005 ABC_tran" FT /note="Updated (2006) note: Similar to more than one FT species with acceptable identity score. Putative not added FT to product function. Functional classification FT -Transport/binding proteins - Other" FT /db_xref="GOA:Q0PAE7" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR008995" FT /db_xref="InterPro:IPR013611" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/TrEMBL:Q0PAE7" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34869.1" FT /translation="MAYLKIKNFKKAYGDKIIFEDINFSAKKGEFITLLGPSGCGKSTL FT LRCIAGLSQINGGKISLNDKDLTKLSPQKRNIGMVFQNYALFPNLNVFENVAFGLKIKK FT MDKKDIEKRVKKMLKLVELEEYAKTYPHKLSGGQMQRVALARSLVIKPDLLLLDEPLSA FT LDAKIRKYLRVQIKEIQKELELTTIFVTHDQEEALELSDTIILMNEGKIIQNSNANNLY FT LLPESHFVASFIGNYNILSPKELDSLGLKHDFKKDIALRPETIEISNEGLEAKIKEKSL FT LGNIIRYRVRVQEIEFKVDTLNFSTHSTYEAGDKIALKFNLSLAKELK" FT misc_feature 686361..686906 FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 4.1e-70" FT /inference="protein motif:Pfam:PF00005" FT misc_feature 686382..686405 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 686676..686720 FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT CDS 687263..687901 FT /transl_table=11 FT /locus_tag="Cj0733" FT /product="putative HAD-superfamily hydrolase" FT /note="Original (2000) note: Cj0733, unknown, len: 212 aa; FT some similarity to hypotheical proteins from Actinomycetes FT e.g. TR:O69629 (EMBL:AL022121) Rv3661 (MTV025.009) (287 FT aa), fasta scores; opt: 264 z-score: 321.7 E(): FT 1.3e-10,28.4% identity in 215 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF00702 haloacid FT dehalogenase-like hydrolase identified within CDS. No FT specific characterisation with acceptable identity score FT has been carried out yet. Putative kept within product FT function. Functional classification - Misc" FT /db_xref="GOA:Q0PAE6" FT /db_xref="InterPro:IPR006383" FT /db_xref="InterPro:IPR006385" FT /db_xref="InterPro:IPR023214" FT /db_xref="UniProtKB/TrEMBL:Q0PAE6" FT /inference="protein motif:Pfam:PF00702" FT /protein_id="CAL34870.1" FT /translation="MKLVLFDLDDTLIQGDSAKLWLKFCVEKGFLPQEYLEKIVFYQKQ FT YQEKKFDMDEFMTFFLQSVKGKNEDRISSLVDEFIKIYIKPYEKAKELIIKYQDQRCII FT ISATAEFLVRKIASFLGVRESIAIKCERVGDKFSGKAYGIYSFKEGKVLRLKEYLGKDY FT EKWMKDSYFFSDSINDLPLLESVSKAFVCNGDEKILKIAKERKYEILTF" FT misc_feature 687263..687850 FT /note="HMMPfam hit to PF00702, haloacid dehalogenase-like FT hydrolase, score 0.0017" FT /inference="protein motif:Pfam:PF00702" FT misc_feature 687518..687547 FT /note="PS00215 Mitochondrial energy transfer proteins FT signature" FT /inference="protein motif:Prosite:PS00215" FT CDS complement(687925..688680) FT /transl_table=11 FT /gene="hisJ" FT /locus_tag="Cj0734c" FT /product="histidine-binding protein precursor" FT /note="Original (2000) note: Cj0734c, hisJ, probable FT histidine-binding protein precursor, len: 251 aa; almost FT identical to HISJ_CAMJE histidine-binding protein precursor FT (256 aa) (88.7% identity in 256 aa overlap) and similar to FT many priplasmic amino-acid binding proteins e.g. HISJ_ECOLI FT histidine-binding periplasmic protein precursor (260 aa), FT fasta scores; opt: 343 z-score: 390.5 E(): 1.9e-14. 33.5% FT identity in 263 aa overlap. No Hp ortholog. Contains FT N-terminal signal sequence, PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site,PS01039 Bacterial FT extracellular solute-binding proteins,family 3 signature, FT and Pfam match to entry PF00497 SBP_bac_3, Bacterial FT extracellular solute-binding proteins, family 3" FT /note="Updated (2006) note: Characterised in Campylobacter FT jejuni. Putative not added to product function. Functional FT classification - Transport/binding proteins - Amino acids FT and amines" FT /note="PMID:9489038, PMID:15063560, PMID:9395059" FT /db_xref="GOA:Q46125" FT /db_xref="InterPro:IPR001638" FT /db_xref="InterPro:IPR018313" FT /db_xref="UniProtKB/Swiss-Prot:Q46125" FT /inference="protein motif:Pfam:PF00497" FT /inference="protein motif:Prosite:PS01039" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34871.1" FT /translation="MKKILSIALVALVGLFLGACSDSKNKESNASVELKVGTAPNYKPF FT NYKENSKLTGFDTDLVEEIAKKNGIKIVWVETNFDGLIPALKAGKIDMIASAMSATDER FT RQSVDFTKPYYMSKNLYLKLKNNDSLQTKNDLEGKKIGVQLGTLQENTAKAIKNAQVQS FT NKDLNIAVLALKNNKIDAIVADQDTAKGFLAENPELVSFYQETDGGEGFSFAFDKNKQK FT NIIEIFNKGIDEAKTDGFYDTLIKKYELE" FT misc_feature complement(687928..688581) FT /note="HMMPfam hit to PF00497, Bacterial extracellular FT solute-binding prot, score 4.4e-67" FT /inference="protein motif:Pfam:PF00497" FT misc_feature complement(688477..688518) FT /note="PS01039 Bacterial extracellular solute-binding FT proteins, family 3 signature" FT /inference="protein motif:Prosite:PS01039" FT sig_peptide complement(688618..688680) FT /note="Signal peptide predicted for hisJ by SignalP 2.0 HMM FT (Signal peptide probability 1.000) with cleavage site FT probability 0.646 between residues 21 and 22" FT misc_feature complement(688621..688653) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 689007..689726 FT /transl_table=11 FT /locus_tag="Cj0735" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0735, probable periplasmic FT protein, len: 239 aa; no Hp match. Similar to N-terminus of FT Cj0967 (E(): 6.7e-15, 34.5% identity in 116 aa overlap); FT similarity continues in downstream CDS Cj0736. Contains FT probable N-terminal signal sequence" FT /note="Updated (2006) note: One probable transmembrane FT helix predicted by TMHMM2.0. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAE4" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34872.1" FT /translation="MKKYFNIFKIFTNKTNAKFGLGVCSVVLSSSVCFAAVQAASKDGK FT IFYISEHSFKDNQVYDPQAEIFKKINGKNFYASKSKYPISNLTMIYNNPKSGNKNLSKL FT EILTPDTSKEEIITAFSTLGTVSSDTQAVPSSFMPFIVTAYAQNTNATNNKLILENGEL FT SSVYFCKPSIGDCGVPNNSQKGDRFKYLITAAFTDRGEGFNNQTILKENSYINNGCRKY FT LHLALKWSSLYFRICSF" FT sig_peptide 689007..689123 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000347_689007_689726 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.662 between residues 39 and 40" FT misc_feature 689061..689129 FT /note="1 probable transmembrane helix predicted for Cj0735 FT by TMHMM2.0 at aa 19-41" FT /inference="protein motif:TMHMM:2.0" FT CDS 689656..691584 FT /transl_table=11 FT /locus_tag="Cj0736" FT /product="hypothetical protein Cj0736" FT /note="Original (2000) note: Cj0736, unknown, len: 239 aa; FT no Hp match. Similar to C-terminus of Cj0967(E(): 0, 42.3% FT identity in 562 aa overlap); similarity continues from FT upstream CDS Cj0735" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAE3" FT /protein_id="CAL34873.1" FT /translation="MGVENIYTLPLNGVPYISGSVAFDGEAKDNKLILESNTKIDLHNS FT QYFSDEEGKDIYDERITRLMGAFGINSNLQNNKVLIDSANIVLHGPDGEYTARSTFEIL FT GALADVNNLKKYNVSKNSVIIKNLNLDLMVNSQNKITFYDAVLFGEIYGGRTLQGNAEK FT NSIEVYHFNSLDHLNKNIKTHASLNLYGGYSNDGEANGNKIVFRLKKPLKISDNFYGKN FT YYNLYGCFATEGANFNVFDIQNDLTYEKVPQNYSDKFTVYAARTLSGKANNNTLSIKDS FT VISLPLYAFITSETTLDGIDYIADESNNNEVNFENIKSSKNLSLMINAKNVSNNKINYN FT LIQSLTEASSLGKGSKIILKATQNANNNLIKLKDCSSAAVESSCIIKADKESAFNKIIN FT NNTAFSTASDKRQGYVGLIAGVSANSHDNIMELVNLNIDEYKNQDAIFLAPSGTSDISN FT FKSYNNTLYLGGELNFFKDVNIDLLSGSVFHEVNKKGKIITQILPHQEDFSKNNRLIID FT TQDVKSEVVNNFENFTFILPNKIKNPILTIEKLINLPANGSMEILTKNKPTKGKYILIQ FT SDVGIYDGDNGLLNQQELENLLEKMKNNKNKFNYNKIEKLAKSTLKNVNFSFEVSDDAK FT IIYINIL" FT CDS 691596..692672 FT /transl_table=11 FT /locus_tag="Cj0737" FT /product="putative haemagglutination activity domain FT containing protein" FT /note="Original (2000) note: Cj0737, probable periplasmic FT protein, len: 358 aa; simlar to the N-terminus of FT HXA3_HAEIN heme:hemopexin-binding protein precursor (hxuA) FT (917 aa), fasta scores; opt: 236 z-score: 251.5 E(): 1e-06, FT 32.8% identity in 180 aa overlap, and N-terminus of FT TR:Q48028 H. influenzae adhesin (1477 aa), fasta scores; FT opt: 292 z-score: 307.3 E(): 8.1e-10, 28.9% identity in 381 FT aa overlap. No Hp match. Similar in part to Cj0968 and FT Cj0969, probably representing a pseudogene copy of this FT CDS" FT /note="Updated (2006) note: Pfam domain PF05860 FT haemagglutination activity domain identified within CDS. FT One probable transmembrane helix predicted by TMHMM2.0. FT Product modified to more specific family member due to FT motif match. Putative kept as no specific characterisation. FT Functional classification - Misc" FT /db_xref="GOA:Q0PAE2" FT /db_xref="InterPro:IPR008638" FT /db_xref="InterPro:IPR011050" FT /db_xref="UniProtKB/TrEMBL:Q0PAE2" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF05860" FT /protein_id="CAL34874.1" FT /translation="MKKMSKHIVLSFAVSSLLFSQAYALLSGGKFTHGTSGTIHTSGNT FT VTITGKGQNHVIQWGGGFNIGQNESVNFNGKNQNYLNIAYQKDASKIDGALNRGNNNIF FT LVNPMGVLIGKTGTITAGKFVASTTALSDDNVKTFLEKGASFSPAFDVSKQGNIINLGK FT INADNIVLIGNKVEINKGKITLDVLKLEGNKVYVDAGVVKDTKNIVAKAEQEAIIQQSI FT TSFEEDGALLGNSSSKFSFDDSSKVKNWTKYGSIADATEWNKFADFWNVNKEKFRTAFD FT HFRLIDDIDFSGVKTYIVGDNTSNAFAKSFDGSGYALKNVNINSSNQYVGIFGVVQNSY FT IRNFNIQGLKIASTGYDA" FT sig_peptide 691596..691697 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000349_691596_692672 by SignalP 2.0 FT HMM (Signal peptide probability 0.997) with cleavage site FT probability 0.249 between residues 34 and 35" FT misc_feature 691614..691682 FT /note="1 probable transmembrane helix predicted for Cj0737 FT by TMHMM2.0 at aa 7-29" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 691659..692003 FT /note="HMMPfam hit to PF05860, haemagglutination activity FT domain, score 3.3e-11" FT /inference="protein motif:Pfam:PF05860" FT CDS 692726..692890 FT /transl_table=11 FT /locus_tag="Cj0738" FT /product="hypothetical protein Cj0738" FT /note="Original (2000) note: Cj0738, unknown, len: 54 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAE1" FT /protein_id="CAL34875.1" FT /translation="MTVNDLVINTAVNTKVGGIIGWGNGSGGNNTINFTNVAINNISIV FT AKKVLMWVA" FT CDS 692878..693051 FT /transl_table=11 FT /locus_tag="Cj0739" FT /product="hypothetical protein Cj0739" FT /note="Original (2000) note: Cj0739, unknown, len: 57 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAE0" FT /protein_id="CAL34876.1" FT /translation="MGGIGRQIDGGNFNNVVVNDIEKLITSGNDSKTGGFTGKVGNLKI FT NNAYLFYKMEQF" FT CDS 693048..693212 FT /transl_table=11 FT /locus_tag="Cj0740" FT /product="hypothetical protein Cj0740" FT /note="Original (2000) note: Cj0740, unknown, len: 54 aa; FT no Hp match. Functional classification - . Functional FT classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAD9" FT /protein_id="CAL34877.1" FT /translation="MSAGNYKTQAGKVIGDPGISVNNNFSNIYVYHNLENGYIDEGQNF FT LSLCNIIMK" FT CDS 693191..694117 FT /transl_table=11 FT /locus_tag="Cj0741" FT /product="hypothetical protein Cj0741" FT /note="Original (2000) note: Cj0741, unknown, len: 308 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAD8" FT /protein_id="CAL34878.1" FT /translation="MQYNNEVTGKKDFDSAVRKKFNDIKYLDNNSYAFADSFTKATDAV FT KLSKDDFDPKLLQRILDDLMNGKYTYDFDTKTWTYTDSKGVVGKDEASEITQSLNFLNA FT FKDTGVEQEFLKLWQGSQEQNYKNYTNLYEKWTQKKTAMDKIKTGEGYFASFKEELQKY FT QEALAQLDKENKNYEKIKESGLVSDETLRAIYEKLLEQKEALEKQFADLSGNEGFRYKL FT ENEILNSQGFSIEGKDVDGKVYTGNFNFKGKLASLPEKPNISIYEPDKQGGEDPDKPSV FT LPPEIPEKVVEAPIKIQTEVDAKKRRR" FT CDS join(694230..694694,694694..694936,694939..695922) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0742" FT /product="pseudogene (putative outer membrane protein)" FT /note="Original (2000) note: Cj0742, probable outer FT membrane protein pseudogene, len: 1567 bp; similar to parts FT of Cj0975 (H. inf. hxuB-like). No Hp match" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores. Thus, putative kept within FT product function. Coding sequence has been updated to FT reflect the complete amino acid sequence for the encoded FT protein regardless of its expression. This will cause FT differences from the amino acid sequence of the previous FT annotation. Functional classification -Membranes, FT lipoproteins and porins" FT rRNA 696424..697936 FT /note="16S rRNA" FT tRNA 698041..698116 FT /gene="tRNA-Ala" FT /note="tRNA Ala anticodon TGC, Cove score 92.14" FT tRNA 698125..698201 FT /gene="tRNA-Ile" FT /note="tRNA Ile anticodon GAT, Cove score 93.24" FT rRNA 698743..701654 FT /note="23S rRNA" FT rRNA 701939..702058 FT /note="5S rRNA" FT CDS 702810..702917 FT /transl_table=11 FT /locus_tag="Cj0747" FT /product="hypothetical protein Cj0747" FT /note="Original (2000) note: Cj0747, unknown, len: 35 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAD7" FT /protein_id="CAL34880.1" FT /translation="MGVVYDEINIAVNTCKGLVLSKKRLLALNLSFFIQ" FT CDS 703027..703119 FT /transl_table=11 FT /locus_tag="Cj0748" FT /product="hypothetical protein Cj0748" FT /note="Original (2000) note: Cj0748, unknown, len: 30 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAD6" FT /protein_id="CAL34881.1" FT /translation="MLETLKKYAENQGIEDNYPKKIYNQKEKKP" FT CDS join(703132..703170,703172..703219,703219..703263, FT 703266..704369) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0752" FT /product="pseudogene (IS element transposase)" FT /note="Original (2000) note: Cj0752, probable IS element FT transposase pseudogene, len: 1113 bp; similar to parts of FT e.g. TR:O06526 (EMBL:U95957) H. pylori transposase homolog FT B (442 aa). Similar to several Hp genes e.g. HP1095,HP0997, FT HP0989, HP0438, HP1534. No other C.j. matches" FT /note="Updated (2006) note: Pfam domains PF01385 Probable FT transposase and PF07282 Putative transposase DNA-binding FT domain were both identified within CDS. Further support FT given to product function. Similarity and characterisation FT work within Helicobacter pylori has led to putative not FT being added to product function. Coding sequence has been FT updated to reflect the complete amino acid sequence for the FT encoded protein regardless of its expression. This will FT cause differences from the amino acid sequence of the FT previous annotation. Functional classification - IS FT elements" FT /note="PMID:9858724, PMID:15019987" FT /inference="protein motif:Pfam:PF07282" FT /inference="protein motif:Pfam:PF01385" FT misc_feature order(703153..703170,703172..703219,703219..703263, FT 703266..704006) FT /note="HMMPfam hit to PF01385, Probable transposase, score FT 7e-08" FT /inference="protein motif:Pfam:PF01385" FT misc_feature 704067..704276 FT /note="HMMPfam hit to PF07282, Putative transposase FT DNA-binding domai, score 1.1e-33" FT /inference="protein motif:Pfam:PF07282" FT CDS complement(704442..705125) FT /transl_table=11 FT /gene="tonB3" FT /locus_tag="Cj0753c" FT /product="TonB transport protein" FT /note="Original (2000) note: Cj0753c, tonB3, probable tonB FT transport protein, len: 227 aa; almost identical to FT TONB_CAMCO C. coli tonB protein (232 aa); 96.6% identity in FT 232 aa overlap, and similar to e.g. TONB_ECOLI (239 FT aa,fasta scores; opt: 154 z-score: 170.4 E(): 0.034, 29.6% FT identity in 162 aa overlap. 34.6% identity to HP1341. Also FT similar to tonB2, Cj1630 (41.7% identity in 230 aa FT overlap)" FT /note="Updated (2006) note: Pfam domain PF03544 FT Gram-negative bacterial tonB protein identified within CDS. FT One probable transmembrane helix predicted by TMHMM2.0. FT Further support given to product function. Characterised FT within Campylobacter strains. Putative not added to product FT function. Functional classification -Transport/binding FT proteins - Other" FT /note="PMID:9190817, PMID:11395459" FT /db_xref="GOA:Q0PAD5" FT /db_xref="InterPro:IPR003538" FT /db_xref="InterPro:IPR006260" FT /db_xref="UniProtKB/TrEMBL:Q0PAD5" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03544" FT /protein_id="CAL34883.1" FT /translation="MKTFISNHKNQSSFITLFVFTPLFFVFLYSKDFLHIQPNETIKEN FT KFNMAIKHFVQNSSDMKPTQPTQTIQEPSNVQPKEPVQEIKKIKPRKEKPIAKPKKIIP FT PANAKAISQPKKDTNMQQQTPQASSYQSVSLTSNSELLKEIKSAIDEALIYPRQARKMR FT MSGEVLVEFTWTKEKKLENLKILKPSKYDFLNKSALETIRIASKKFPQYEKTFHIKIPL FT VYKLS" FT misc_feature complement(704568..704672) FT /note="HMMPfam hit to PF03544, Gram-negative bacterial tonB FT protein, score 4.1e-13" FT /inference="protein motif:Pfam:PF03544" FT misc_feature complement(705039..705092) FT /note="1 probable transmembrane helix predicted for Cj0753c FT by TMHMM2.0 at aa 12-29" FT /inference="protein motif:TMHMM:2.0" FT CDS 705450..707540 FT /transl_table=11 FT /gene="cfrA" FT /locus_tag="Cj0755" FT /product="ferric enterobactin uptake receptor" FT /note="Original (2000) note: Cj0755, cfrA, probable iron FT uptake protein (ferric receptor), len: 696 aa; almost FT identical to TR:O07651 (EMBL:U80812) C. coli ferric FT receptor CFRA (696 aa); 98.7% identity in 696 aa overlap. FT Also simimlar to e.g. TR:O87518 (EMBL:AF081285) E. coli FT exogenous ferric siderophore receptor R4 (669 aa), fasta FT scores; opt: 1127 z-score: 1247.0 E(): 0, 34.5% identity in FT 693 aa overlap. 23.4% identity to HP0686" FT /note="Updated (2006) note: Pfam domains PF07715 FT TonB-dependent Receptor Plug Domain and PF00593 TonB FT dependent receptor identified within CDS. Further support FT given to product function. Characterisation work within FT Campylobacter jejuni (following on from Campylobacter FT coli), has led to product function being modified to more FT specfic family member. Putative not added to product FT function. Functional classification - Transport/binding FT proteins - Cations" FT /note="PMID:9190817, PMID:9765558, FT PMID:15231804,PMID:15632442" FT /db_xref="GOA:Q0PAD4" FT /db_xref="InterPro:IPR000531" FT /db_xref="InterPro:IPR012910" FT /db_xref="UniProtKB/TrEMBL:Q0PAD4" FT /inference="protein motif:Pfam:PF00593" FT /inference="protein motif:Pfam:PF07715" FT /protein_id="CAL34884.1" FT /translation="MKKICLSVCAIGLLSSNAISQNVELDSSIVSASGFTQDIKEAPAT FT INVITKKELQSKPYRDVAEAIADIPGVDLYASKGKTGSYNITMRGITGYTLVLIDGRRQ FT GIGGEVGPNGFNEISNSFLPPISSIERIEVIKGPMSTLYGSEALGGVVNIITKKVSDKW FT ETSVSLDALLNENKDWGNTYGTSIYSSGPLMNDKLGLTLRFREFYRQQSNVEFTNGSGQ FT RVQGDQAQSPTKANNFNIGTRISYLANDYNTFIFDIDFSRNHYDNKQGQLGTITSPGRT FT PGSLTGGYADIMEVDKFVTYLSHEGVYENFSITSGLQYNRVSNDGREVVGQSTQPFLGE FT NRDIVAEDIILDTKSVIPLGQSHILSVGGEYRLEKMQDKIASPTNFDQYLLAIFAEDEY FT SIKDDLRLTFGARYNHHEIFGNNVSPRAYVVYNPTNELTLKGGVSTGFRTPYANRLING FT TYSYSGQGRFPTYGNPDLKEETSLNYEIAAIYNNDLFYVSATGFLTNFKDKISSQSYNN FT SEPIPGIGTCDADRCSRAINHGKVEYKGVELGAGISPLDNLNVNFAYTYLDTEVKEAQD FT RSVIGKPEQDSLKHNIMLKTEYSFYNKITPWIKGEWQIDRYMGDTNINREYYKDIFLAS FT MGVRYDINKQWSINAAIYNLFDKSFTNGWESYASGSGSTWVNTYNRIEEGRRMYISING FT NF" FT sig_peptide 705450..705524 FT /note="Signal peptide predicted for cfrA by SignalP 2.0 HMM FT (Signal peptide probability 0.996) with cleavage site FT probability 0.498 between residues 25 and 26" FT misc_feature 705561..705902 FT /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug FT Domain, score 4.3e-21" FT /inference="protein motif:Pfam:PF07715" FT misc_feature 706719..707537 FT /note="HMMPfam hit to PF00593, TonB dependent FT receptor,score 2.4e-27" FT /inference="protein motif:Pfam:PF00593" FT CDS 707840..708634 FT /transl_table=11 FT /gene="hrcA" FT /locus_tag="Cj0757" FT /product="putative heat shock regulator" FT /note="Original (2000) note: Cj0757, hrcA, possible heat FT shock regulator, len: 264 aa; identical to TR:O69296 FT (EMBL:Y17165) C. jejuni heat shock regulator (fragment) (95 FT aa), and similar to HRCA_LACLA heat-inducible transcription FT repressor HRCA (347 aa), fasta scores; opt: 176 z-score: FT 220.8 E(): 5.3e-05, 23.6% identity in 276 aa overlap. 27.6% FT identity to HP0111" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni, however, not sure about the overall FT similarity of the encoded polypeptide to other bacterial FT HrcA proteins (PMID:10024560). Thus, putative kept in FT product function. Functional classification - FT Chaperones,chaperonins, heat shock" FT /note="PMID:10024560" FT /db_xref="GOA:Q9PPG2" FT /db_xref="InterPro:IPR002571" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPG2" FT /protein_id="CAL34885.1" FT /translation="MMKSRDKKDLILESIIQTYLLDNAPIGSNELNSNLCIPASTIRVY FT LKRLSDEGLITQLHISSGRIPTILTMQNYWQNFWEKEQDKNIHIKNESFLKELSKEFEI FT YCLVYGGRSLVLKEVLDLNTKFIVLDFEDEELVLKYEKEAWNFLQSLIGLDLSSIEKIA FT LRVHFIDLVEKIASLRQNLICYRSNEERAYQIYQNDEFVKLLDCQIHRHFKESLEFEPL FT FKEGFMGLKVDAQFLGEDVNIILAGSVYTDYKKILQYIKEAA" FT CDS 708631..709161 FT /transl_table=11 FT /gene="grpE" FT /locus_tag="Cj0758" FT /product="heat shock protein GrpE" FT /note="Original (2000) note: Cj0758, grpE, heat shock FT protein, len: 176 aa; almost identical to TR:O69297 FT (EMBL:Y17165) C. jejuni grpE; 98.3% identity in 176 aa FT overlap, and similar to e.g. GRPE_STAAU GRPE protein FT (HSP20) (208 aa), fasta scores; opt: 399 z-score: 425.7 FT E(): 2e-16, 38.5% identity in 187 aa overlap. 35.8% FT identity to HP0110. Contains Pfam match to entry PF01025 FT GrpE" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni and others to GrpE protein. Putative FT not added to product function. Functional classification FT -Chaperones, chaperonins, heat shock" FT /note="PMID:10024560" FT /db_xref="GOA:O69297" FT /db_xref="InterPro:IPR000740" FT /db_xref="InterPro:IPR009012" FT /db_xref="InterPro:IPR013805" FT /db_xref="UniProtKB/Swiss-Prot:O69297" FT /inference="protein motif:Pfam:PF01025" FT /protein_id="CAL34886.1" FT /translation="MSEQKQEFENENAENSEHLQDENLQNIEDVEQNKLQKDYDELKDK FT YMRANAEFENIKKRMEKEKLSAMAYANESFAKDLLDVLDALEAAVNVECQDEISLKIKE FT GVQNTLDLFLKKLEKHGVALIKDEKEFDPNLHEAMFHVDSENHQSGEVVQVLQKGYKIA FT DRVIRPTKVSVAK" FT misc_feature 708664..709158 FT /note="HMMPfam hit to PF01025, GrpE, score 4.9e-55" FT /inference="protein motif:Pfam:PF01025" FT CDS 709183..711054 FT /transl_table=11 FT /gene="dnaK" FT /locus_tag="Cj0759" FT /product="heat shock protein DnaK" FT /note="Original (2000) note: Cj0759, dnaK, heat shock FT protein (hsp70), len: 623 aa; identical to TR:O69298 FT (EMBL:Y17165) C. jejuni dnaK, and similar to e.g. FT DNAK_BRAJA DNAK protein (heat shock protein 70) (633 FT aa),fasta scores; opt: 2452 z-score: 2295.1 E(): 0, 62.3% FT identity in 623 aa overlap. 78.2% identity to HP0109. FT Contains PS00297, PS00329 and PS01036 Heat shock hsp70 FT proteins family signatures 1, 2 and 3, and Pfam match to FT entry PF00012 HSP70" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni and others to DnaK protein. Putative FT not added to product function. Functional classification FT -Chaperones, chaperonins, heat shock" FT /note="PMID:10024560" FT /db_xref="GOA:O69298" FT /db_xref="InterPro:IPR001023" FT /db_xref="InterPro:IPR012725" FT /db_xref="InterPro:IPR013126" FT /db_xref="InterPro:IPR018181" FT /db_xref="UniProtKB/Swiss-Prot:O69298" FT /inference="protein motif:Pfam:PF00012" FT /inference="protein motif:Prosite:PS01036" FT /inference="protein motif:Prosite:PS00329" FT /inference="protein motif:Prosite:PS00297" FT /protein_id="CAL34887.1" FT /translation="MSKVIGIDLGTTNSCVAVYERGESKVIPNKEGKNTTPSVVAFTDK FT GEVLVGDSAKRQAVTNPEKTIYSIKRIMGLMINEDAAKEAKNRLPYHITERNGACAIEI FT AGKIYTPQEISAKVLMKLKEDAEAFLGESVTDAVITVPAYFNDAQRKATKEAGTIAGLN FT VLRIINEPTSAALAYGLDKKDSEKIVVYDLGGGTFDVTVLETGDNVVEVLATGGNAFLG FT GDDFDNKLIDFLANEFKDETGIDLKNDVMALQRLKEAAENAKKELSSANETEINLPFIT FT ADASGPKHLVKKLTRAKFEGMIDSLVAETITKINEVVSDAGLKKDEIKEIVMVGGSTRV FT PLVQEEVKKAFNKDLNKSVNPDEVVAIGAAIQGAVIKGDVKDVLLLDVTPLSLGIETLG FT GVMTKIIEKGTTIPTKKEQVFSTAEDNQSAVTINVLQGEREFSRDNKSLGNFNLEGIPP FT APRGMPQIEVTFDIDANGILTVSAKDKATGKAQEIKITGSSGLSEEEINNMVKDAELHK FT EEDKKRKEAVDARNAADSLAHQVEKSLSELGEKVAAADKENIQKALDDLRETLKNQNAS FT KEEIESKMKALSEVSHKLAENMYKKDEPNTANDKKKKDDDVIDAEVE" FT misc_feature 709192..710982 FT /note="HMMPfam hit to PF00012, Hsp70 protein, score 0" FT /inference="protein motif:Pfam:PF00012" FT misc_feature 709201..709224 FT /note="PS00297 Heat shock hsp70 proteins family signature FT 1" FT /inference="protein motif:Prosite:PS00297" FT misc_feature 709750..709791 FT /note="PS00329 Heat shock hsp70 proteins family signature FT 2" FT /inference="protein motif:Prosite:PS00329" FT misc_feature 710173..710217 FT /note="PS01036 Heat shock hsp70 proteins family signature FT 3" FT /inference="protein motif:Prosite:PS01036" FT CDS 711314..712336 FT /transl_table=11 FT /locus_tag="Cj0760" FT /product="hypothetical protein Cj0760" FT /note="Original (2000) note: Cj0760, unknown, len: 340 aa; FT similar to hypothetical proteins e.g. YZ34_MYCTU FT Rv0906,(MTCY31.34) (372 aa), fasta scores; opt: 598 FT z-score: 724.2 E(): 4.8e-33, 29.9% identity in 335 aa FT overlap. Some similarity in C-terminus to ROMA_KLEPN outer FT membrane protein roma (fragment) (132 aa), fasta scores; FT opt: 335 z-score: 415.0 E(): 8.1e-16, 43.0% identity in 114 FT aa overlap. No Hp match" FT /note="Updated (2006) note: Literature search identified FT paper giving clues to product function. Product function FT modified based on literature search. Putative kept within FT product function. Functional classification - Conserved FT hypothetical proteins" FT /note="PMID:15758238" FT /db_xref="GOA:Q0PAD0" FT /db_xref="InterPro:IPR001279" FT /db_xref="InterPro:IPR024884" FT /db_xref="UniProtKB/TrEMBL:Q0PAD0" FT /protein_id="CAL34888.1" FT /translation="MNLSFKIFDISNTQRSKAKKVQGKKYEIFLNENEHSLITPKVSFK FT EILRYYYLYPKNAIPSFKLPFFKPDLSGFSTPHITWLGHSSLFISFKEYKILIDPIFNT FT HASPISFINKAFKNAPVYNINDFNEIFAVIITHSHFDHLDAKSVKALKDKAKFFITPLK FT VGNYLKSYGVSEKKIIELDWWSGIEFGDLKIMATPAQHSSSRGDGKNKTLWASFVMEFL FT SVDKRVFFSADGGYFTHFKKIGEYFGSFDLACLESGQFNIAWPYSHSFPEQILKEAKDL FT NAKAVMPIHWGRFLAGTHAWNEVVKFLYENLDLPLITPKMGEAYEVGAKFKQDFWWKEE FT " FT CDS 712406..712747 FT /transl_table=11 FT /locus_tag="Cj0761" FT /product="hypothetical protein Cj0761" FT /note="Original (2000) note: Cj0761, unknown, len: aa; FT similar to hypothetical proteins e.g. TR:O67079 FT (EMBL:AE000715) Aquifex aeolicus AQ_943 (107 aa), fasta FT scores; opt: 130 z-score: 186.5 E(): 0.0043, 28.6% identity FT in 84 aa overlap. 55.8% identity to HP0902" FT /note="Updated (2006) note: Literature search identified FT paper giving clues to product function. Functional FT classification - Conserved hypothetical proteins" FT /note="PMID:15758235" FT /db_xref="InterPro:IPR011051" FT /db_xref="InterPro:IPR014710" FT /db_xref="UniProtKB/TrEMBL:Q0PAC9" FT /protein_id="CAL34889.1" FT /translation="MKIIQWNGAEFSPKEVKINVLIDNEKGKEIQILLAKDSVMKEHKA FT PFAIHVQVLSGKIWFEVEKEKFELNALDMISLEANVAHSLGGLENSIIRLSLNKSDSVQ FT RVNAVLKKP" FT CDS complement(712797..713966) FT /transl_table=11 FT /gene="aspB" FT /locus_tag="Cj0762c" FT /product="aspartate aminotransferase" FT /EC_number="2.6.1.1" FT /note="Original (2000) note: Cj0762c, aspB, probable FT aspartate aminotransferase, len: 389 aa; similar to e.g. FT AAT1_BACSU aspartate aminotransferase (EC 2.6.1.1) (393 FT aa), fasta scores; opt: 1216 z-score: 1352.8 E(): 0, 50.6% FT identity in 393 aa overlap. 57.5% identity to HP0672. FT Contains Pfam match to entry PF00155 FT aminotran_1,Aminotransferases class-I" FT /note="Updated (2006) note: Characterised in Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Amino acid FT biosynthesis - Aspartate family" FT /note="PMID:10712618" FT /db_xref="GOA:Q0PAC8" FT /db_xref="InterPro:IPR001176" FT /db_xref="InterPro:IPR004839" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:Q0PAC8" FT /inference="protein motif:Pfam:PF00155" FT /protein_id="CAL34890.1" FT /translation="MLTKRSQVLEESITLAITALANELKAKGEDIISFSAGEPDFDTPQ FT TIKNAAISAIEKGCGKYTAVAGIPEVLKAIQTKFKKDNNLDYETNEIITNVGAKHSLFE FT CIECLVEKDDEVIIPSPYWVSYPEMVKFAGGKPVFIEGLEENGFKITAEQLKKAITAKT FT KVLMLNSPSNPVGSIYSKEELTQIAKVLEGTQITVLSDEMYEKLRYDGFDFVAFASVSK FT DALKRTVTINGLSKCGAMPGWRFGYMASKNKALISAVKRLQGQSTSNICSITQHAAIPA FT LNGECDKDIEKMRQAFEKRRNLALDILKQIPNISVYKPEGAFYLFVNIQKIEKDSMKFC FT QKLLEQEKVAVVPGVGFGMDGYFRLSYATSDELIKKGLERIANFIKNYK" FT misc_feature complement(712812..713738) FT /note="HMMPfam hit to PF00155, Aminotransferase class I and FT II, score 5.3e-50" FT /inference="protein motif:Pfam:PF00155" FT CDS complement(714138..714776) FT /transl_table=11 FT /gene="cysE" FT /locus_tag="Cj0763c" FT /product="serine acetyltransferase" FT /EC_number="2.3.1.30" FT /note="Original (2000) note: Cj0763c, cysE, probable serine FT acetyltransferase, len: 212 aa; highly similar to many e.g. FT CYSE_BACSU serine acetyltransferase (EC 2.3.1.30) (217 aa), FT fasta scores; opt: 598 z-score: 700.2 E(): 1e-31, 46.6% FT identity in 204 aa overlap. 50.9% identity to HP1210. FT Contains PS00101 Hexapeptide-repeat containing-transferases FT signature and 2x Pfam match to entry PF00132 hexapep, FT Bacterial transferase hexapeptide (four repeats)" FT /note="Updated (2006) note: Characterised in Bacillus FT subtilis with acceptable identity score. Putative not added FT to product function. Functional classification -Amino acid FT biosynthesis - Serine family" FT /note="PMID:7510287" FT /db_xref="GOA:Q0PAC7" FT /db_xref="InterPro:IPR001451" FT /db_xref="InterPro:IPR005881" FT /db_xref="InterPro:IPR011004" FT /db_xref="InterPro:IPR018357" FT /db_xref="UniProtKB/TrEMBL:Q0PAC7" FT /inference="protein motif:Pfam:PF00132" FT /inference="protein motif:Prosite:PS00101" FT /protein_id="CAL34891.1" FT /translation="MNFWGIIKEDFSQPKAQDPAFNSCIELFFNYPGVWAVVNYRFAHF FT FYIRNFKRIARMISGISQFLTGVDLHPGAELGRRIFIDHANGVVIGQTAIIEDDVLIYQ FT GVTLGGTSLEKGTKRHPTIKKGVIIGSGAKVLGNITIGENAKIGSNAVVVKDIGANLTA FT VGIPAYIIEERKNKNIRAIDANCDDKLEKLEKKILELENLILKQPESQK" FT misc_feature complement(714306..714392) FT /note="PS00101 Hexapeptide-repeat containing-transferases FT signature" FT /inference="protein motif:Prosite:PS00101" FT misc_feature complement(714312..714365) FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 0.31" FT /inference="protein motif:Pfam:PF00132" FT misc_feature complement(714366..714419) FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 17" FT /inference="protein motif:Pfam:PF00132" FT misc_feature complement(714447..714500) FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (three rep, score 0.077" FT /inference="protein motif:Pfam:PF00132" FT CDS complement(714777..716612) FT /transl_table=11 FT /gene="speA" FT /locus_tag="Cj0764c" FT /product="biosynthetic arginine decarboxylase" FT /EC_number="4.1.1.19" FT /note="Original (2000) note: Cj0764c, speA, probable FT biosynthetic arginine decarboxylase, len: 611 aa; similar FT to many e.g. SPEA_ECOLI biosynthetic arginine decarboxylase FT (EC 4.1.1.19) (658 aa), fasta scores; opt: 1077 z-score: FT 1198.7 E(): 0, 36.1% identity in 613 aa overlap. 62.6% FT identity to HP0422. Contains PS00878 Orn/DAP/Arg FT decarboxylases family 2 pyridoxal-P attachment site, and 2x FT Pfam match to entry PF00278 FT Orn_DAP_Arg_deC,Pyridoxal-dependent decarboxylase" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with acceptable identity score. Putative not added to FT product function. Functional classification - Polyamine FT synthesis" FT /note="PMID:2198270" FT /db_xref="GOA:Q0PAC6" FT /db_xref="InterPro:IPR000183" FT /db_xref="InterPro:IPR002985" FT /db_xref="InterPro:IPR009006" FT /db_xref="InterPro:IPR022643" FT /db_xref="InterPro:IPR022644" FT /db_xref="InterPro:IPR022653" FT /db_xref="PDB:3NZP" FT /db_xref="UniProtKB/TrEMBL:Q0PAC6" FT /inference="protein motif:Pfam:PF00278" FT /inference="protein motif:Prosite:PS00878" FT /protein_id="CAL34892.1" FT /translation="MMDYGIDIWGNENFIIKNGKVCINYEKKPAIIDIVKELRDDGYKG FT PLLLRFPHLIQKQIENIYGNFNKARKEFGYKGGFNAVYPLKVNQYPGFVKNLVKLGKDY FT NYGLEAGSKAELLLAMAYNNEGAPITVNGFKDRELINIGFIAAEMGHNITLTIEGLNEL FT EAIIDIAKERFKPKPNIGLRVRLHSAGVGIWAKSGGINSKFGLTSTELIEAVNLLKENK FT LLEQFTMIHFHLGSQITEIHPLKKALNEAGNIYTELRKMGAKNLKAINLGGGLAVEYSQ FT FKNEKSRNYTLREYANDVVFILKNIAEQKKDLEPDIFIESGRFVAANHAVLIAPVLELF FT SQEYAENKLILKKQNPKLIDELYDLYKSIKPSNALEYLHDSIDHLESILTLFDLGYVDL FT QDRSNAEILTHLITKKAILLLGDKQNPADLLAIQDEVQERYLVNFSLFQSMPDFWGLEQ FT NFPIMPLDRLDEEPTRSASIWDITCDSDGEISYSKDKPLFLHDVDVEKENYFLGFFLVG FT AYQEVLGMKHNLFTHPTEAIISINEKGYEVEGIIEAQSILDTLEDLDYDIHAIMDILNE FT RISNSKLVNDKQKKHILGELYLFLNDNGYLKSIGV" FT misc_feature complement(714996..715397) FT /note="HMMPfam hit to PF00278, Pyridoxal-dependent FT decarboxylase, C-, score 2.2e-08" FT /inference="protein motif:Pfam:PF00278" FT misc_feature complement(715629..716441) FT /note="HMMPfam hit to PF02784, Pyridoxal-dependent FT decarboxylase, py, score 1.7e-39" FT /inference="protein motif:Pfam:PF02784" FT misc_feature complement(716310..716366) FT /note="PS00878 Orn/DAP/Arg decarboxylases family 2 FT pyridoxal-P attachment site" FT /inference="protein motif:Prosite:PS00878" FT CDS complement(716609..717835) FT /transl_table=11 FT /gene="hisS" FT /locus_tag="Cj0765c" FT /product="histidyl-tRNA synthetase" FT /EC_number="6.1.1.21" FT /note="Original (2000) note: Cj0765c, hisS, probable FT histidyl-tRNA synthetase, len: 408 aa; similar to many e.g. FT SYH_ECOLI histidyl-tRNA synthetase (EC 6.1.1.21) (423 aa), FT fasta scores; opt: 927 z-score: 1052.2 E(): 0, 37.6% FT identity in 407 aa overlap. 29.8% identity to HP1190. FT Contains PS00339 Aminoacyl-transfer RNA synthetases FT class-II signature 2 and Pfam match to entry PF00587 FT tRNA-synt_2b, tRNA synthetases class II (Gly, His, Pro and FT Ser)" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with acceptable identity score. Putative not added to FT product function. Functional classification - Aminoacyl FT tRNA synthetases and their modification" FT /note="PMID:2991272" FT /db_xref="GOA:Q9PPF4" FT /db_xref="InterPro:IPR002314" FT /db_xref="InterPro:IPR004154" FT /db_xref="InterPro:IPR004516" FT /db_xref="InterPro:IPR006195" FT /db_xref="InterPro:IPR015807" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPF4" FT /inference="protein motif:Pfam:PF00587" FT /inference="protein motif:Prosite:PS00339" FT /protein_id="CAL34893.1" FT /translation="MINALKGMKDLLDKDAYYYEKVIKICEEVAKNYGFTFINTPHLEL FT CTLFKRSVGESSDIVGKEMYEFIDKGENHVCMRPEGTAGVVRAYIEKKLDKNTSVKRWF FT YYGSMFRYERPQKGRLREFHQFGVESLGIPNVYEDASIILMLVEIFSRLGIDFKLQLNS FT LGCSQCLPKYRDRLVEFLDSKEGFCEDCLRRKNLNPIRVLDCKNEHCQNLLENAPLLIN FT NLCTSCQKDFETLQQILKDNGVKFELDSKLVRGLDYYSKTAFEFISDEIGAKAAIAGGG FT RYDRLIEYLGGKSGYGIGFAMGIERIITILEQKEEKIQREGIYLCAMDEIYIQKLLHIA FT TNLRKEYKVLLSYEARKLAKHLENADKNNTEIFLCMGENEAQNESLFYKNLAKKEEKMI FT KISDLKKVL" FT misc_feature complement(716612..716872) FT /note="HMMPfam hit to PF03129, Anticodon binding FT domain,score 0.018" FT /inference="protein motif:Pfam:PF03129" FT misc_feature complement(716906..716935) FT /note="PS00339 Aminoacyl-transfer RNA synthetases class-II FT signature 2" FT /inference="protein motif:Prosite:PS00339" FT misc_feature complement(717365..717817) FT /note="HMMPfam hit to PF00587, tRNA synthetase class II FT core domain (, score 1.5e-36" FT /inference="protein motif:Pfam:PF00587" FT CDS complement(717832..718410) FT /transl_table=11 FT /gene="tmk" FT /locus_tag="Cj0766c" FT /product="thymidylate kinase" FT /EC_number="2.7.4.9" FT /note="Original (2000) note: Cj0766c, tmk, probable FT thymidylate kinase, len: 192 aa; similar to many e.g. FT KTHY_ECOLI thymidylate kinase (EC 2.7.4.9) (DTMP KINAS (213 FT aa), fasta scores; opt: 181 z-score: 222.6 E(): 4.2e-05, FT 28.2% identity in 202 aa overlap. 48.5% identity to HP1474. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF02223 Thymidylate FT kinase and Prosite domain PS01331 THYMIDYLATE_KINASE, FT Thymidylate kinase identified within CDS. Further support FT given to product function. Characterised within Escherichia FT coli, however, identity was marginal. Putative removed from FT product function. Functional classification - FT 2'-deoxyribonucleotide biosynthesis" FT /note="PMID:8631667" FT /db_xref="GOA:Q9PPF3" FT /db_xref="InterPro:IPR018094" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPF3" FT /inference="protein motif:Pfam:PF02223" FT /inference="protein motif:Prosite:PS00017" FT /inference="protein motif:Prosite:PS01331" FT /protein_id="CAL34894.1" FT /translation="MYVVFEGIDCVGKSTQISLLKEIYKDAIFTLEPGGTELGKHLREI FT LLNKTHPINKRAELLLFLADRAQHFEEILKTNQNKLIISDRSFISGMAYAKDFENDLLF FT ALNSFALENFFPQKIIFLKGDANLIQERLSQKELDSIEKRGIEYFLSVQDKLEKVLHFL FT KEKISVEILTLDAKESKEKLHQQIKEFLQ" FT misc_feature complement(717850..718398) FT /note="HMMPfam hit to PF02223, Thymidylate kinase, score FT 5.9e-33" FT /inference="protein motif:Pfam:PF02223" FT misc_feature complement(718126..718164) FT /note="PS01331 Thymidylate kinase signature" FT /inference="protein motif:Prosite:PS01331" FT misc_feature complement(718369..718392) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(718401..718877) FT /transl_table=11 FT /gene="coaD" FT /locus_tag="Cj0767c" FT /product="phosphopantetheine adenylyltransferase" FT /EC_number="2.7.7.3" FT /note="Original (2000) note: Cj0767c, kdtB, probable FT 3-deoxy-D-manno-octulosonic-acid transferase, len: 158 aa; FT highly similar to e.g. KDTB_ECOLI lipopolysaccharide core FT biosynthesis protein (159 aa)opt: 507 z-score: 656.5 E(): FT 2.9e-29, 48.3% identity in 145 aa overlap. 57.0% identity FT to HP1475" FT /note="Updated (2006) note: Pfam domain PF01467 FT Cytidylyltransferase identified within CDS. Characterised FT within Escherichia coli with acceptable identity score. FT This particular piece of research demonstrates a new FT function and gene name for Cj0767c. Putative not added to FT product function. Functional classification - Biosynthesis FT of cofactors, prosthetic groups and carriers -Pantothenate" FT /note="PMID:15866922, PMID:10480925" FT /db_xref="GOA:Q9PPF2" FT /db_xref="InterPro:IPR001980" FT /db_xref="InterPro:IPR004820" FT /db_xref="InterPro:IPR004821" FT /db_xref="InterPro:IPR014729" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPF2" FT /inference="protein motif:Pfam:PF01467" FT /protein_id="CAL34895.1" FT /translation="MTCLYPGTFDPITNGHLDVIKRALKIFDEVIVAIAKSEHKKPCYD FT LEKRKELALLATQNLKNVKIIAFDNLLVDLAKELKVNTIIRGLRAVSDFEYELQIGYAN FT HALWEDMETIYLMPSLKHAFISSSIVRSIVAHGGDVSSLVPKEILPFLKDQSCM" FT misc_feature complement(718479..718868) FT /note="HMMPfam hit to PF01467, Cytidylyltransferase, score FT 1.9e-29" FT /inference="protein motif:Pfam:PF01467" FT CDS complement(718917..719480) FT /transl_table=11 FT /locus_tag="Cj0768c" FT /product="putative decarboxylase" FT /EC_number="4.1.1.-" FT /note="Original (2000) note: Cj0768c, probable FT decarboxylase, len: 187 aa; similar to e.g. UBIX_ECOLI FT 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (189 aa),fasta FT scores; opt: 366 z-score: 476.9 E(): 2.9e-19, 34.0% FT identity in 188 aa overlap, and PAD1_YEAST phenylacrylic FT acid decarboxylase (242 aa), fasta scores; opt: 370 FT z-score: 480.4 E(): 1.8e-19, 34.1% identity in 185 aa FT overlap. 39.1% identity to HP1476" FT /note="Updated (2006) note: Pfam domain PF02441 FT Flavoprotein identified within CDS. No specific FT characterisation with acceptable identity score carried out FT yet. Putative kept within product function. Functional FT classification - Misc" FT /db_xref="GOA:Q9PPF1" FT /db_xref="InterPro:IPR003382" FT /db_xref="InterPro:IPR004507" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPF1" FT /inference="protein motif:Pfam:PF02441" FT /protein_id="CAL34896.1" FT /translation="MKVLLGISGSSSVNLGLKLLKNLENQCELYCILTQGAKLNFKTEN FT QANLEEICQENFKYTHFLDDKNLSLSVASGSFGIEKTIIAPCSISSLAKIHAGFADTLL FT MRAAAVALKERKKLILGVREMPFSTLNLEHMLKLSQMGVIIAPPIIASYSKANNLEQME FT NFIAGKWLDLLEIKHNLYEKWQNF" FT misc_feature complement(719112..719480) FT /note="HMMPfam hit to PF02441, Flavoprotein, score 2.5e-29" FT /inference="protein motif:Pfam:PF02441" FT CDS complement(719477..720139) FT /transl_table=11 FT /gene="flgA" FT /locus_tag="Cj0769c" FT /product="putative flagellar protein FlgA" FT /note="Original (2000) note: Cj0769c, probable periplasmic FT protein, len: 220 aa; 29.8% identity to HP1477. Contains FT N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF03240 FlgA family FT protein identified within CDS. The FlgA protein is involved FT in the assembly of the flageller P-ring. It may associate FT with FlgF on the rod constituting a structure essential for FT the P-ring assembly, or may act as a modulator protein for FT P-ring assembly. Product modified to more specific family FT member due to motif match. Characterisation work in more FT than one species with marginal identity scores. Putative FT kept within product function. Functional classification - FT Surface structures" FT /note="PMID:15817382, PMID:2129540, PMID:10832645" FT /db_xref="GOA:Q0PAC1" FT /db_xref="InterPro:IPR017585" FT /db_xref="UniProtKB/TrEMBL:Q0PAC1" FT /inference="protein motif:Pfam:PF03240" FT /protein_id="CAL34897.1" FT /translation="MKIIFLTFFIVINYIQAASLEEIKTALAKEFRNNFPKIIISQIDL FT KITSLPKDFDQYEFLRIANGRFNQAQGFLRAEFKTPQNIQKNVFFRYFIQANLEVLKSE FT RAIKRGDKLGAFDYKSVLIDFDKVPLNALTLDDVDNLVAKSNINKNAILRANMFKTTAL FT IRRNDPIIGVLSEANVDVLIELVALQSANMGERIRAKNKEGKVMQGIVVGKNRMIIQ" FT misc_feature complement(719480..719962) FT /note="HMMPfam hit to PF03240, FlgA family, score 8e-05" FT /inference="protein motif:Pfam:PF03240" FT CDS complement(720223..720999) FT /transl_table=11 FT /locus_tag="Cj0770c" FT /product="putative NLPA family lipoprotein" FT /note="Original (2000) note: Cj0770c, probable periplasmic FT protein, len: 258 aa; similar to lipoproteins from other FT organisms e.g. PLPC_PASHA outer membrane lipoprotein 3 FT precursor (263 aa), fasta scores; opt: 569 z-score: 657.0 FT E(): 2.7e-29, 38.9% identity in 265 aa overlap, and FT TR:O69441 (EMBL:AJ005668) Legionella pneumophila 29 kda FT immunogenic protein (259 aa), fasta scores; opt: 584 FT z-score: 674.2 E(): 3e-30, 41.0% identity in 261 aa FT overlap. Also similar to Cj0772c (55.0% identity), Cj0771c FT (54.8% identity) and Cj1200 (44.9% identity). Single copy FT in Hp (HP1564)" FT /note="Updated (2006) note: Pfam domain PF03180 NLPA FT lipoprotein identified within CDS. NLPA lipoproteins are a FT family of bacterial lipoproteins that contain many FT antigenic members, which may be involved in bacterial FT virulence. The function is currently unknown. Product FT modified to more specific family member due to motif match. FT Some characterisation work in more than one species. Highly FT similar to Cj0771c and Cj0772c. Putative kept within FT product function. Functional classification -Miscellaneous FT periplasmic proteins" FT /note="PMID:12169620" FT /db_xref="InterPro:IPR004872" FT /db_xref="UniProtKB/TrEMBL:Q0PAC0" FT /inference="protein motif:Pfam:PF03180" FT /protein_id="CAL34898.1" FT /translation="MNIKKIFLSVLFTISLSFGADKTIIIGATPTPYAEILNFSKPLFQ FT EKGWKLIVKEFNDYNIPNIALNEKDLDANLYQHKPFLDDFNTHKGTKLSSLGAIVLVPM FT AIYSNSIKDIKDIPNGAKIAIPNDATNESRALDLLAKANLIEFKSQSTLKTPIDISKNP FT KKLKFIELKAAQLPRALNDTDLAIITTNYALGAGLNPLKDGIFMEDKDSLYAIVLATRK FT GEETSQKSLVIKEILTSDKIKNFIIEKYKGSVIPTF" FT misc_feature complement(720226..720930) FT /note="HMMPfam hit to PF03180, NLPA lipoprotein, score FT 5.2e-129" FT /inference="protein motif:Pfam:PF03180" FT misc_feature complement(720913..720981) FT /note="1 probable transmembrane helix predicted for Cj0770c FT by TMHMM2.0 at aa 7-29" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(720919..720999) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000359_720223_720999 by SignalP 2.0 FT HMM (Signal peptide probability 0.996) with cleavage site FT probability 0.413 between residues 27 and 28" FT CDS complement(721009..721779) FT /transl_table=11 FT /locus_tag="Cj0771c" FT /product="putative NLPA family lipoprotein" FT /note="Original (2000) note: Cj0771c, probable periplasmic FT protein, len: 258 aa; similar to lipoproteins from other FT organisms e.g. NLPA_ECOLI lipoprotein-28 precursor (272 FT aa), fasta scores; opt: 623 z-score: 705.2 E(): FT 5.6e-32,46.4% identity in 237 aa overlap, and TR:O69441 FT (EMBL:AJ005668) Legionella pneumophila 29 kda immunogenic FT protein (259 aa), fasta scores; opt: 661 z-score: 747.9 FT E(): 0, 44.2% identity in 258 aa overlap. Also similar to FT Cj0772c (52.5% identity), Cj0770c (54.8% identity) and FT Cj1200 (45.6% identity). Single copy in Hp (HP1564)" FT /note="Updated (2006) note: Pfam domain PF03180 NLPA FT lipoprotein identified within CDS. NLPA lipoproteins are a FT family of bacterial lipoproteins that contain many FT antigenic members, which may be involved in bacterial FT virulence. The function is currently unknown. Product FT modified to more specific family member due to motif match. FT Some characterisation in more than one species. Also FT similar to Cj0770c and Cj0772c. Putative kept within FT product function. Functional classification -Miscellaneous FT periplasmic proteins" FT /note="PMID:12169620" FT /db_xref="InterPro:IPR004872" FT /db_xref="UniProtKB/TrEMBL:Q0PAB9" FT /inference="protein motif:Pfam:PF03180" FT /protein_id="CAL34899.1" FT /translation="MNLFKIIILACILNLSSLFAQNITIGATPNPFGSLLELMKDDFKN FT KGYELKIVEFSDYILPNRALEEKELDANLYQHKPFLEEYNLKKGSNLIATTPVLIAPVG FT VYSKKIKNLENLKEGARVAIPNDATNESRALELLEKAKLIELNKNTLKTPLDINKNPKK FT LKFIELKAAQLPRALDDVDIAIINSNFALGAGLNPSKDTIFREDKNSPYVNYVVVRSEG FT KNSEKTKVIDEILRSDKFKAIINEHYKDILIPAF" FT misc_feature complement(721012..721713) FT /note="HMMPfam hit to PF03180, NLPA lipoprotein, score FT 2.2e-132" FT /inference="protein motif:Pfam:PF03180" FT sig_peptide complement(721699..721779) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000360_721009_721779 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.913 between residues 27 and 28" FT CDS complement(721828..722601) FT /transl_table=11 FT /locus_tag="Cj0772c" FT /product="putative NLPA family lipoprotein" FT /note="Original (2000) note: Cj0772c, probable periplasmic FT protein, len: 258 aa; similar to lipoproteins from other FT organisms e.g. PLPC_PASHA outer membrane lipoprotein 3 FT precursor (263 aa), fasta scores; opt: 642 z-score: 721.7 FT E(): 6.7e-33. 40.8% identity in 260 aa overlap, and FT TR:O69441 (EMBL:AJ005668) Legionella pneumophila 29 kda FT immunogenic protein (259 aa), fasta scores; opt: 638 FT z-score: 717.3 E(): 1.2e-32. 39.8% identity in 259 aa FT overlap. Also similar to Cj0770c (55.0% identity), Cj0771c FT (52.5% identity) and Cj1200 (57.5% identity). Single copy FT in Hp (HP1564; 47.7% identity in 243 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF03180 NLPA FT lipoprotein identified within CDS. NLPA lipoproteins are a FT family of bacterial lipoproteins that contain many FT antigenic members, which may be involved in bacterial FT virulence. The function is currently unknown. Product FT modified to more specific family member due to motif match. FT Some characterisation in more than one species. Also FT similar to Cj0770c and Cj0771c. Putative kept within FT product function. Functional classification -Miscellaneous FT periplasmic proteins" FT /note="PMID:12169620" FT /db_xref="InterPro:IPR004872" FT /db_xref="UniProtKB/TrEMBL:Q0PAB8" FT /inference="protein motif:Pfam:PF03180" FT /protein_id="CAL34900.1" FT /translation="MKIKSLFIASILTLSLNANALETITVAATPVPHAEILEQVKPDLE FT KQGYKLEIKEFTDYVLPNLAVDNGEADANFFQHTPYLEEFNKNKGTKLIKVAAIHIEPM FT AVYSKKYKSLDDIKEGVKIAIPNDPTNESRALDIIAKKGLVKFKDKALKTPLDIIDNPK FT KIKFVELKPAQLPRALNDVDFAVINSNYALSANLNPAKDSVFIEDKESPYANILVVRVG FT HENDPKIKALIQALQSDKIKQFIIEKYNGSVLPAF" FT misc_feature complement(721831..722532) FT /note="HMMPfam hit to PF03180, NLPA lipoprotein, score FT 1.1e-145" FT /inference="protein motif:Pfam:PF03180" FT misc_feature complement(722515..722601) FT /note="PS00430 TonB-dependent receptor proteins signature FT 1" FT /inference="protein motif:Prosite:PS00430" FT sig_peptide complement(722518..722601) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000361_721828_722601 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.862 between residues 28 and 29" FT CDS complement(722791..723702) FT /transl_table=11 FT /locus_tag="Cj0773c" FT /product="putative binding-protein dependent transport FT system permease protein" FT /note="Original (2000) note: Cj0773c, probable FT binding-protein dependent transport system permease FT protein, len: 303 aa; similar to many e.g. PROW_BACSU FT glycine betaine/L-proline transport system permease protein FT (217 aa), fasta scores; opt: 212 z-score: 249.9 E(): FT 1.3e-06, 30.0% identity in 190 aa overlap. 43.9% identity FT in 205 aa overlap to HP1577. Contains Pfam match to entry FT PF00528 BPD_transp, Binding-protein-dependent transport FT systems inner membrane component" FT /note="Updated (2006) note: Seven probable transmembrane FT helices predicted by TMHMM2.0. Further support given to FT product function. No specific characterisation with FT acceptable identity score carried out yet. Putative added FT to product function. Functional classification FT -Transport/binding proteins - Other" FT /note="PMID:12169620" FT /db_xref="GOA:Q0PAB7" FT /db_xref="InterPro:IPR000515" FT /db_xref="UniProtKB/TrEMBL:Q0PAB7" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00528" FT /protein_id="CAL34901.1" FT /translation="MNEENISIVSAFFSRISQFFNEFSWQDIKEVSLSSITSFNENYEN FT ILKPALNETIYMSLMAVLFGFLLAIIPGILLAIWDKNGIKENKIAYSILDFITNILRAF FT PFLILIVVLLPLSKIIVGTSIGTNAAIVPLAIGIAPYLAKMLESAFKEIDKGIIEAAKS FT YGASNIQIIFKVIFSEALPAIISGITLTLIFTIGFSALAGTVGGGGLGDVAIRYGYERF FT NKEVMIQTVVILLILVQLVQILGNLFYTWAKNSKTTYIIATLLILLGVSIVININNDEN FT FFWQVIVFILFLGSLLYKGFKK" FT misc_feature complement(join(723466..723534,723361..723429, FT 723280..723348,723085..723153,722959..723027, FT 722872..722925,722800..722859)) FT /note="7 probable transmembrane helices predicted for FT Cj0773c by TMHMM2.0 at aa 57-79, 92-114, 119-141, FT 184-206,226-248, 260-277 and 282-301" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(722941..723552) FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 1.9e-15" FT /inference="protein motif:Pfam:PF00528" FT CDS complement(723699..724709) FT /transl_table=11 FT /locus_tag="Cj0774c" FT /product="ABC transport system ATP-binding protein" FT /note="Original (2000) note: Cj0774c, probable ABC FT transport system ATP-binding protein, len: 336 aa; similar FT to many e.g. HISP_ECOLI histidine transport ATP-binding FT protein (257 aa), fasta scores; opt: 497 z-score: 566.5 FT E(): 2.9e-24, 38.5% identity in 262 aa overlap, and FT OCCP_AGRT6 octopine permease ATP-binding protein P (262 FT aa), fasta scores; opt: 511 z-score: 582.1 E(): 4e-25,36.9% FT identity in 260 aa overlap. 38.9% identity to HP1576. FT Contains PS00017 ATP/GTP-binding site motif A (P-loop), FT PS00211 ABC transporters family signature, and Pfam match FT to entry PF00005 ABC_tran" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Transport/binding proteins - Other" FT /note="PMID:3313284" FT /db_xref="GOA:Q0PAB6" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR017871" FT /db_xref="InterPro:IPR017908" FT /db_xref="InterPro:IPR018449" FT /db_xref="UniProtKB/Swiss-Prot:Q0PAB6" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34902.1" FT /translation="MIKIKNLKKYYGKELVINDVSLEIKKGEIYAIVGHSGAGKSTLLR FT CINGLENYQEGSLKVFDQEIKDLSQKKSKELRMLRKDIGMIFQNFALMERKNVFENVAM FT PLRTHYTQCKFHAKLFNKEYMSEKEIAQKVNSLLEIVGLDHKNKSYPRELSGGQKQRVA FT IARALALNPKILLSDEATSALDPNTTKNILELISKINAEFGITVVLVTHEMDVVKDIAQ FT KALLLEHGQIIGSGAIDELFLRPNAKMKEFLGESDFLPEHGLNIKLYFPKEVAQNSVIT FT HMARTLNIDFNIVWGKIEKLNGKALGNLVININEKDKDKVLDYIEKSGVLWEVAS" FT misc_feature complement(724020..724631) FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 1.8e-69" FT /inference="protein motif:Pfam:PF00005" FT misc_feature complement(724206..724250) FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature complement(724587..724610) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(724714..727326) FT /transl_table=11 FT /gene="valS" FT /locus_tag="Cj0775c" FT /product="valyl-tRNA synthetase" FT /EC_number="6.1.1.9" FT /note="Original (2000) note: Cj0775c, valS, probable FT valyl-tRNA synthetase, len: 870 aa; similar to many e.g. FT SYV_ECOLI valyl-tRNA synthetase (EC 6.1.1.9) (951 aa),fasta FT scores; opt: 1027 z-score: 1128.2 E(): 0, 38.1% identity in FT 938 aa overlap. 59.6% identity to HP1153. Contains PS00178 FT Aminoacyl-transfer RNA synthetases class-I signature, and FT Pfam match to entry PF00133 tRNA-synt_1" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Aminoacyl tRNA synthetases and their modification" FT /note="PMID:3275660" FT /db_xref="GOA:Q9PPE4" FT /db_xref="InterPro:IPR001412" FT /db_xref="InterPro:IPR002300" FT /db_xref="InterPro:IPR002303" FT /db_xref="InterPro:IPR009008" FT /db_xref="InterPro:IPR009080" FT /db_xref="InterPro:IPR010978" FT /db_xref="InterPro:IPR013155" FT /db_xref="InterPro:IPR014729" FT /db_xref="InterPro:IPR019499" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPE4" FT /inference="protein motif:Pfam:PF00133" FT /inference="protein motif:Prosite:PS00178" FT /protein_id="CAL34903.1" FT /translation="MYDKNLEKEYYQICEERGYFEIDGNKTIQEKDKNFCIMMPPPNVT FT GVLHIGHALTFTLQDIMTRYKRMDGYKVLYQPGLDHAGIATQNVVEKQLLTQGIKKEEL FT GREEFIEKVWEWKEQSGGKILDQMRTLGITPAWSRLRFTMDEGLVNAVKKAFVELYDKR FT LIVRGNYMINWCTHDGALSDIEVEYKENKGKLYHIKYFLKDSDEFLVVATTRPETFFGD FT TAVMVHPDDERYAKFVDKEVILPISKKAIKIIADKHVEKEFGTGVVKVTPAHDMNDYEV FT GLRHNLDFISVFDEKGILNEHCLEFQGLERLEAREKIVAKLESLGFIEKIEEYNNQIGY FT CYRCNNIVEPYISKQWFVKKEIAQESIEKVALGESKFYPNHWINSFNAWMKDLRDWCIS FT RQLWWGHQIPVYYCECSHEWASQHTPKTCPKCQSQNFKQDEDVLDTWFSSGLWAMSTLG FT WGNENWGKDKIWSEKDLKDFYPNSLLITGFDILFFWVARMMFQSTNVLHQLPFKDIYLH FT ALVKDEQGRKMSKSLGNVIDPNESIKEYSADILRFTLALLAIQGRDIKLSNDKLLQVRN FT FTNKIYNAKNYLLLNESKFEDLENITLHSELAKYIYAKFQTCVKDVRENLDNYRFNDAA FT NTLYKFFWDDFCDWGIELSKAEKSSVKELGSIFKEALKLLNPFMPFISEYLYHKLSDTE FT LKTSPSIMISKYPKFKEQDKNIEKIFSLLIESIVSIRRAKSLIDLGNSKIEKAYIKFND FT KKIKDEIKAYMNFIIMLAKCEQIEFSEEKLPKAICDVSENLEIFITLENVDLSGILTRL FT ENQKNKLEKESFKLNSMLSNEKFIANAPKEVVEQNKEALENLKIQLEKISVELQNLRG" FT misc_feature complement(725626..727302) FT /note="HMMPfam hit to PF00133, tRNA synthetases class I (I, FT L, M and V), score 1.7e-207" FT /inference="protein motif:Pfam:PF00133" FT misc_feature complement(727168..727203) FT /note="PS00178 Aminoacyl-transfer RNA synthetases class-I FT signature" FT /inference="protein motif:Prosite:PS00178" FT CDS complement(727349..728371) FT /transl_table=11 FT /locus_tag="Cj0776c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0776c, probable periplasmic FT protein, len: 340 aa; no Hp match. Contains N-terminal FT signal sequence. Functional classification - Miscellaneous FT periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAB4" FT /protein_id="CAL34904.1" FT /translation="MNLKIFSIIVGILIAVIVILGGTYYYLFEYSKPKNYTLNTNTYTE FT QKSYTNNYDNPYSPSIQTNNSSSNVNTNNNTIQKQETNPLLDENQSLNNDTFNISISEN FT NQSLNNDTNTSNNINTNENKQILDTDKEKLKQENKQAKIEALKKEISKQQKILERERAI FT KKELQSNKSNKNKYLNTAREYLSIGKNSRLEPELSTENMKVYILDGKFLSQYRINLLKD FT MLSIIQDNAKDYYLSIFVKMLPKGEMKLTIYNKEIIFSDMKKAYKYISLDRLSPYLNNP FT KELNEHVAREEILERLKLQIKKDGKGSDFSKHIKSLKTGLNTAQYFFPFCEIIEISSIK FT " FT misc_feature complement(728291..728359) FT /note="1 probable transmembrane helix predicted for Cj0776c FT by TMHMM2.0 at aa 5-27" FT /inference="protein motif:TMHMM:2.0" FT CDS 728500..730530 FT /transl_table=11 FT /locus_tag="Cj0777" FT /product="putative ATP-dependent DNA helicase" FT /note="Original (2000) note: Cj0777, probable ATP-dependent FT DNA helicase, len: 676 aa; similar to many members of the FT uvrD family of helicases, e.g. PCRA_STAAU ATP-dependent FT helicase PCRA (675 aa), fasta scores; opt: 561 z-score: FT 634.4 E(): 4.9e-28, 29.0% identity in 694 aa overlap, and FT REP_ECOLI ATP-dependent DNA helicase REP (673 aa), fasta FT scores; opt: 423 z-score: 478.5 E(): 2.4e-19,27.3% identity FT in 682 aa overlap. 47.5% identity to HP0911. Contains FT PS00017 ATP/GTP-binding site motif A (P-loop) and Pfam FT match to entry PF00580 UvrD-helicase,UvrD/REP helicase" FT /note="Updated (2006) note: Characterisation work carried FT out within more than one species with marginal identity FT score. Putative kept within product function. Functional FT classification - DNA replication,restriction/modification, FT recombination and repair" FT /db_xref="GOA:Q0PAB3" FT /db_xref="InterPro:IPR000212" FT /db_xref="InterPro:IPR014016" FT /db_xref="InterPro:IPR014017" FT /db_xref="UniProtKB/TrEMBL:Q0PAB3" FT /inference="protein motif:Pfam:PF00580" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34905.1" FT /translation="MPLSKLNNEQYLAATADFGHNLVIASAGTGKTSTIVARISYLLSK FT GVAPQKIMLLTFTNKASKEMIGRLGKFFDKNITSKILAGTFHSTAYTLLRNADKNIALK FT QASELKTLLKSVYEKRTFRHLSDIKPYQSSYLYDLYSLFQNKAHNQDFYTWFCQNYEDQ FT SIYAEIYEDILKEYDNEKKRFNYVDFNDLLINLKDLLKEEKYEFDEILVDEYQDTNTLQ FT SSLIEAFHSKSLFCVGDYDQSIYAFNGADINIIGGFKDRFKDAKIFSLNKNYRSSRSIL FT ALANKVILNNERLYPKELIVTRNDEFKAPSLLTFEELFDQYQNIAKMILTSGVSLEEIA FT VIFRNNSSADGVEVALREQGIASVRKGSGSFFESLEVKAFSSMLALVVNPKDIMAFIHL FT VQYTKGVGGVLAKEIFDALLKLGHGNLIKGFLDPDKNVNLQNHQKRNYQLGLFADLEEL FT ASETRFKFESEFDAHPILRLSKINDLCARNLEKIYLFLKKAMEIKHSLTLVNLICENSF FT YREICEELATKRATNKAGQVDLLRKSENLEKIETKFNVLKELTKNYSDIYKYYNFLTLG FT ASEMSSGKGVNLLSVHASKGLEFDLVFVIDLAQGRFPNQKLMGMGGSLEEERRLFYVAV FT TRAKNILYLSYAKYDKNKKTSFAPSRFLIEAGLCKGELTID" FT misc_feature 728515..729927 FT /note="HMMPfam hit to PF00580, UvrD/REP helicase, score FT 1.6e-90" FT /inference="protein motif:Pfam:PF00580" FT misc_feature 728572..728595 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 730569..731306 FT /transl_table=11 FT /gene="peb2" FT /locus_tag="Cj0778" FT /product="major antigenic peptide PEB2" FT /note="Original (2000) note: Cj0778, peb2, major antigenic FT peptide PEB2, len: 245 aa; 94.9% identical to FT TR:G234576,sequenced by direct peptide sequencing; see: J. FT Biol. Chem. 266:16363-16369 (1991). Also similar to FT TR:Q57410 (EMBL:U39068, U15606) Vibrio cholerae accessory FT colonization factor ACFC (253 aa), fasta scores; opt: 430 FT z-score: 499.2 E(): 1.7e-20, 33.9% identity in 248 aa FT overlap, and TR:P96759 (EMBL:U82533)E. coli O45 ANM protein FT (251 aa), fasta scores; opt: 417 z-score: 484.4 E(): FT 1.1e-19, 33.2% identity in 247 aa overlap. Contains FT N-terminal signal sequence" FT /note="Updated (2006) note: Characterised in Campylobacter FT jejuni in 1991. Putative not added to product function. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /note="PMID:1885571" FT /db_xref="UniProtKB/TrEMBL:Q0PAB2" FT /protein_id="CAL34906.1" FT /translation="MKKILILSLAASFLNAEILVYGPGGPAPVLKELALKFEEKTKEKV FT IVTAGPTPAWVDKAKENADLIFSGNTSMMDDFAKKIPSLSLENLSVLNVRPSGIIVRPN FT NPKNIKNFEDILKDGINVMVVDGAGQVGLYEDMALKSAKRENLVKLRKNIKIYAKNSKA FT AVDEWNNNPNIDALIIWSHWAKALGDDKALFIKDKNAVIYRAAEIAPTKKGLENKKALE FT FVDFIKSQEAQKVWKKYTWKEVK" FT sig_peptide 730569..730616 FT /note="Signal peptide predicted for peb2 by SignalP 2.0 HMM FT (Signal peptide probability 0.666) with cleavage site FT probability 0.408 between residues 16 and 17" FT CDS 731405..731932 FT /transl_table=11 FT /gene="tpx" FT /locus_tag="Cj0779" FT /product="thiol peroxidase" FT /EC_number="1.11.1.-" FT /note="Original (2000) note: Cj0779, tpx, probable thiol FT peroxidase, len: 175 aa; similar to e.g. TPX_ECOLI thiol FT peroxidase (EC 1.11.1.-) (167 aa), fasta scores; opt: 407 FT z-score: 489.0 E(): 6.1e-20, 44.2% identity in 154 aa FT overlap, and TAGD_VIBCH TAGD protein (164 aa), fasta FT scores; opt: 381 z-score: 458.8 E(): 3e-18, 39.9% identity FT in 158 aa overlap. 42.2% identity to HP0390. Contains FT PS01265 Tpx family signature, and Pfam match to entry FT PF00578 AhpC-TSA, AhpC/TSA family" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Literature search also FT revealed additional papers with experiments in FT Campylobacter. Paper identified linking protein to FT glycoprotein (PMID:12186869). Functional classification FT -Detoxification" FT /note="PMID:15632442, PMID:12069882, PMID:12186869" FT /db_xref="GOA:Q9PPE0" FT /db_xref="InterPro:IPR002065" FT /db_xref="InterPro:IPR012336" FT /db_xref="InterPro:IPR013740" FT /db_xref="InterPro:IPR018219" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPE0" FT /inference="protein motif:Pfam:PF00578" FT /inference="protein motif:Prosite:PS01265" FT /protein_id="CAL34907.1" FT /translation="MSIVNFKGNPVKLKGNSVEVGADAPKVNLKAKDLSVIEIGAAGKT FT QIILSVPSLDTPVCATEAREFNKKVASYNGAEVIVVSMDLPFAMGRFCSTEGIENLSVA FT SDFVAKEFGEKYGVLINEGALEGLLARAVFVIKEGKVAYKELVNEITEMPDIAKLDAFF FT GGSSCCGGCGCH" FT misc_feature 731462..731884 FT /note="HMMPfam hit to PF00578, AhpC/TSA family, score FT 3.8e-21" FT /inference="protein motif:Pfam:PF00578" FT misc_feature 731648..731683 FT /note="PS01265 Tpx family signature" FT /inference="protein motif:Prosite:PS01265" FT misc_feature 731894..731926 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 732179..734953 FT /transl_table=11 FT /gene="napA" FT /locus_tag="Cj0780" FT /product="periplasmic nitrate reductase" FT /EC_number="1.7.99.4" FT /note="Original (2000) note: Cj0780, napA, probable FT periplasmic nitrate reductase, len: 924 aa; similar to many FT e.g. NAPA_ECOLI periplasmic nitrate reductase precursor (EC FT 1.7.99.4) (828 aa), fasta scores; opt: 1331 z-score: 1491.7 FT E(): 0, 51.3% identity in 927 aa overlap. No Hp match. FT Contains PS00551 Prokaryotic molybdopterin oxidoreductases FT signature 1 and Pfam match to entry PF00384 molybdopterin, FT Prokaryotic molybdopterin oxidoreductases" FT /note="Updated (2006) note: Characterised within FT Escherichia coli and Wolinella succinogenes with acceptable FT identity scores. Putative not added to product function. FT Literature search identified paper giving further FT information on product function. Functional classification FT - Energy metabolism - Electron transport" FT /note="PMID:12107136, PMID:16436444, PMID:12823811" FT /db_xref="GOA:Q9PPD9" FT /db_xref="InterPro:IPR006655" FT /db_xref="InterPro:IPR006656" FT /db_xref="InterPro:IPR006657" FT /db_xref="InterPro:IPR006963" FT /db_xref="InterPro:IPR009010" FT /db_xref="InterPro:IPR010051" FT /db_xref="InterPro:IPR019546" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPD9" FT /inference="protein motif:Pfam:PF00384" FT /inference="protein motif:Prosite:PS00551" FT /protein_id="CAL34908.1" FT /translation="MNRRDFIKNTAIASAASVAGLSVPSSMLGAQEEDWKWDKAVCRFC FT GTGCGIMIARKDGKIVATKGDPAAPVNRGLNCIKGYFNAKIMYGEDRLVMPLLRMNEKG FT EFDKKGKFQQVSWQRAFDEMEKQFKKAYNELGVTGIGIFGSGQYTIQEGYAALKLAKAG FT FRTNNIDPNARHCMASAVVGFMQTFGVDEPSGCYDDIELTDTIITWGANMAEMHPILWS FT RVSDRKLSNLDKVKVVNLSTFSNRTSNIADIEIIFKPNTDLAIWNYIAREIVYNHPEAM FT DMKFIKDHCVFATGYADIGYGMRNNPNHPKFKESEKDTVEKENVITLDDEEATSLSYLG FT VKAGDKFEMKHQGVADKNWEISFDEFKKGLAPYTLEYTARVAKGDDNESLEDFKKKLQE FT LANLYIEKNRKVVSFWTMGFNQHTRGSWVNEQAYMVHFLLGKQAKPGSGAFSLTGQPSA FT CGTAREVGTFSHRLPADMVVANPKHREISEKIWKVPAKTINPKPGSPYLNIMRDLEDGK FT IKFAWVQVNNPWQNTANANHWIAAAREMDNFIVVSDCYPGISAKVADLILPSAMIYEKW FT GAYGNAERRTQHWKQQVLPVGAAMSDTWQILEFAKRFKLKEVWKEQKVDNKLTLPSVLE FT EAKAMGYSEDDTLFDVLFANKEAKSFNPNDAIAKGFDNTDVKGDERKIQGSDGKEFTGY FT GFFVQKYLWEEYRKFGLGHGHDLADFDTYHKVRGLRWPVVNGKETQWRFNTKFDYYAKK FT AAPNSDFAFYGDFNKMLTNGDLIAPKDEKEHSIKNKAKIFFRPFMKAPERPSKEYPFWL FT ATGRVLEHWHSGTMTMRVPELYRAVPEALCYMSEKDGEKLGLNQGDLVWVESRRGKVKA FT RVDMRGRNKPPVGLVYVPWFDENVYINKVTLDATCPLSKQTDFKKCAVKIYKA" FT sig_peptide 732179..732268 FT /note="Signal peptide predicted for napA by SignalP 2.0 HMM FT (Signal peptide probability 1.000) with cleavage site FT probability 0.976 between residues 30 and 31" FT misc_feature 732281..732445 FT /note="HMMPfam hit to PF04879, Molybdopterin oxidoreductase FT Fe4S4 do, score 2.3e-23" FT /inference="protein motif:Pfam:PF04879" FT misc_feature 732296..732349 FT /note="PS00551 Prokaryotic molybdopterin oxidoreductases FT signature 1" FT /inference="protein motif:Prosite:PS00551" FT misc_feature 732452..734014 FT /note="HMMPfam hit to PF00384, Molybdopterin FT oxidoreductase, score 6.2e-85" FT /inference="protein motif:Pfam:PF00384" FT misc_feature 734606..734932 FT /note="HMMPfam hit to PF01568, Molydopterin dinucleotide FT binding dom, score 3e-32" FT /inference="protein motif:Pfam:PF01568" FT CDS 734971..735711 FT /transl_table=11 FT /gene="napG" FT /locus_tag="Cj0781" FT /product="putative ferredoxin" FT /note="Original (2000) note: Cj0781, napG, probable FT ferredoxin, len: 246 aa; similar to e.g. NAPG_ECOLI FT ferredoxin-type protein NAPG (231 aa), fasta scores; opt: FT 763 z-score: 884.9 E(): 0, 48.2% identity in 228 aa FT overlap, and MAUM_METEX methylamine utilization FT ferredoxin-type protein (220 aa), fasta scores; opt: 635 FT z-score: 738.5 E(): 0, 45.7% identity in 210 aa overlap. No FT Hp match. Contains PS00198 4Fe-4S ferredoxins,iron-sulfur FT binding region signature, and 3x Pfam match to entry FT PF00037 fer4, 4Fe-4S ferredoxins and related iron-sulfur FT cluster binding domains" FT /note="Updated (2006) note: Some characterisation within FT Escherichia coli and Wolinella succinogenes with acceptable FT identity score. Putative kept as not fully characterised. FT Literature search identified paper given further FT information on product function. Functional classification FT - Energy metabolism - Electron transport" FT /note="PMID:12107136, PMID:16436444, PMID:12823811" FT /db_xref="GOA:Q0PAA9" FT /db_xref="InterPro:IPR001450" FT /db_xref="InterPro:IPR004494" FT /db_xref="InterPro:IPR009051" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR017900" FT /db_xref="UniProtKB/TrEMBL:Q0PAA9" FT /inference="protein motif:Pfam:PF00037" FT /inference="protein motif:Prosite:PS00198" FT /protein_id="CAL34909.1" FT /translation="MKGRREFFVSAFKAACLCTGGGFLANLALKADDNYALRPPGAENE FT ARFLSKCIRCGLCVKACPYDTLKLASLLDSPKNGTPFFKAREIPCYLCKDIPCIRECPT FT DALDKKHLEQGIESLKMGIAIVDSASCVAHWGIQCDACYRACPLIDRALKLELKRNERT FT AKHAFLLPSVDHEVCVGCGLCELACITEKPAIRVLPREYVLGKAGSHYVKGWDEKDEGR FT IKNADTSKHFNVKKATNYLNDGEL" FT sig_peptide 734971..735063 FT /note="Signal peptide predicted for napG by SignalP 2.0 HMM FT (Signal peptide probability 0.988) with cleavage site FT probability 0.777 between residues 31 and 32" FT misc_feature 734989..735057 FT /note="1 probable transmembrane helix predicted for Cj0781 FT by TMHMM2.0 at aa 7-29" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 735103..735174 FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 6.2e-06" FT /inference="protein motif:Pfam:PF00037" FT misc_feature 735124..735159 FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT misc_feature 735481..735558 FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 0.0011" FT /inference="protein motif:Pfam:PF00037" FT CDS 735708..736490 FT /transl_table=11 FT /gene="napH" FT /locus_tag="Cj0782" FT /product="putative ferredoxin" FT /note="Original (2000) note: Cj0782, napH, probable FT ferredoxin, len: 260 aa; similar to e.g. NAPH_ECOLI FT ferredoxin-type protein NAPH (287 aa), fasta scores; opt: FT 588 z-score: 663.2 E(): 1.2e-29, 35.3% identity in 255 aa FT overlap, and MAUN_PARDE methylamine utilization FT ferredoxin-type protein (283 aa), fasta scores; opt: 596 FT z-score: 672.2 E(): 3.8e-30, 37.8% identity in 251 aa FT overlap. No Hp ortholog. Contains PS00198 4Fe-4S FT ferredoxins, iron-sulfur binding region signature, and Pfam FT match to entry PF00037 fer4, 4Fe-4S ferredoxins and related FT iron-sulfur cluster binding domains" FT /note="Updated (2006) note: Six probable transmembrane FT helices predicted by TMHMM2.0. Putative kept as not fully FT characterised. Some work carried out within Wolinella FT succinogenes. Literature search identified paper giving FT further information on protein product. Functional FT classification - Energy metabolism - Electron transport" FT /note="PMID:12107136, PMID:16436444, PMID:12823811" FT /db_xref="GOA:Q0PAA8" FT /db_xref="InterPro:IPR001450" FT /db_xref="InterPro:IPR011886" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR017900" FT /db_xref="UniProtKB/TrEMBL:Q0PAA8" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00037" FT /inference="protein motif:Prosite:PS00198" FT /protein_id="CAL34910.1" FT /translation="MMKYLIARRIVQLGILALFSFKATDFILQGNLSSSRLFNTIPLSD FT PFAVLQIILASWSIDLMALIGALIIFFIYGLLLGRVFCSWVCPVNLITDFAAFVRNKLT FT LNNKFLILPKNLRYFVLVLVLVLSFVFSLPVFESFSYIGMIHRGIIFATSSWIFVAFIL FT FCIDTFLSPRAICSHFCPLGAFYAFISRFALLKIKHDSDKCTKCYECIRICPEKQVLWM FT VGKESTSVKSGECIRCARCIEVCNDDALNFNIFDLRNK" FT misc_feature order(735744..735803,735861..735929,735948..736004, FT 736062..736130,736149..736217,736227..736292) FT /note="6 probable transmembrane helices predicted for FT Cj0782 by TMHMM2.0 at aa 13-32, 52-74, 81-99, FT 119-141,148-170 and 174-195" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 736296..736367 FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 0.00013" FT /inference="protein motif:Pfam:PF00037" FT misc_feature 736317..736352 FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature" FT /inference="protein motif:Prosite:PS00198" FT misc_feature 736389..736460 FT /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score FT 0.0015" FT /inference="protein motif:Pfam:PF00037" FT CDS 736487..737011 FT /transl_table=11 FT /gene="napB" FT /locus_tag="Cj0783" FT /product="periplasmic nitrate reductase small subunit FT (cytochrome C-type protein)" FT /note="Original (2000) note: Cj0783, napB, probable FT cytochrome C-type protein (periplasmic nitrate reductase FT small subunit), len: 174 aa; similar to e.g. NAPB_ECOLI FT cytochrome C-type protein NAPB precursor (149 aa), fasta FT scores; opt: 269 z-score: 327.2 E(): 6.3e-11,38.1% identity FT in 97 aa overlap. No Hp match. Contains 2x PS00190 FT Cytochrome c family heme-binding site signature,N-terminla FT signal sequence and PS00013 Prokaryotic membrane FT lipoprotein lipid attachment site" FT /note="Updated (2006) note: Pfam domain PF03892 Nitrate FT reductase cytochrome c-type subunit identified within CDS. FT Further support given to product function. Characterised in FT Escherichia coli and Wolinella succinogenes with acceptable FT identity score, thus putative not needed. Literature search FT identified paper given further information on product FT function. Functional classification - Respiration - FT Electron transport" FT /note="PMID:12107136, PMID:16436444, PMID:12823811" FT /db_xref="InterPro:IPR005591" FT /db_xref="InterPro:IPR011031" FT /db_xref="UniProtKB/TrEMBL:Q0PAA7" FT /inference="protein motif:Pfam:PF03892" FT /inference="protein motif:Prosite:PS00013" FT /inference="protein motif:Prosite:PS00190" FT /protein_id="CAL34911.1" FT /translation="MMKKKLVLLGSAAVVFFAACAMNSGVSSEQIGLRKASLENENKVN FT LVEANFTTLQPGESTRFERSYENAPPLIPHAIEDLLPITKDNNMCLSCHDKAIAADAGA FT TPLPASHYYDFRHNKTTGDMISDSRFNCTQCHVPQSDAKPLVGNSFKPEFKNEQLKSRS FT NLIDVINEGVK" FT sig_peptide 736487..736570 FT /note="Signal peptide predicted for napB by SignalP 2.0 HMM FT (Signal peptide probability 1.000) with cleavage site FT probability 0.618 between residues 28 and 29" FT misc_feature 736499..736957 FT /note="HMMPfam hit to PF03892, Nitrate reductase cytochrome FT c-type subunit, score 2.5e-103" FT /inference="protein motif:Pfam:PF03892" FT misc_feature 736505..736564 FT /note="1 probable transmembrane helix predicted for Cj0783 FT by TMHMM2.0 at aa 7-26" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 736514..736546 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 736754..736771 FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT misc_feature 736880..736897 FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT CDS 737016..737930 FT /transl_table=11 FT /gene="napL" FT /locus_tag="Cj0784" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0784, probable periplasmic FT protein, len: 304 aa; no Hp match. Contains N-terminal FT signal sequence" FT /note="Updated (2006) note: Some characterisation work FT within Wolinella succinogenes with acceptable identity FT score. Functional classification - Miscellaneous FT periplasmic proteins" FT /note="PMID:12823811" FT /db_xref="InterPro:IPR001680" FT /db_xref="InterPro:IPR011046" FT /db_xref="InterPro:IPR015943" FT /db_xref="UniProtKB/TrEMBL:Q0PAA6" FT /protein_id="CAL34912.1" FT /translation="MKKFLFILSLFCVLSYAYELKLNANITALKLDKQNLYIGTDKGEI FT LQYNIKDKSLKELLSLPKIKNYYGDDFAKIYNIDIFKHTLLILSEGDFGAKNLSFYKEN FT LQIKKLEENSIIKAFFINENTYLLISIGSEIELIDKSLKNIKKFNFSHSSLNDAVLNED FT KSRLIAGFESGEVELFDLKNWKMLKNYDKMHKDNIYQVDFKNNVILSCGTDRRIGVVKN FT EEQNFLQKDFLIYTCALSPSGEFAVYSDNEAGVSEVFSTSDFKPVKTFNNENLMSEFII FT FLNNKDFIVSGFGDSIMFRSIDE" FT sig_peptide 737016..737087 FT /note="Signal peptide predicted for napL by SignalP 2.0 HMM FT (Signal peptide probability 0.883) with cleavage site FT probability 0.691 between residues 24 and 25" FT CDS 737923..738261 FT /transl_table=11 FT /gene="napD" FT /locus_tag="Cj0785" FT /product="NapD protein homolog" FT /note="Original (2000) note: Cj0785, napD, possible napD FT protein, len: 112 aa; very weak similarity to e.g. FT NAPD_PARDT NAPD protein (112 aa), fasta scores; opt: 102 FT z-score: 146.1 E(): 0.77, 22.9% identity in 83 aa FT overlap,and NAPD_ECOLI NAPD protein (87 aa), blastp scores; FT E = 4.7e-05, 23% identity in 72 bp overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF03927 NapD FT protein identified within CDS. Further support given to FT product function. Some work carried out within Wolinella FT succinogenes. Putative kept within product function. FT Literature search identified papers giving further FT information on protein product. Functional classification - FT Energy metabolism - Electron transport" FT /note="PMID:12107136, PMID:12823811" FT /db_xref="InterPro:IPR005623" FT /db_xref="UniProtKB/TrEMBL:Q0PAA5" FT /inference="protein motif:Pfam:PF03927" FT /protein_id="CAL34913.1" FT /translation="MNNLSSVLILAKEEYINDLKKAISEIPFCSVELCENEKIIVVIES FT ENLEDELNSYKMLEKLPNIISINMVFSYQDLNDDIQKAINSGAIETIEKNENAENVRYY FT GSVFNQFS" FT misc_feature 737923..738153 FT /note="HMMPfam hit to PF03927, NapD protein, score 4.9e-34" FT /inference="protein motif:Pfam:PF03927" FT CDS 738274..738447 FT /transl_table=11 FT /locus_tag="Cj0786" FT /product="small hydrophobic protein" FT /note="Original (2000) note: Cj0786, small hydrophobic FT protein, len: 57 aa; no Hp match" FT /note="Updated (2006) note: One probable transmembrane FT helix predicted by TMHMM2.0. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PAA4" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34914.1" FT /translation="MVFLIPLLIIIGVIFGIDYVYFKNQDLKVQVKKEQKELNSSLEKE FT KKEYIEKLFKTK" FT misc_feature 738283..738339 FT /note="1 probable transmembrane helix predicted for Cj0786 FT by TMHMM2.0 at aa 4-22" FT /inference="protein motif:TMHMM:2.0" FT CDS 738526..738774 FT /transl_table=11 FT /locus_tag="Cj0787" FT /product="conserved hypothetical protein Cj0787" FT /note="Original (2000) note: Cj0787, unknown, len: 82 aa; FT 38.1% identity to HP0168" FT /note="Updated (2006) note: Prosite domain PS50293 FT TPR_REGION, Tetratricopeptide region identified within CDS. FT Functional classification - Conserved hypothetical FT proteins" FT /db_xref="GOA:Q0PAA3" FT /db_xref="InterPro:IPR011990" FT /db_xref="InterPro:IPR013026" FT /db_xref="InterPro:IPR019734" FT /db_xref="UniProtKB/TrEMBL:Q0PAA3" FT /inference="protein motif:Prosite:PS50293" FT /protein_id="CAL34915.1" FT /translation="MMKNTVTEASIYEAQGLKDEALEIYKNILKEDPNNQNAIDAVRRL FT SGFRSKHKDLNTQMLDFFINMKSDEEINEFKRWLIKI" FT CDS 738771..739262 FT /transl_table=11 FT /locus_tag="Cj0788" FT /product="hypothetical protein Cj0788" FT /note="Original (2000) note: Cj0788, unknown, len: 163 aa; FT 30.8% identity to HP0167. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PAA2" FT /protein_id="CAL34916.1" FT /translation="MNLEDLAKKTISEVSSIMEEQRRQNEILKEQELNRKTEIKDELPP FT MEFVCEELDTPQDLEDKISMAKFEEEQKIQNNIEISTQENKEFKKEEPFLQNEILNPSV FT MTEVQTLNEDIFLKHLRERILVLFEGLNSIKKDDLENRLNLTINFLEFLLANIEDKLKK FT " FT CDS 739231..740349 FT /transl_table=11 FT /gene="cca" FT /locus_tag="Cj0789" FT /product="putative multifunctional Cca protein" FT /note="Original (2000) note: Cj0789, probable RNA FT nucleotidyltransferase, len: 372 aa;p similar in C-terminus FT to C-terminus of e.g. CCA_ECOLI tRNA nucleotidyltransferase FT (412 aa), fasta scores; opt: 343 z-score: 412.9 E(): FT 1.1e-15, 35.4% identity in 212 aa overlap, and PAPS_BACSU FT poly(A) polymerase (397 aa), fasta scores; opt: 338 FT z-score: 407.2 E(): 2.2e-15, 29.3% identity in 294 aa FT overlap. 24.9% identity to HP0640. Contains PS00017 FT ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF01743 Poly A FT polymerase family protein identified within CDS. Further FT support to product function. Product function modified FT based on updated characterisation naming within Escherichia FT coli. Functional classification - RNA synthesis, RNA FT modification and DNA transcription" FT /note="PMID:3009457, PMID:3516995, PMID:15210699" FT /db_xref="GOA:Q0PAA1" FT /db_xref="InterPro:IPR002646" FT /db_xref="UniProtKB/TrEMBL:Q0PAA1" FT /inference="protein motif:Pfam:PF01743" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34917.1" FT /translation="MQISKISLKNNPDLQFIAEFLKPYTKRAYLVGGSVRDLFLGLKIC FT DYDIELYDIKPKDFEKIMQKLGAQGFGKSFFVYKFKNYDLALARTENKISYGHKGFEVQ FT ICNDEKLGAKRRDFTINSMMINLFNDEFLDFYGGLKDLGVGFLRHIDKQSFQEDSLRVL FT RAVVFASRFNFKITSESLKLMQSMDITDLSKDRINAELCKFFKSPRLDVGYRYLQELGL FT EKQVFGFESVFKSSEFQNLLRQSREFVKSDALFLYLYLNFFNLEKDIFFKRTKLKKEYL FT KYANQAFYLDDISDFELAKIAFEMPLKEWLGLWSKKRIEQAKRLGLYENKFESKILAKD FT FINAGFCGKILGLKLQEARENELKEYIKGLAK" FT misc_feature 739429..739452 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 739483..739938 FT /note="HMMPfam hit to PF01743, Poly A polymerase FT family,score 5.6e-32" FT /inference="protein motif:Pfam:PF01743" FT CDS 740346..741170 FT /transl_table=11 FT /gene="purU" FT /locus_tag="Cj0790" FT /product="formyltetrahydrofolate deformylase" FT /EC_number="3.5.1.10" FT /note="Original (2000) note: Cj0790, purU, probable FT formyltetrahydrofolate deformylase, len: 274 aa; similar to FT many e.g. PURU_ECOLI formyltetrahydrofolate deformylase (EC FT 3.5.1.10) (280 aa), fasta scores; opt: 952 z-score: 1130.0 FT E(): 0, 52.0% identity in 273 aa overlap. 52.6% identity to FT HP1434. Contains Pfam match to entry PF00551 formyl_transf, FT Formyl transferase" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Purine ribonucleotide biosynthesis" FT /note="PMID:7868604" FT /db_xref="GOA:Q0PAA0" FT /db_xref="InterPro:IPR002376" FT /db_xref="InterPro:IPR004810" FT /db_xref="UniProtKB/TrEMBL:Q0PAA0" FT /inference="protein motif:Pfam:PF00551" FT /protein_id="CAL34918.1" FT /translation="MISVLKICTKDQKGLIYRISDVIFKYHINIVKNDEFVGEGMFFFR FT ALLEGEFDKEAFIGTLEAMLGQEALIELCEKRKKDIVVFATKESHCLGDLLIKHYSNEL FT EANIKAVISNHNSLKDLVEKFEIPYHFISAENLDRKEQENQILKCLEQYKFDYLVLAKY FT MRILSPDFVRHFEGKIINIHHSFLPAFIGANPYKQAFERGVKIIGATAHFVNNNLDEGP FT IITQAVSPVNHEFTWQDMQQAGRNIEKDVLSKALDLAFEDRIFIHNNKTIIF" FT misc_feature 740580..741113 FT /note="HMMPfam hit to PF00551, Formyl transferase, score FT 4e-55" FT /inference="protein motif:Pfam:PF00551" FT CDS complement(741167..742441) FT /transl_table=11 FT /locus_tag="Cj0791c" FT /product="putative aminotransferase" FT /note="Original (2000) note: Cj0791c, probable FT aminotransferase, len: 424 aa; similar to many members of FT the nifS family e.g. TR:O32164 (EMBL:Z99120) B. subtilis FT YURW protein (406 aa), fasta scores; opt: 289 z-score: FT 340.6 E(): 1.1e-11, 23.9% identity in 431 aa overlap. 45.4% FT identity to HP0405. Contains PS00455 Putative AMP-binding FT domain signature and PS00595 Aminotransferases class-V FT pyridoxal-phosphate attachment site" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity score carried out yet. Putative FT kept within product function. Functional classification FT -Misc" FT /db_xref="GOA:Q0PA99" FT /db_xref="InterPro:IPR000192" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:Q0PA99" FT /inference="protein motif:Prosite:PS00595" FT /inference="protein motif:Prosite:PS00455" FT /protein_id="CAL34919.1" FT /translation="MYLQISDLKKELILKKGILHFDFTASALALKCVEKEILKILPTYA FT NTHSDSSLNSFKTQQTYEQARKDIKKSLSLDENFALIACGTGSSSAIKKFQELIGIYIP FT PLVKERYFTQIDKNTLPLVIVGPYEHHSNELSFREGLCECIRIPLDKNGEIDFDFLEKT FT LQKNKKRKIIASFSLASNVTGILSDYKRISEMVRKFKGIVAFDASSFIPYKNISCQYYD FT ALFISSHKLIGGIGGSGLLAIKKDLCGNKPSFAAGGTVGYVSRTSQCYLCNEEALEEGG FT TPGILQLIRASLAFKIKDSIGVKNIEKKEEILKDYFFEKLKTIPNLILYAKNLKTRLPI FT FAFNIKGISPFDIAYELSKKYHIETRAGCACAGPYGHDLLGLKDNQKLKTKPGWLRISL FT HYTHEKEDIDYFFNALNKTIVKLSH" FT misc_feature complement(741719..741781) FT /note="PS00595 Aminotransferases class-V FT pyridoxal-phosphate attachment site" FT /inference="protein motif:Prosite:PS00595" FT misc_feature complement(742163..742198) FT /note="PS00455 Putative AMP-binding domain signature" FT /inference="protein motif:Prosite:PS00455" FT CDS 742477..743355 FT /transl_table=11 FT /locus_tag="Cj0792" FT /product="conserved hypothetical protein Cj0792" FT /note="Original (2000) note: Cj0792, unknown, len: 292 aa; FT some similarity to hypothetical proteins e.g. YZ04_METJA FT hypothetical protein MJECL04 (439 aa), fasta scores; opt: FT 175 z-score: 208.0 E(): 0.00027, 26.5% identity in 309 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF03008 Archaea FT bacterial proteins of unknown function identified within FT CDS. Conserved added to product function. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="InterPro:IPR004256" FT /db_xref="UniProtKB/TrEMBL:Q0PA98" FT /inference="protein motif:Pfam:PF03008" FT /protein_id="CAL34920.1" FT /translation="MLYKRKNIKFKNFVDLHKNLSLSKLFDFYSVFEGFEKLNILNFED FT DVFTNIERILLDDYLKIKSYFALDETSSYALTLLAKNNRKRFSINRKIQHFKALSTLKY FT LLETGIIKLEYSKEAKKIKDKRQKIKKELRSYVVQDKIIFSNHFTRFFFYFLKPNEKLI FT LQNRYKEVLECIKEKFELYQSFCFEQLSRELLEKKFNINGVQSYWDKNLELDLYYQDEN FT LCFVGEVKFKNKKICKNILNLLKSKAKSLNLAPNYYIIISKNGFSKEIDKICEQNLLLL FT DLNDFKILLEE" FT misc_feature 742930..743196 FT /note="HMMPfam hit to PF03008, Archaea bacterial proteins FT of unknown functi, score 1.6e-05" FT /inference="protein motif:Pfam:PF03008" FT CDS 743359..744378 FT /transl_table=11 FT /gene="flgS" FT /locus_tag="Cj0793" FT /product="signal transduction histidine kinase" FT /note="Original (2000) note: Cj0793, probable signal FT transduction histidine kinase, len: 339 aa; similar to e.g. FT the C-terminus of ATOS_ECOLI sensor protein ATOS (608 aa), FT fasta scores; opt: 357 z-score: 408.3 E(): 1.9e-15,33.3% FT identity in 222 aa overlap. 42.4% identity to HP0244. FT Contains Pfam match to entry PF00512 signal,Signal FT carboxyl-terminal domain" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni and Helicobacter pylori. Putative not FT added to product function. Literature search identified FT papers linking Cj0793 and Cj1024 to a two-component signal FT transduction system (FlgS/FlgR) that regulates the fla FT regulon in Campylobacter jejuni (similar to that found in FT Helicobacter pylori). Functional classification - Signal FT transduction" FT /note="PMID:14960570, PMID:15231786, PMID:14617189" FT /db_xref="GOA:Q0PA97" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR003661" FT /db_xref="InterPro:IPR004358" FT /db_xref="InterPro:IPR005467" FT /db_xref="InterPro:IPR009082" FT /db_xref="UniProtKB/TrEMBL:Q0PA97" FT /inference="protein motif:Pfam:PF00512" FT /protein_id="CAL34921.1" FT /translation="MNESILKSLDSNEKETLQKGLESLIEQTYVIENEYKTLNENYNSL FT RAMVDEIIEVLPSALWILDKEKNIILQNQEALKNPKLLSIISLDKIRDELEFEGRFYAV FT KIIAHNEKTIVSATDISDEKRNERLASMGSVAAHLAHEIRNPIGSISLLASTLFARSEL FT KNKHIVLEIQKAIARVERIVNSTLLFTKGVHINALNFNLLELKEECESAINSYNFTSQI FT DFEISFLDKQICADKALLGLVLQNLIYNAIDAIEESECEKPMIKILASYDNEKICIRVY FT DNGCEIKDEKLVFEAFKTTKLKGNGLGLSLSKEIINAHKGELSFQSDPKNFYFTLPLV" FT misc_feature 743749..743943 FT /note="HMMPfam hit to PF00512, His Kinase A FT (phosphoacceptor) domain, score 5.3e-09" FT /inference="protein motif:Pfam:PF00512" FT misc_feature 744061..744375 FT /note="HMMPfam hit to PF02518, Histidine kinase-, DNA FT gyrase B-, and HSP90, score 1.1e-21" FT /inference="protein motif:Pfam:PF02518" FT CDS 744495..745775 FT /transl_table=11 FT /locus_tag="Cj0794" FT /product="hypothetical protein Cj0794" FT /note="Original (2000) note: Cj0794, unknown, len: 426 aa; FT no Hp match. Has consecutive regions of near-identity to FT Cj0814 (73.9% identity in 253 aa overlap), Cj0815 (61.6% FT identity in 86 aa overlap) and Cj0816 (63.6% identity in 44 FT aa overlap), which may represent a pseudogene copy of this FT CDS" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PA96" FT /protein_id="CAL34922.1" FT /translation="MITQTMQSKESKESKENSKISFANAFLKQNASKLNEIQNANSQTL FT ARSEALNSTNTTNTSNNTNFSISSKTSSPNYDISSEFKNSIYTLKYKQVDISNTSTNTA FT YGYSVDKDGYMGSDFNKAAGLPEDFKIHKSTLDEIERKAENNSYTSDIKKYLGIDKYYT FT NIDMAETIKQYYNQFNQIVNYAFNDTNKTSFTEADINSMPKGISELSSDKTIGIMPKNY FT DKLTITNYYNTQEQYNEAEQLGMFGHINIGLQPLNFTPQSMQTQNLDKDTAIDTFNPDM FT SVYPQNEDGSYSKEALFMSFLKSTGVSPREGSATLNPIAKSYAEAMAKESFDGSLASLD FT DIMTGKVDFASLLKGYAQEGWLDADIYAMDKGVAWQNTSIGYGGAWFDREFNQVKANGW FT KASSESINSYVGSIMDRLNNLMGQTRV" FT CDS complement(745833..747260) FT /transl_table=11 FT /gene="murF" FT /locus_tag="Cj0795c" FT /product="UDP-N-acetylmuramoyl-tripeptide FT D-alanyl-D-alanine ligase" FT /EC_number="6.3.2.10" FT /note="Original (2000) note: Cj0795c, murF, possible FT UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate FT -- ligase, len: 475 aa; some similarity to e.g. MURF_BACSU FT UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate FT -- ligase (EC 6.3.2.15) (457 aa), fasta scores; opt: 235 FT z-score: 258.7 E(): 4.1e-07, 26.7% identity in 348 aa FT overlap. 41.5% identity to HP0740" FT /note="Updated (2006) note: Pfam domains PF01225 Mur ligase FT family, catalytic domain and PF02875 Mur ligase family, FT glutamate ligase domain were identified within CDS. Also, FT three probable transmembrane helices predicted by TMHMM2.0 FT within CDS. Further support given to product function. FT Characterisation work carried out within Escherichia coli FT and Bacillus subtilis with mariginal identity scores. FT Putative not added to product function. Product function FT and EC number updated. Functional classification - Murein FT sacculus and peptidoglycan" FT /note="PMID:11090285, PMID:2668880, PMID:9305945" FT /db_xref="GOA:Q0PA95" FT /db_xref="InterPro:IPR004101" FT /db_xref="InterPro:IPR005863" FT /db_xref="InterPro:IPR013221" FT /db_xref="UniProtKB/TrEMBL:Q0PA95" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02875" FT /inference="protein motif:Pfam:PF01225" FT /protein_id="CAL34923.1" FT /translation="MLINTLYFINSLFFNFCIAFYLMSALQWYSYKFKRVFFHYHKPLW FT HLYFLFIPYFLFLAFPLYSLVYFALIHTPILYFWNKGIDKKLVFTSKVKWFFVFVFVYN FT AIFTILALRFSFLFNLFSLPFALLSLKIYEFFTNLYYKKQAKAKLRANENLKIILITAS FT FGKTSIKNFLYELLKDDFKSYKTPRSVNTLLGIVADINANLSQDTQIYIAEAGARLKGD FT IDEITHFLQPQISIVGEIGNAHLEYFKSVENIRSTKLEALNSERLEKAFLHSSTQKEED FT KLISLYDDKLSLIHSSLEGLEFKVDIENKSYDFKSQILGDFNAQNLCVCILCAHYLGIK FT LEKIQKQVLNINSVEHRLQVLSREPKFIIDDGFNGNFKGMSTSYKLCKSYKGRKVLVSP FT GIVEVSEEENIKLAKIINECFDLAIISAQINAEIFKKELKIKTIILKEKSQLVQTLAKE FT TKHGDLILFSNDAPSFM" FT misc_feature complement(745965..746201) FT /note="HMMPfam hit to PF02875, Mur ligase family,glutamate FT ligase doma, score 0.0036" FT /inference="protein motif:Pfam:PF02875" FT misc_feature complement(746226..746972) FT /note="HMMPfam hit to PF01225, Mur ligase family,catalytic FT domain, score 3.5e-15" FT /inference="protein motif:Pfam:PF01225" FT misc_feature complement(join(747174..747242,747048..747116, FT 746910..746978)) FT /note="3 probable transmembrane helices predicted for FT Cj0795c by TMHMM2.0 at aa 7-29, 49-71 and 95-117" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(747261..747980) FT /transl_table=11 FT /locus_tag="Cj0796c" FT /product="putative hydrolase" FT /note="Original (2000) note: Cj0796c, unknown, len: 239 aa; FT 46.3% identity to HP0739 (annotated as FT 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase)" FT /note="Updated (2006) note: Pfam domain PF00561 alpha/beta FT hydrolase fold and Prosite domain PS50187 FT Esterase/lipase/thioesterase active site serine identified FT within CDS. The latter are found in alpha/beta fold FT hydrolase. Product function modified due to motif match. No FT specific characterisation with acceptable identity score FT carried out yet. Putative kept within product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PA94" FT /db_xref="UniProtKB/TrEMBL:Q0PA94" FT /inference="protein motif:Pfam:PF00561" FT /inference="protein motif:Prosite:PS50187" FT /protein_id="CAL34924.1" FT /translation="MAQTQLSYKNKTYQISYEILGDLSLPQILILHGWGADKKLMKQSF FT CPFLKDFCQIYMDLAGFGNSSVEEILNTQDYANITELFLKQKKLNVCFFMGHSFGGKVS FT TLLAKEKDTLILLSSAGILAKKSLKVRFKIRIFKILKLFGLGKFYRYFASKDGANLSPI FT MYETFKKVVDEDFSEIFAKQKAKSLIFWGKSDEATPLYCGEKMHQFLKNSTFYPLEGDH FT FFFLKHSAFIAQKIKEI" FT misc_feature complement(747267..747827) FT /note="HMMPfam hit to PF00561, alpha/beta hydrolase FT fold,score 0.0025" FT /inference="protein motif:Pfam:PF00561" FT CDS complement(747982..748197) FT /transl_table=11 FT /locus_tag="Cj0797c" FT /product="hypothetical protein Cj0797c" FT /note="Original (2000) note: Cj0797c, unknown, len: 71 aa; FT weak similarity to TR:O68849 (EMBL:AF055586) ORF10 in FT Vibrio cholerae integron InVch (80 aa), fasta scores; opt: FT 95 z-score: 151.4 E(): 0.39, 39.2% identity in 51 aa FT overlap. No Hp match. Functional classification -Conserved FT hypothetical proteins" FT /db_xref="InterPro:IPR006442" FT /db_xref="UniProtKB/TrEMBL:Q0PA93" FT /protein_id="CAL34925.1" FT /translation="MLSFKQDEIYTATEVVRNFSPIMEKLKKSESGKIVILKNNKFEAV FT MLSMKEFERLQNAMQLLENIYKNQKA" FT CDS complement(748257..749297) FT /transl_table=11 FT /gene="ddlA" FT /locus_tag="Cj0798c" FT /product="D-alanine--D-alanine ligase" FT /EC_number="6.3.2.4" FT /note="Original (2000) note: Cj0798c, ddlA, possible FT D-alanine--D-alanine ligase, len: 346 aa; similar to e.g. FT DDLA_ECOLI D-alanine--D-alanine ligase A (EC 6.3.2.4) (364 FT aa), fasta scores; opt: 335 z-score: 386.3 E(): FT 3.2e-14,25.2% identity in 322 aa overlap, and VANA_ENTFC FT vancomycin/teicoplanin A-type resistance protein (343 FT aa),fasta scores; opt: 415 z-score: 477.2 E(): 2.8e-19, FT 27.9% identity in 312 aa overlap. 54.3% identity to HP0738. FT Contains PS00843 and PS00844 D-alanine--D-alanine ligase FT signatures 1 and 2" FT /note="Updated (2006) note: Pfam domain PF07478 D-ala D-ala FT ligase C-terminus identified within CDS. Further support FT given to product function. Characterised within Escherichia FT coli with marginal identity score. Appropriate motifs FT present. Putative removed from product function. Functional FT classification - Murein sacculus and peptidoglycan" FT /note="PMID:1993184" FT /db_xref="GOA:Q9PPC2" FT /db_xref="InterPro:IPR000291" FT /db_xref="InterPro:IPR005905" FT /db_xref="InterPro:IPR011095" FT /db_xref="InterPro:IPR011127" FT /db_xref="InterPro:IPR011761" FT /db_xref="InterPro:IPR013815" FT /db_xref="InterPro:IPR013816" FT /db_xref="InterPro:IPR013817" FT /db_xref="InterPro:IPR016185" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPC2" FT /inference="protein motif:Pfam:PF07478" FT /inference="protein motif:Prosite:PS00844" FT /inference="protein motif:Prosite:PS00843" FT /protein_id="CAL34926.1" FT /translation="MKFAILFGGNSYEHEISIVSAVVLKKVINQNLEFIFCDEERRFYH FT IPSEKMNSKTFSTKAYKKEKELFIKQGGFFSKGFLKENKLECECVINLIHGRDGEDGKI FT AALFEFYSIKFIGPRLEASVLSFNKELTKLYAKSVGVKTLDYTILRKNQNSKEKLSFPC FT IIKPARLGSSIGISIVKDEKDLEYAKDVGFEFDNDLVVEEFKNNIKEYNLAGCMINDEF FT VFSIIEEPKKKEFLDFEQKYLSFSGHNELIEADLSEELKEKLKDSFKKIYNPLFKGALI FT RCDFFILDNEIYLNEINPNPGSLANYLFKDFNTTLNALADQISLEKMIKINYNFLHSIN FT GQKGKL" FT misc_feature complement(748320..748916) FT /note="HMMPfam hit to PF07478, D-ala D-ala ligase FT C-terminus, score 3.3e-23" FT /inference="protein motif:Pfam:PF07478" FT misc_feature complement(748392..748475) FT /note="PS00844 D-alanine--D-alanine ligase signature 2" FT /inference="protein motif:Prosite:PS00844" FT misc_feature complement(748980..749015) FT /note="PS00843 D-alanine--D-alanine ligase signature 1" FT /inference="protein motif:Prosite:PS00843" FT CDS complement(749307..749858) FT /transl_table=11 FT /gene="ruvA" FT /locus_tag="Cj0799c" FT /product="putative Holliday junction ATP-dependent DNA FT helicase" FT /EC_number="3.6.1.-" FT /note="Original (2000) note: Cj0799c, ruvA, probable FT Holliday junction DNA helicase, len: 183 aa; simlar to e.g. FT RUVA_ECOLI holliday junction DNA helicase RUVA (203 aa), FT fasta scores; opt: 283 z-score: 347.2 E(): 4.8e-12,31.7% FT identity in 202 aa overlap. 36.6% identity to HP0883" FT /note="Updated (2006) note: Pfam domains PF01330 RuvA N FT terminal domain and PF07499 RuvA, C-terminal domain were FT both identified within product function. Further support FT given to product function. Characterised within Escherichia FT coli with marginal identity score. Putative kept within FT product funciton. Functional classification -DNA FT replication, restriction/modification, recombination and FT repair" FT /note="PMID:9493263, 9442895" FT /db_xref="GOA:Q9PPC1" FT /db_xref="InterPro:IPR000085" FT /db_xref="InterPro:IPR003583" FT /db_xref="InterPro:IPR010994" FT /db_xref="InterPro:IPR011114" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR013849" FT /db_xref="InterPro:IPR016027" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPC1" FT /inference="protein motif:Pfam:PF07499" FT /inference="protein motif:Pfam:PF01330" FT /protein_id="CAL34927.1" FT /translation="MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKH FT EFFITQIIKEDSNKFYGFLDKDEQKMFEMLLKVNGVGANTAMAVCSSLDVNSFYKALSL FT GDESVLKKVPGIGPKSAKRIIVELSDTKTKLENVSDDKSEALAALLTLGFKQEKIISVL FT VSAQATGTSELIKEALKKLG" FT misc_feature complement(749310..749441) FT /note="HMMPfam hit to PF07499, RuvA, C-terminal FT domain,score 7.9e-06" FT /inference="protein motif:Pfam:PF07499" FT misc_feature complement(749478..749567) FT /note="HMMPfam hit to PF00633, Helix-hairpin-helix FT motif,score 0.13" FT /inference="protein motif:Pfam:PF00633" FT misc_feature complement(749583..749672) FT /note="HMMPfam hit to PF00633, Helix-hairpin-helix FT motif,score 0.66" FT /inference="protein motif:Pfam:PF00633" FT misc_feature complement(749673..749858) FT /note="HMMPfam hit to PF01330, RuvA N terminal domain,score FT 1.7e-20" FT /inference="protein motif:Pfam:PF01330" FT misc_feature complement(749748..749816) FT /note="1 probable transmembrane helix predicted for Cj0799c FT by TMHMM2.0 at aa 15-37" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(749834..751693) FT /transl_table=11 FT /locus_tag="Cj0800c" FT /product="putative ATPase" FT /note="Original (2000) note: Cj0800c, unknown, len: 619 aa; FT 24.7% identity to HP0884. Also similar to Cj0044c (28.6% FT identity in 622 aa overlap)" FT /note="Updated (2006) note: Prosite domain PS00389 FT ATPase,F1 complex, OSCP/delta subunit signature identified FT within CDS. Product modified to more specific family member FT due to motif match. Not fully characterised so putative FT kept within product function. Functional classification - FT Misc" FT /db_xref="InterPro:IPR005646" FT /db_xref="UniProtKB/TrEMBL:Q0PA90" FT /inference="protein motif:Prosite:PS00389" FT /protein_id="CAL34928.1" FT /translation="MALDEKIIAYTENPARELLSVASRTNLSLNELDFSLLAFSTQYRF FT GDLEWEKISEKELTLFDKDEIFLKNDLQIKQEYKIEIFHGINQSKASQAVKLVANKNLT FT KIVAQIDFTNLDFHEKLALELLQNIYKKMLKLKFLIGIRIFDFKKKLMSFCNQYKNTPL FT NKTIQITVAQGIDPIESQDESLILTYKEKTKNYTIDEKRSGIIVVDENEVVLKHVKFKQ FT GKEGKDLNLHTLKVLAANENKVKFSCSSAFKQVEQDGYTEYIALKKGYVVQDGEKFDIA FT NELDFNGVDFKNIGIIRAGLDKNVKINIKFLSEVKDAVNSGVGIECEELNVVGSVGSNT FT QLNATKMKIEGTTHSKAKIQAKQAYIKTHRGFAEAEILNIDLLEGGTIKAKEVRIKKSL FT GGNIQADKIYIENLESNNSCVFFENTTIERINGDNNKFHAKIKTLDKNYDEEFAILGEQ FT ISKLNHKINKIRQYILSSKNGILSVEKKITELKNQGQNVPVQYEKALKDFSLQNLELNK FT LQNEEKELLERKKSLQLELINLQKMLFEATFINKSGKWTDMNEIKFSLLEPKEDIFCSS FT FVNESAKFIGIKKVIQNNQESIEIHKKLDYEEKDIAWLSASKE" FT misc_feature complement(750710..750769) FT /note="PS00389 ATP synthase delta (OSCP) subunit signature" FT /inference="protein motif:Prosite:PS00389" FT CDS 751797..753248 FT /transl_table=11 FT /locus_tag="Cj0801" FT /product="putative integral membrane protein (MviN FT homolog)" FT /note="Original (2000) note: Cj0801, probable integral FT membrane protein, len: 483 aa; similar to MVIN_SALTY FT virulence factor MVIN (524 aa), fasta scores; opt: 725 FT z-score: 828.0 E(): 0, 32.4% identity in 463 aa overlap,and FT to homologs from other organisms. 45.8% identity to HP0885" FT /note="Updated (2006) note: Eleven probable transmembrane FT helices predicted by TMHMM2.0. Also, Pfam domain PF03023 FT MviN-like protein identified within CDS. Still not FT functionally characterised. Homolog designation kept within FT product function. Functional classification -Membranes, FT lipoproteins and porins" FT /db_xref="InterPro:IPR004268" FT /db_xref="UniProtKB/TrEMBL:Q0PA89" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03023" FT /protein_id="CAL34929.1" FT /translation="MKSLVFKNFIINALGILFSRILGLARDVLIALFLGAGLYSDIFFV FT ALKMPAFFRRIFAEGAFGQSFLPNFVKAKKKGAFCVSVMMQFSLIVFLFCLLVSFFSSF FT FTKLFAFGFNADTIALAAPLVAINFWYLFFIFLVTFLGAILNYRQKFFITSFSAALFNL FT SIVIAAFFVDKNAPQNTLYYFSYATVLSGVAQLILHLLVLKNNPVIRAMTLSIKFKKTK FT AKLQGFYGNFFHGVLGSSATQFSSLLDTTIASFLMSGSISYLYYANRVFQLPLALFAIA FT LTQVSFPKILKHLKSDQENLALKFMQRALALLSILLIASSIVGSVFALEISKLLFERGN FT FTHEDSVITAYVLIAYLIGLLPFGLQKLFSLWLYAKFKQKTAAWIAVKSLIISALCSMA FT FIFLIKDESLKVIAVALSSSISAFYLLGANIKEFGFKKFFALISIKICLLVIVALIVFT FT ILLILIKPYILSFFIGIFTSFKGVF" FT misc_feature order(751809..751868,751878..751937,752031..752099, FT 752163..752231,752250..752309,752337..752405, FT 752724..752792,752835..752903,752940..753008, FT 753018..753086,753120..753188) FT /note="11 probable transmembrane helices predicted for FT Cj0801 by TMHMM2.0 at aa 5-24, 28-47, 79-101, FT 123-145,152-171, 181-203, 310-332, 347-369, 382-404, FT 408-430 and 442-464" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 751884..753233 FT /note="HMMPfam hit to PF03023, MviN-like protein, score FT 1.6e-84" FT /inference="protein motif:Pfam:PF03023" FT misc_feature 752469..752516 FT /note="PS00225 Crystallins beta and gamma 'Greek key' motif FT signature" FT /inference="protein motif:Prosite:PS00225" FT CDS 753248..754636 FT /transl_table=11 FT /gene="cysS" FT /locus_tag="Cj0802" FT /product="cysteinyl-tRNA synthetase" FT /EC_number="6.1.1.16" FT /note="Original (2000) note: Cj0802, cysS, probable FT cysteinyl-tRNA synthetase, len: 462 aa; similar to many FT e.g. SYC_ECOLI cysteinyl-tRNA synthetase (EC 6.1.1.16) (461 FT aa), fasta scores; opt: 900 z-score: 1011.4 E(): 0,37.0% FT identity in 470 aa overlap. 50.2% identity to HP0886" FT /note="Updated (2006) note: Pfam domain PF01406 tRNA FT synthetases class I (C) catalytic domain identified within FT CDS. Further support given to product function. FT Characterised within Escherichia coli with acceptable FT identity score. Putative kept within product function. FT Functional classification - Aminoacyl tRNA synthetases and FT their modification" FT /note="PMID:2014166" FT /db_xref="GOA:Q9PPB8" FT /db_xref="InterPro:IPR009080" FT /db_xref="InterPro:IPR014729" FT /db_xref="InterPro:IPR015273" FT /db_xref="InterPro:IPR015803" FT /db_xref="InterPro:IPR024909" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPB8" FT /inference="protein motif:Pfam:PF01406" FT /protein_id="CAL34930.1" FT /translation="MRLLDSVTKEKIKLDKKDISIYLCGPTVYDDAHLGHARSSVCFDL FT LRRVLLAQGNRVKFARNYTDIDDKILKKMAQSGQTLEEITEFYIKSYEEDMRVLNVLDP FT DFKPRATHYITAMLDLIKKLAKDGFVYTLEDGIYFDTSKDEKYLSLSNRNLEENISRLS FT NEVQKRNESDFVLWKFDENFYESEFGKGRPGWHTECVAMIDSIFENTLDIHAGGIDLLF FT PHHENEAAQCRCGCKRKLANIWLHNGFVKIDGEKMSKSLNNSFFIKDALKEFMGEALRF FT YLLSSHYRSHFNYSLSDLENAKKRLDKFYRLKKRLDLGEISDFDVLNDIGIKSEIAKQI FT LEILNDDLNVSKALALLDDFISSANLELDKESKNKILKQNIKEALSELAKIFGFGFMDA FT TLYFQWGVSKEEREEIEKLILERTEAKKNKDFNTADAIREQLNSKKITLLDTPNGTIWE FT KINA" FT misc_feature 753275..754159 FT /note="HMMPfam hit to PF01406, tRNA synthetases class I (C) FT catalytic d, score 5.6e-134" FT /inference="protein motif:Pfam:PF01406" FT CDS 754629..756371 FT /transl_table=11 FT /gene="msbA" FT /locus_tag="Cj0803" FT /product="lipid export ABC transport protein" FT /note="Original (2000) note: Cj0803, msbA, probable lipid FT export ABC transport protein, len: 580 aa; similar to lipid FT export protein MSBA_ECOLI probable transport ATP-binding FT protein MSBA (582 aa), fasta scores; opt: 1032 z-score: FT 1135.9 E(): 0, 29.6% identity in 575 aa overlap,and to FT other members of the mutidrug-resistance family of ABC FT transporters. 42.7% identity to HP1082. Contains PS00017 FT ATP/GTP-binding site motif A (P-loop), PS00211 ABC FT transporters family signature, Pfam match to entry PF00664 FT ABC_membrane, ABC transporter transmembrane region, and FT Pfam match to entry PF00005 ABC_tran, ABC transporters" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with marginal identity score. Appropriate motifs FT present. Putative not needed to product function. FT Functional classification - Transport/binding proteins FT -Other" FT /note="PMID:16159769, PMID:12119303" FT /db_xref="GOA:Q0PA87" FT /db_xref="InterPro:IPR001140" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR011527" FT /db_xref="InterPro:IPR017871" FT /db_xref="InterPro:IPR017940" FT /db_xref="UniProtKB/TrEMBL:Q0PA87" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Pfam:PF00664" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34931.1" FT /translation="MHNEMNLKEVLIRFKPFYKRYWKQFAIAIFGMILASGGTAGSFYA FT LEPILNYIFVEKNEALLYTVPFLLVLMYFFKNLGTYLQSFYVSFIGTDMLRVLRARVLK FT NVLRLDMDFFKRYRSGELVSRCTNDINALQSIVSNIIPDFFRELLTAIGLLAVVLYQSP FT TLAFFALVILPLAIFPLVWFAKKLKKYARNIQETNSDLLSYLGEIFSNIELIKANDNEK FT KESDKFAKHNDTLCKLNLKSARIDALTSPLMDMMGSVGVAVVIIVGGREVINGSMSVGS FT FISFVSALFAIYTPLKRLSSLYGKLQGAVAASERTFYLLDLEPQIKGGSKELKNIEKIS FT FENVEFAYENPHKSVLKGVNFDFVKGQMLALVGTSGGGKSSIINLLMYFYEKQKGKILL FT NQEDISTFTIESLHAKIGLVTQNIYLFNDSFAANIAYSEELEEEKVIQALKLANAYEFV FT KEMGGIWAEVKEHGKNLSGGQKQRIAIARALYKNPDVLIFDEATSALDNESEKAIVKTI FT ENLKQDRLILVVAHRLSTIENADKIVVLDKGKVLAIGKDEELLQTCSLYQKFKSKEKTK FT PSFS" FT sig_peptide 754629..754763 FT /note="Signal peptide predicted for msbA by SignalP 2.0 HMM FT (Signal peptide probability 0.839) with cleavage site FT probability 0.530 between residues 45 and 46" FT misc_feature order(754701..754769,754806..754874,755121..755180, FT 755442..755510) FT /note="4 probable transmembrane helices predicted for FT Cj0803 by TMHMM2.0 at aa 25-47, 60-82, 165-184 and 272-294" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 754701..755516 FT /note="HMMPfam hit to PF00664, ABC transporter FT transmembrane region, score 8.8e-42" FT /inference="protein motif:Pfam:PF00664" FT misc_feature 755724..756272 FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 4.9e-51" FT /inference="protein motif:Pfam:PF00005" FT misc_feature 755745..755768 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 756051..756095 FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT CDS 756403..757461 FT /transl_table=11 FT /gene="pyrD" FT /locus_tag="Cj0804" FT /product="dihydroorotate dehydrogenase" FT /EC_number="1.3.3.1" FT /note="Original (2000) note: Cj0804, pyrD, probable FT dihydroorotate dehydrogenase, len: 352 aa; similar to many FT e.g. PYRD_ECOLI dihydroorotate dehydrogenase (EC 1.3.3.1) FT (336 aa), fasta scores; opt: 583 z-score: 682.2 E(): FT 1.1e-30, 39.5% identity in 339 aa overlap. 47.6% identity FT to HP1011. Contains PS00912 Dihydroorotate dehydrogenase FT signature 2, and Pfam match to entry PF01180 FT DHOdehase,Dihydroorotate dehydrogenase (DHOdehase)" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with acceptable identity score. Appropriate motifs FT present. Putative not added to product function. Functional FT classification - Pyrimidine ribonucleotide biosynthesis" FT /note="PMID:2992959, PMID:6370696" FT /db_xref="GOA:Q0PA86" FT /db_xref="InterPro:IPR001295" FT /db_xref="InterPro:IPR005719" FT /db_xref="InterPro:IPR012135" FT /db_xref="InterPro:IPR013785" FT /db_xref="UniProtKB/TrEMBL:Q0PA86" FT /inference="protein motif:Pfam:PF01180" FT /inference="protein motif:Prosite:PS00912" FT /protein_id="CAL34932.1" FT /translation="MAYEMIKLLLFKLNPEHAHALVEYSLRALSASFPGALSFLAHKYI FT VDDESLRQNLLGLDFNNPVGLAGGFDKNATMIRPLSALGFGFLEVGTFTPKPQEGNEKP FT RLFRLVKQESIQNAMGFNNEGAEKIALRLAKTYPFVLPLGVNIGKNKITPNDKALEDYF FT TLFRDFKDLCDYFIVNISSPNTKNLRELQNDDFLNTLLEEAKKITSKPILIKIAPDMKI FT DDALNLCENAIKKGADGFILANTSVDYSLLDNNRTFGGISGRLITEKSGIFFKEVTKIL FT FGKTLLIASGGIDSADIAYERIKNGANLVQVYTALIFKGPSLVKNINQNLIELLRKDGF FT LHISEAVGVNLK" FT misc_feature 756550..757407 FT /note="HMMPfam hit to PF01180, Dihydroorotate FT dehydrogenase, score 6.1e-84" FT /inference="protein motif:Pfam:PF01180" FT misc_feature 756658..756717 FT /note="PS00911 Dihydroorotate dehydrogenase signature 1" FT /inference="protein motif:Prosite:PS00911" FT misc_feature 757261..757323 FT /note="PS00912 Dihydroorotate dehydrogenase signature 2" FT /inference="protein motif:Prosite:PS00912" FT CDS 757458..758708 FT /transl_table=11 FT /locus_tag="Cj0805" FT /product="putative zinc protease" FT /note="Original (2000) note: Cj0805, probable zinc FT protease, len: 416 aa; similar to many members of the FT insulinase family e.g. Y4WA_RHISN hypothetical zinc FT protease Y4WA (512 aa), fasta scores; opt: 664 z-score: FT 739.8 E(): 0, 31.8% identity in 415 aa overlap. 57.2% FT identity to HP1012. Contains PS00143 Insulinase FT family,zinc-binding region signature, and Pfam match to FT entry PF00675 Insulinase, Insulinase (proteinase M16)" FT /note="Updated (2006) note: Pfam domain PF05193 Peptidase FT M16 inactive domain identified within CDS. Further support FT given to product function. No specific characterisation FT with acceptable identity score carried out yet. Putative FT kept within product function. Functional classification FT -Proteins, peptides and glycopeptides" FT /db_xref="GOA:Q0PA85" FT /db_xref="InterPro:IPR001431" FT /db_xref="InterPro:IPR007863" FT /db_xref="InterPro:IPR011237" FT /db_xref="InterPro:IPR011249" FT /db_xref="InterPro:IPR011765" FT /db_xref="UniProtKB/TrEMBL:Q0PA85" FT /inference="protein motif:Pfam:PF05193" FT /inference="protein motif:Pfam:PF00675" FT /inference="protein motif:Prosite:PS00143" FT /protein_id="CAL34933.1" FT /translation="MIAYEKIQLKNKLEVYALPVNKNSDVISVDIFYKVGSRNEIMGKS FT GIAHMLEHLNFKSTKNLKAGEFDEIVKGFGGVDNASTGFDYTHYYIKCAKKNLDKALEL FT FAELMANLNLKDEEFQPERAVVLEERRWRTDNNPLGYLYFRLFNHAFMYHPYHWTPIGF FT FKDIENWSIEDIKEFHSIYYQPKNAILLVSGDIESKEVFELSKKHFEKIKNTKTIPKIH FT TKEPKQDGVKRIYLHKNSDTELLALAYKIPNFKHKDIPALNALSELLGSGKSSLMSEIL FT IDKLNLINDYYAYVNDCIDENLFIFICNCNPNVNAEKVEKELLKIIDKLKMGKISQKDL FT QRVKNNVKSDFIFSLNNASAVANIYGSYLARGDINPLLNYEKDIQNLELKDLISCAKKY FT FIQENSTTVILRKDSNG" FT misc_feature 757503..757919 FT /note="HMMPfam hit to PF00675, Insulinase (Peptidase family FT M16), score 1.2e-15" FT /inference="protein motif:Pfam:PF00675" FT misc_feature 757563..757634 FT /note="PS00143 Insulinase family, zinc-binding region FT signature" FT /inference="protein motif:Prosite:PS00143" FT misc_feature 757962..758498 FT /note="HMMPfam hit to PF05193, Peptidase M16 inactive FT domain, score 4.8e-42" FT /inference="protein motif:Pfam:PF05193" FT CDS 758701..759597 FT /transl_table=11 FT /gene="dapA" FT /locus_tag="Cj0806" FT /product="dihydrodipicolinate synthase" FT /EC_number="4.2.1.52" FT /note="Original (2000) note: Cj0806, dapA, probable FT dihydrodipicolinate synthase, len: 298 aa; simimlar to many FT e.g. DAPA_ECOLI dihydrodipicolinate synthase (EC 4.2.1.52) FT (292 aa), fasta scores; opt: 697 z-score: 792.3 E(): 0, FT 38.1% identity in 291 aa overlap. 56.5% identity to HP1013. FT Contains PS00665 and PS00666 Dihydrodipicolinate synthetase FT signatures 1 and 2, and Pfam match to entry PF00701 DHDPS, FT Dihydrodipicolinate synthetase" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with acceptable identity score. Putative not needed to FT product function. Functional classification - Amino acid FT biosynthesis - Aspartate family" FT /note="PMID:3514578, PMID:15158272" FT /db_xref="GOA:Q9PPB4" FT /db_xref="InterPro:IPR002220" FT /db_xref="InterPro:IPR005263" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR020624" FT /db_xref="InterPro:IPR020625" FT /db_xref="PDB:3LER" FT /db_xref="PDB:3M5V" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPB4" FT /inference="protein motif:Pfam:PF00701" FT /inference="protein motif:Prosite:PS00666" FT /inference="protein motif:Prosite:PS00665" FT /protein_id="CAL34934.1" FT /translation="MDKNIIIGAMTALITPFKNGKVDEQSYARLIKRQIENGIDAVVPV FT GTTGESATLTHEEHRTCIEIAVETCKGTKVKVLAGAGSNATHEAVGLAKFAKEHGADGI FT LSVAPYYNKPTQQGLYEHYKAIAQSVDIPVLLYNVPGRTGCEISTDTIIKLFRDCENIY FT GVKEASGNIDKCVDLLAHEPRMMLISGEDAINYPILSNGGKGVISVTSNLLPDMISALT FT HFALDENYKEAKKINDELYNINKILFCESNPIPIKTAMYLAGLIESLEFRLPLCSPSKE FT NFAKIEEVMKKYKIKGF" FT misc_feature 758713..759582 FT /note="HMMPfam hit to PF00701, Dihydrodipicolinate FT synthetase family, score 2e-106" FT /inference="protein motif:Pfam:PF00701" FT misc_feature 758821..758874 FT /note="PS00665 Dihydrodipicolinate synthetase signature 1" FT /inference="protein motif:Prosite:PS00665" FT misc_feature 759109..759204 FT /note="PS00666 Dihydrodipicolinate synthetase signature 2" FT /inference="protein motif:Prosite:PS00666" FT CDS 759597..760376 FT /transl_table=11 FT /locus_tag="Cj0807" FT /product="putative oxidoreductase" FT /note="Updated (2006) note: Similarity to more than one FT genus. Putative kept within product function" FT /note="Original (2000) note: Cj0807, probable FT oxidoreductase, len: 259 aa; similar to members of the FT short-chain dehydrogenase/reductase family e.g. SOU1_CANAL FT sorbitol utilization protein SOU1 (281 aa), fasta scores; FT opt: 422 z-score: 477.6 E(): 2.6e-19, 32.9% identity in 258 FT aa overlap, and HDHA_ECOLI 7-alpha-hydroxysteroid FT dehydrogenase (255 aa), fasta scores; opt: 377 z-score: FT 428.4 E(): 1.4e-16, 34.3% identity in 254 aa overlap. 65.3% FT identity to HP1014. Contains Pfam matches to entry PF00106 FT adh_short, Alcohol/other dehydrogenases, short chain type, FT and to entry PF00678 adh_short_C2, Short chain FT dehydrogenase/reductase C-terminus. Also contains two FT polymorphic G/A bases giving a K/E polymorphism at aa 198 FT and a T/A polymorphism at aa 206. These are not highly FT conserved positions in related proteins. Functional FT classification - Misc" FT /db_xref="GOA:Q0PA83" FT /db_xref="InterPro:IPR002198" FT /db_xref="InterPro:IPR002347" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:Q0PA83" FT /inference="protein motif:Pfam:PF00678" FT /inference="protein motif:Pfam:PF00106" FT /protein_id="CAL34935.1" FT /translation="MNTEFQGKTLVISGGTRGIGKAIVYEFAKVGANIAFTYNSNAQIA FT DEMVQDLEKNYKIKARAYEFNILEPETYKELFEKIDVDFDRVDYFISNAIISGRAVVGG FT YTKFMKLKPKGINNIFTATVNAFVVGAQEAAKRMEKVGGGSIISISSTGNLVYIENYSG FT HGTAKAAVEAMARYAATELGEKNIRVNVVSGGPIKTDALRAFTNYEEVKQATINLSPLN FT RMGQPEDLAGACLFLCSSKASWVTGHTFIVDGGTTFK" FT misc_feature 759624..760364 FT /note="HMMPfam hit to PF00106, short chain FT dehydrogenase,score 1e-43" FT /inference="protein motif:Pfam:PF00106" FT CDS complement(760417..760722) FT /transl_table=11 FT /locus_tag="Cj0808c" FT /product="small hydrophobic protein" FT /note="Original (2000) note: Cj0808c, small hydrophobic FT protein, len: 101 aa; no Hp match" FT /note="Updated (2006) note: Three probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PA82" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34936.1" FT /translation="MELDQILLYAFIFLNLFALFGLFLGNKKKNQFNDKKFYKICPCKK FT MAENGSLSTICIYSAVGGFFYSVLSIGFVGFGNWTLNFIFLLALLSVFLGWKLKLD" FT misc_feature complement(join(760645..760710,760516..760584, FT 760435..760503)) FT /note="3 probable transmembrane helices predicted for FT Cj0808c by TMHMM2.0 at aa 5-26, 47-69 and 74-96" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(760734..761330) FT /transl_table=11 FT /locus_tag="Cj0809c" FT /product="putative hydrolase" FT /note="Original (2000) note: Cj0809c, possible FT hydrolase,len: 198 aa; similar to many hypothetical FT proteins belonging to the glyoxalase II family e.g. FT YQGX_BACSU (211 aa), fasta scores; opt: 289 z-score: 365.7 FT E(): 4.5e-13,32.8% identity in 204 aa overlap. 44.3% FT identity to HP0813. Contains Pfam match to entry PF00753 FT lactamase_B,Metallo-beta-lactamase superfamily" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores carried out yet. Putative FT kept within product function. Functional classification FT -Misc" FT /db_xref="GOA:Q6B8H9" FT /db_xref="InterPro:IPR001279" FT /db_xref="UniProtKB/TrEMBL:Q6B8H9" FT /inference="protein motif:Pfam:PF00753" FT /protein_id="CAL34937.1" FT /translation="MQIIKQACGVYETNCYILFTPKGEFIIDPGTDALLFIKKHVKNPL FT AILNTHGHYDHIWDNAKVKKEYNIPIYIHKNDAFMLHDDFNQGYDSSDADFLVDNEDIL FT NICGVDFKFHFLPGHTPGCTMIEIVGKNIMFSGDFLFYRSIGRWDFPYSDANLMKQSLE FT KVMTYKEDFKLLPGHGQETTLKEEQVHLPSWLRYF" FT misc_feature complement(760797..761297) FT /note="HMMPfam hit to PF00753, Metallo-beta-lactamase FT superfamily, score 3.6e-34" FT /inference="protein motif:Pfam:PF00753" FT CDS 761404..762144 FT /transl_table=11 FT /gene="nadE" FT /locus_tag="Cj0810" FT /product="NH(3)-dependent NAD(+) synthetase" FT /EC_number="6.3.5.1" FT /note="Original (2000) note: Cj0810, nadE, possible FT NH(3)-dependent NAD(+) synthetase, len: 246 aa; similar to FT many putative nadE prteins, and to NADE_ECOLI FT NH(3)-dependent NAD(+) synthetase (EC 6.3.5.1) (275 FT aa),fasta scores; opt: 208 z-score: 252.5 E(): 9.1e-07, FT 28.3% identity in 230 aa overlap. 47.2% identity to HP0329" FT /note="Updated (2006) note: Pfam domain PF02540 NAD FT synthase identified within CDS. Further support given to FT product function. Characterised within Escherichia coli and FT Bacillus subtilis with marginal identity scores. FT Appropriate motifs present. Putative removed from product FT function. Functional classification - Biosynthesis of FT cofactors, prosthetic groups and carriers - Pyridine FT nucleotide" FT /note="PMID:12077433, PMID:11375500" FT /db_xref="GOA:Q9PPB0" FT /db_xref="InterPro:IPR003694" FT /db_xref="InterPro:IPR014729" FT /db_xref="InterPro:IPR022310" FT /db_xref="InterPro:IPR022926" FT /db_xref="PDB:3P52" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPB0" FT /inference="protein motif:Pfam:PF02540" FT /protein_id="CAL34938.1" FT /translation="MDWQKITEKMCDFIQEKVKNSQSQGVVLGLSGGIDSALVATLCKR FT ALKENVFALLMPTQISNKANLEDALRLCADLNLEYKIIEIQSILDAFIKQSENTTLVSL FT GNFAARIRMSLLYDYSALKNSLVIGTSNKSELLLGYGTIYGDLACAFNPIGSLYKSEIY FT ALAKYLNLHENFIKKAPSADLWENQSDEADLGFSYTKIDEGLKALETNDEKLLRTLDPS FT LIAMLKNRMQKNAFKGKMPEILEI" FT misc_feature 761569..762138 FT /note="HMMPfam hit to PF02540, NAD synthase, score 7.9e-62" FT /inference="protein motif:Pfam:PF02540" FT CDS 762148..763074 FT /transl_table=11 FT /gene="lpxK" FT /locus_tag="Cj0811" FT /product="tetraacyldisaccharide 4'-kinase" FT /EC_number="2.7.1.130" FT /note="Original (2000) note: Cj0811, lpxK, possible FT tetraacyldisaccharide 4'-kinase, len: 308 aa; similar to FT hypothetical proteins and e.g. LPXK_ECOLI FT tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (328 FT aa),fasta scores; opt: 182 z-score: 221.7 E(): 4.7e-05, FT 24.9% identity in 289 aa overlap. 41.3% identity to HP0328" FT /note="Updated (2006) note: Pfam domain PF02606 FT Tetraacyldisaccharide-1-P 4'-kinase identified within CDS. FT One probable transmembrane helix predicted by TMHMM2.0. FT Further support given to product function. Characterised FT within Escherichia coli with marginal identity score. FT Putative removed from product function. Functional FT classification - Surface FT polysaccharides,lipopolysaccharides and antigens" FT /note="PMID:9575203" FT /db_xref="GOA:Q9PPA9" FT /db_xref="InterPro:IPR003758" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPA9" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02606" FT /protein_id="CAL34939.1" FT /translation="MNEEKNYELWLDNYFFKPNFWQKCLAFILLPLSVLYAFFAILNTF FT FRKKIVFKKPVISVGNLSFGGNGKTPLCKAIAREFDGVFIVLRGYKRKSKGLFVVKNQN FT EILCTLTQSGDEAMEYAFEENIKGVIVSEDRVKGIEKAFELGAKIVVLDDAFSKFHIKK FT FDILLESKIKPYFNFTLPSGAYRLPKFYEKRADFIALEGRDFVRYSFVKENPKAVLVTA FT IAKPFRLYEHFIKARACYFFKDHYEFKKEELENLLKKHNCDTLMLTFKDFVKVKDFGFK FT CQIIELNIELKDSLREKIKTYIKEFEQ" FT misc_feature 762187..763071 FT /note="HMMPfam hit to PF02606, Tetraacyldisaccharide-1-P FT 4'-kinase, score 1e-24" FT /inference="protein motif:Pfam:PF02606" FT misc_feature 762217..762285 FT /note="1 probable transmembrane helix predicted for Cj0811 FT by TMHMM2.0 at aa 24-46" FT /inference="protein motif:TMHMM:2.0" FT CDS 763071..764483 FT /transl_table=11 FT /gene="thrC" FT /locus_tag="Cj0812" FT /product="threonine synthase. Functional FT classification-Amino acid biosynthesis-Aspartate family" FT /EC_number="4.2.3.1" FT /note="Updated (2006) note: Characterised within FT Pseudomonas aeruginosa with acceptable identity score. FT Appropriate motifs present. Putative not added to product FT function" FT /note="Original (2000) note: Cj0812, thrC, probable FT threonine synthase, len: 470 aa; similar to e.g. THRC_YEAST FT threonine synthase (EC 4.2.99.2) (514 aa),fasta scores; FT opt: 595 z-score: 671.2 E(): 4.3e-30, 33.6% identity in 464 FT aa overlap, and THRC_PSEAE (470 aa), fasta scores; opt: 647 FT z-score: 730.2 E(): 0, 32.3% identity in 434 aa overlap. FT 43.5% identity to HP0098. Contains PS00165 Serine/threonine FT dehydratases pyridoxal-phosphate attachment site, and Pfam FT match to entry PF00291 S_T_dehydratase, Pyridoxal-phosphate FT dependant enzymes" FT /note="PMID:1333566" FT /db_xref="GOA:Q0PA78" FT /db_xref="InterPro:IPR000634" FT /db_xref="InterPro:IPR001926" FT /db_xref="InterPro:IPR004450" FT /db_xref="UniProtKB/TrEMBL:Q0PA78" FT /inference="protein motif:Pfam:PF00291" FT /inference="protein motif:Prosite:PS00165" FT /protein_id="CAL34940.1" FT /translation="MKLVESRNVNNVSSFKEALINPNAPEGGLYSPLNLPIFEGEKYAN FT LSYKDFALKLIESFGFGEEELFKKALKSYESFDDKNTPISLQKISEKTYINELWHGPTR FT AFKDMALQPFGVLLSEFSKDKNILIICATSGDTGPATLKSFENAKNVKVACMYPKGGTS FT GVQELQMRALDKDNLKVFAIDEDFDAAQRTLKELLFSKDFQNEIKALNYELCAANSVNF FT GRILFQIIYHYYASLKLFNEFLEEVQIIVPSGNFGNALGAFYAKKMGAKISKIKIASNA FT NNILSEFFNQGVYDLREKSLKKTISPAMDILISSNIERLLFAKFKDKRTKELMNLLKNE FT RYFKLEKEELQSLQEDFEADFCTDEECMQFIKQSKILIDPHTATCFKMLDPLKPSIITS FT TAEWTKFTPSMIKALYDRDSKNEKEDLKFIAKEFNVQVKDEILALFDLKNSDEKVFEAR FT NIKKEILDWMQK" FT misc_feature 763293..764165 FT /note="HMMPfam hit to PF00291, Pyridoxal-phosphate FT dependent enzyme, score 4e-08" FT /inference="protein motif:Pfam:PF00291" FT misc_feature 763359..763403 FT /note="PS00165 Serine/threonine dehydratases FT pyridoxal-phosphate attachment site" FT /inference="protein motif:Prosite:PS00165" FT CDS 764480..765199 FT /transl_table=11 FT /gene="kdsB" FT /locus_tag="Cj0813" FT /product="3-deoxy-manno-octulosonate cytidylyltransferase" FT /EC_number="2.7.7.38" FT /note="Original (2000) note: Cj0813, kdsB, probable FT 3-deoxy-manno-octulosonate cytidylyltransferase, len: 239 FT aa; similar to e.g. KDSB_ECOLI 3-deoxy-manno-octulosonate FT cytidylyltransferase (EC 2.7.7.38) (247 aa), fasta scores; FT opt: 519 z-score: 611.2 E(): 9.6e-27, 39.7% identity in 242 FT aa overlap. 47.9% identity to HP0230" FT /note="Updated (2006) note: Pfam domain PF02348 FT Cytidylyltransferase identified within CDS. Further support FT given to product function. Characterised in Escherichia FT coli with acceptable identity score, so putative not added FT to product function. Functional classification - Surface FT polysaccharides,lipopolysaccharides and antigens" FT /note="PMID:3023327" FT /db_xref="GOA:Q0PA77" FT /db_xref="InterPro:IPR003329" FT /db_xref="InterPro:IPR004528" FT /db_xref="UniProtKB/TrEMBL:Q0PA77" FT /inference="protein motif:Pfam:PF02348" FT /protein_id="CAL34941.1" FT /translation="MIIIPARLKSSRFHEKILCDIGGVPMFVATARRVSSVDEVCIALD FT DEKVLSIAKEYGLNAVLTSKDHESGTDRINEACKKLALKDDEIIINVQADEPFIECENL FT LKFKEFASFCLDKKAFMASCYKKITQEEAMDPNLVKVLCDKEGYALYFSRAKIPYEREN FT YEESFKGHLGIYAYSVKALREFCSLSSSALERAEKLEQLRAIENGKKIKMLEISTTSMG FT IDTKEDYERALKIYLEK" FT misc_feature 764480..765112 FT /note="HMMPfam hit to PF02348, Cytidylyltransferase, score FT 1.9e-54" FT /inference="protein motif:Pfam:PF02348" FT CDS 765304..766059 FT /transl_table=11 FT /locus_tag="Cj0814" FT /product="hypothetical protein Cj0814. Functional FT classification-Unknown" FT /note="Original (2000) note: Cj0814, unknown, len: 251 aa; FT no Hp match. Almost identical to the N-teminus of Cj0794; FT similarity continues in Cj0815 and Cj0816: may represent a FT pseudogene fragment" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria" FT /db_xref="UniProtKB/TrEMBL:Q0PA76" FT /protein_id="CAL34942.1" FT /translation="MITQTMQSKESKESKENSKISFANAFLKQNASKLNEIQNANSQTL FT ARSEALNSTNTTNTSNNTNFSISSKTSSPNYDISSEFKNSIYTLKYKQVDISNTSTNTA FT YGYSVDKDGYMGSDFNKAAGLPEDFKIHKSTLDEIKKAAENDPVVSSTKEYLGVSSYYS FT NIDIANTIKQYYNLFSNALGQSFSNDKTSFSEADINSMPSGYGVSGTQWMDFNEPSNRM FT NITGLKDFSNSLISNVYKTPEQAKEADEI" FT CDS 766075..766419 FT /transl_table=11 FT /locus_tag="Cj0815" FT /product="hypothetical protein Cj0815" FT /note="Original (2000) note: Cj0815, unknown, len: 114 aa; FT no Hp match. Almost identical to the centre of Cj0794; FT similarity continues from Cj0814 and into Cj0816: may FT represent a pseudogene fragment. Functional classification FT - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PA75" FT /protein_id="CAL34943.1" FT /translation="MIKGLSSETLGLSLEEIKNVSRGEDWQFNPDMSVYPQNEDGSYSK FT ETLFMSFLKAQGGQPVESLKTTLNPKLEAYKRAMAKESFSGPAINIDSIMTGKSDFKSF FT FRYWAEWHRR" FT CDS 766427..766597 FT /transl_table=11 FT /locus_tag="Cj0816" FT /product="hypothetical protein Cj0816" FT /note="Original (2000) note: Cj0816, unknown, len: 56 aa; FT no Hp match. Almost identical to the C-terminus of Cj0794; FT similarity continues from Cj0814 and Cj0815: may represent FT a pseudogene fragment. Functional classification -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PA74" FT /protein_id="CAL34944.1" FT /translation="MYENNISKESAMGNWALDAEIKQALANGWKAKPSTIDSYADSIMD FT RLNNLLGQTRV" FT CDS 766692..767462 FT /transl_table=11 FT /gene="glnH" FT /locus_tag="Cj0817" FT /product="putative glutamine binding periplasmic protein" FT /note="Original (2000) note: Cj0817, glnH, probable FT glutamine-binding periplasmic protein, len: 256 aa; similar FT to e.g. GLNH_ECOLI glutamine-binding periplasmic protein FT precursor (248 aa), fasta scores; opt: 382 z-score: 441.9 FT E(): 2.6e-17, 32.5% identity in 243 aa overlap. 29.0% FT identity to HP0940. Contains Pfam match to entry PF00497 FT SBP_bac_3, Bacterial extracellular solute-binding proteins, FT family 3" FT /note="Updated (2006) note: Characterised with marginal FT identity scores in more than one bacteria. Prosite domain FT PS50121, Solute binding protein/glutamate receptor domain FT identified within CDS. Further support given to product FT function. Putative added to product function. Functional FT classification - Transport/binding proteins - Amino acids FT and amines" FT /note="PMID:3027504, PMID:9571045, PMID:9142743" FT /db_xref="GOA:Q0PA73" FT /db_xref="InterPro:IPR001638" FT /db_xref="UniProtKB/TrEMBL:Q0PA73" FT /inference="protein motif:Pfam:PF00497" FT /inference="protein motif:Prosite:PS50121" FT /protein_id="CAL34945.1" FT /translation="MKKIILIFISFFALNLSAKDLVVGMELGYPPFEMSDKTGKASGIS FT VDFLEAFAKKNGYKLVVKNIAWDGLIPALKTAKIDLIMSSMTITDKRKKVVDFSIPYAK FT ANLAILTPLNSDITNIKDLDKKGKVLALKRGSTGHLYAVKNLKNATINLFDKENAAILE FT VIQGKADGFFYDQLTIYRTWQKHQDTTRAILAPFQENPEFWGIAVRKGDEALKDKLDNF FT IDESRKNGFLDFLGNKYLKDIKEVFKQNNITFFL" FT sig_peptide 766692..766745 FT /note="Signal peptide predicted for glnH by SignalP 2.0 HMM FT (Signal peptide probability 0.763) with cleavage site FT probability 0.724 between residues 18 and 19" FT misc_feature 766752..767417 FT /note="HMMPfam hit to PF00497, Bacterial extracellular FT solute-binding prot, score 1.3e-79" FT /inference="protein motif:Pfam:PF00497" FT CDS 767555..767782 FT /transl_table=11 FT /locus_tag="Cj0818" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0818, probable FT lipoprotein,len: 75 aa; no Hp match. Contains N-terminal FT signal sequence and appropriately positioned PS00013 FT Prokaryotic membrane lipoprotein lipid attachment site. FT Functional classification - Membranes, lipoproteins and FT porins" FT /db_xref="UniProtKB/TrEMBL:Q0PA72" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34946.1" FT /translation="MKKVAFFLLFLFLSCTVLNAAREYCKYAYQEDRAIPLILNYGIRL FT GVVGAGVANAPAPGGSTYNSKIDMMAARCH" FT sig_peptide 767555..767620 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000383_767555_767782 by SignalP 2.0 FT HMM (Signal peptide probability 0.998) with cleavage site FT probability 0.481 between residues 22 and 23" FT misc_feature 767564..767617 FT /note="1 probable transmembrane helix predicted for Cj0818 FT by TMHMM2.0 at aa 4-21" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 767567..767599 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS 767808..768032 FT /transl_table=11 FT /locus_tag="Cj0819" FT /product="small hydrophobic protein" FT /note="Original (2000) note: Cj0819, small hydrophobic FT protein, len 74 aa; no Hp match" FT /note="Updated (2006) note: Two probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PA71" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34947.1" FT /translation="MLEFIFTLILDFTFYSIKTLEKVFLGRTALVILFVVFIALFCVKG FT LFLYILLALELFLLLYLFLGILFLRFYKS" FT misc_feature order(767874..767933,767946..768014) FT /note="2 probable transmembrane helices predicted for FT Cj0819 by TMHMM2.0 at aa 23-42 and 47-69" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(768029..768763) FT /transl_table=11 FT /gene="fliP" FT /locus_tag="Cj0820c" FT /product="flagellar biosynthesis protein" FT /note="Updated (2006) note: PMID:7601828, PMID:14617189" FT /note="Original (2000) note: Cj0820c, fliP, probable FT flagellar biosynthesis protein, len: 244 aa; simlar to e.g. FT FLIP_ECOLI flagellar biosynthetic protein FLIP (245 aa), FT fasta scores; opt: 770 z-score: 921.7 E(): 0, 48.1% FT identity in 241 aa overlap. Similar to two consecutive Hp FT ORF's, probably representing a frameshift: HP0684 (105 FT aa,56.1% identity) and HP0685 (172 aa, 76.3% identity). FT Contains PS01060 Flagella transport protein fliP family FT signature 1" FT /note="Updated (2006) note: Pfam domain PF00813 FliP family FT identified within CDS. Prosite domain PS01061 Flagella FT transport protein fliP family signature 2, Type III FT secretion system inner membrane P protein also identified FT within CDS. Also, Five probable transmembrane helices FT predicted by TMHMM2.0. Further support given to product FT function. Characterised in Caulobacter crescentus and FT Escherichia coli with acceptable identity scores. Putative FT not added to product function. Functional classification - FT Surface structures" FT /db_xref="GOA:Q0PA70" FT /db_xref="InterPro:IPR005837" FT /db_xref="InterPro:IPR005838" FT /db_xref="UniProtKB/TrEMBL:Q0PA70" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00813" FT /inference="protein motif:Prosite:PS01060" FT /inference="protein motif:Prosite:PS01061" FT /protein_id="CAL34948.1" FT /translation="MKKILLFLLLSMSLFAAEATIPTVNLSLSAPNTPNQLVTTLNIVI FT VLTILALAPSIVFVMTSFLRLIVVFSFLRQAMGTQSMPPNTILVTLALILTFFIMEPVA FT TKSYNEGIKPYLAEKIGYEEAFIKGAKPFKDFMLKNTREKDLALFYRIRNLPNPKTIDD FT VPLTVLVPAFMISELKTAFEIGFLIYLPFLVIDMVVSSVLMAMGMMMLPPTMISLPFKL FT LIFVLVDGWNLLVQRLVESFVT" FT misc_feature complement(768047..768628) FT /note="HMMPfam hit to PF00813, FliP family, score 1.4e-113" FT /inference="protein motif:Pfam:PF00813" FT misc_feature complement(join(768686..768754,768581..768649, FT 768470..768538,768146..768214,768059..768118)) FT /note="5 probable transmembrane helices predicted for FT Cj0820c by TMHMM2.0 at aa 4-26, 39-61, 76-98, 184-206 and FT 216-235" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(768071..768109) FT /note="PS01061 Flagella transport protein fliP family FT signature 2" FT /inference="protein motif:Prosite:PS01061" FT misc_feature complement(768206..768253) FT /note="PS01060 Flagella transport protein fliP family FT signature 1" FT /inference="protein motif:Prosite:PS01060" FT sig_peptide complement(768677..768763) FT /note="Signal peptide predicted for fliP by SignalP 2.0 HMM FT (Signal peptide probability 1.000) with cleavage site FT probability 0.306 between residues 29 and 30" FT CDS 768906..770195 FT /transl_table=11 FT /gene="glmU" FT /locus_tag="Cj0821" FT /product="UDP-N-acetylglucosamine pyrophosphorylase" FT /EC_number="2.7.7.23" FT /note="Original (2000) note: Cj0821, glmU, probable FT UDP-N-acetylglucosamine pyrophosphorylase, len: 429 aa; FT similar to e.g. GLMU_ECOLI UDP-N-acetylglucosamine FT pyrophosphorylase (EC 2.7.7.23) (456 aa), fasta scores; FT opt: 437 z-score: 494.9 E(): 2.9e-20, 37.4% identity in 455 FT aa overlap. 47.1% identity to HP0683. Contains Pfam match FT to entry PF00483 NTP_transferase, Nucleotidyl transferase, FT and 2x Pfam match to entry PF00132 hexapep,Bacterial FT transferase hexapeptide (four repeats)" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with acceptable identity score, so putative not added FT to product function. Functional classification - Central FT intermediary metabolism - Sugar nucleotides" FT /note="PMID:11329257, PMID:11173485" FT /db_xref="GOA:Q9PPA2" FT /db_xref="InterPro:IPR001451" FT /db_xref="InterPro:IPR005882" FT /db_xref="InterPro:IPR011004" FT /db_xref="UniProtKB/Swiss-Prot:Q9PPA2" FT /inference="protein motif:Pfam:PF00132" FT /inference="protein motif:Pfam:PF00483" FT /protein_id="CAL34949.1" FT /translation="MKTSILILAAGLGTRIKSQKPKVLQELCQKSMILHILKKAFALSD FT DVSVVLSHQKERVEKEILEYFPKTQILEQDLQNYPGTAGALSGFEPKNERVLILCGDMP FT LVEQTSLEALLGNNAKLNLAVFKARDPKSYGRVVIKNDSVEKIVEFKDANTQEKEINTC FT NAGVYVIDSRLLKELLPLIDNNNAAKEYYLTDIVKLAKEKDVMIKAVFVDEDEFMGIND FT KFELSIAENFMQKKIKKYWMQQGVIFHLPQSTFIGADVEFVGECEVYENVRIEGKSKII FT NSIIKSSSVIENSIVENSDVGPLAHLRPNCELKNTHIGNFVECKNAKLNTVKAGHLSYL FT GDCEIDSGTNIGCGTITCNYDGVKKHKTIIGKNVFVGSDTQFIAPVKIEDEVIIAAGST FT VSINVEKGALFINRAGHKMIKDYYYKKFQK" FT misc_feature 768921..769586 FT /note="HMMPfam hit to PF00483, Nucleotidyl FT transferase,score 1.9e-06" FT /inference="protein motif:Pfam:PF00483" FT misc_feature 769662..769715 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (th, score 15" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 769929..769982 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (th, score 45" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 770004..770057 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (th, score 15" FT /inference="protein motif:Pfam:PF00132" FT misc_feature 770058..770111 FT /note="HMMPfam hit to PF00132, Bacterial transferase FT hexapeptide (th, score 58" FT /inference="protein motif:Pfam:PF00132" FT CDS 770192..771346 FT /transl_table=11 FT /gene="dfp" FT /locus_tag="Cj0822" FT /product="phosphopantothenoylcysteine decarboxylase" FT /EC_number="4.1.1.36" FT /note="Original (2000) note: Cj0822, dfp, DNA/pantothenate FT metabolism flavoprotein, len: 384 aa; similar to e.g. FT DFP_ECOLI DNA/pantothenate metabolism flavoprotein (430 FT aa), fasta scores; opt: 451 z-score: 524.7 E(): FT 6.3e-22,29.4% identity in 385 aa overlap. 38.6% identity to FT HP0841" FT /note="Updated (2006) note: Pfam domains PF02441 FT Flavoprotein and PF04127 DNA/pantothenate metabolism FT flavoprotein were identified within CDS. Further support FT given to product function. Literature search and similarity FT search results have identified that part of the Dfp protein FT catalyzes the next step in CoA biosynthesis. FT Characterisation in Escherichia coli has shown that Dfp has FT phosphopantothenoylcysteine decarboxylase activity and uses FT CTP rather than ATP as the activating nucleoside FT 5'-triphosphate. Product function and gene name modified FT based on this information. Functional classification FT -Biosynthesis of cofactors, prosthetic groups and carriers FT - Pantothenate" FT /note="PMID:11278255" FT /db_xref="GOA:Q0PA68" FT /db_xref="InterPro:IPR003382" FT /db_xref="InterPro:IPR005252" FT /db_xref="InterPro:IPR007085" FT /db_xref="UniProtKB/TrEMBL:Q0PA68" FT /inference="protein motif:Pfam:PF04127" FT /inference="protein motif:Pfam:PF02441" FT /protein_id="CAL34950.1" FT /translation="MKTILLAISGSIAFYKSYELISLFKKEGFRVKVLLSNGLLKFASK FT MSFEALVDEVLCEENESWQNSNNHIAFSKDVDLVLFTPASVNSINKLAFGIADNLFIQT FT LIAANKPLIIAPAANTNMFHHFSTQNSLKILKENKALIIEPICKVLACKDEGVGALAEV FT KDIFNITKRELLKEKFWCNKSVVITGGGTRERIDDVRCVSNFSSGKMAKAIADAFYFLG FT ARVKLLSSVEFDTPYELCKFESSKDLKELLDKNLSHDFLIMTAAVSDFIPQSVKGKIKK FT NEHLQGLNLHLSLNEDLLKTCKFQGKKIGFKMEFDSQNALENAKKSLKDKQLDMVCLNI FT IDQKNYFGSDQNELYFITLNNENKSTLQSKEKLAFELVKWCEKL" FT misc_feature 770195..770542 FT /note="HMMPfam hit to PF02441, Flavoprotein, score 1.3e-25" FT /inference="protein motif:Pfam:PF02441" FT misc_feature 770735..771307 FT /note="HMMPfam hit to PF04127, DNA / pantothenate FT metabolism flavoprote, score 1.2e-16" FT /inference="protein motif:Pfam:PF04127" FT CDS 771343..771960 FT /transl_table=11 FT /locus_tag="Cj0823" FT /product="hypothetical protein Cj0823" FT /note="Original (2000) note: Cj0823, unknown, len: 205 aa; FT 24.3% identity to HP0842" FT /note="Updated (2006) note: One probable transmembrane FT helix predicted by TMHMM2.0. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PA67" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34951.1" FT /translation="MSMINSTLPIQMKVLAKSGYGHYTLLLNHKKIQTKSMIELEIGAE FT YLAELYMQNGGVIQFKHLSKRPNFKPFEEGLALIIAILEDKISYKKFIIQNLLDCKDIE FT RYQILKEMLFASFENIYHIPFNFENKSCLFQMRKRAKYLEIYLYFSVFGALKILIDSQG FT ISVFTPFAKVQKFLNEHLDFNVSQENKIEPLFVFKRLFDFKG" FT misc_feature 771775..771843 FT /note="1 probable transmembrane helix predicted for Cj0823 FT by TMHMM2.0 at aa 145-167" FT /inference="protein motif:TMHMM:2.0" FT CDS 771964..772632 FT /transl_table=11 FT /gene="uppS" FT /locus_tag="Cj0824" FT /product="undecaprenyl diphosphate synthase" FT /note="Original (2000) note: Cj0824, uppS, probable FT undecaprenyl diphosphate synthase, len: 222 aa; similar to FT TR:O82827 (EMBL:AB004319) Micrococcus luteus undecaprenyl FT diphosphate synthase (249 aa), fasta scores; opt: 365 FT z-score: 445.7 E(): 1.6e-17, 35.2% identity in 227 aa FT overlap, and to other members of the UPF0015 family e.g. FT YAES_ECOLI (252 aa), fasta scores; opt: 371 z-score: 452.7 FT E(): 6.4e-18, 37.2% identity in 226 aa overlap. 42.6% FT identity to HP1221. Contains Pfam match to entry PF01255 FT UPF0015" FT /note="Updated (2006) note: Previous Pfam domain has now FT been given a classification as PF01255 Putative FT undecaprenyl diphosphate synthase. Further support given to FT product function. Characterised within Escherichia coli FT with acceptable identity score. UPPS (undecaprenyl FT pyrophosphate synthase) catalyses consecutive condensation FT reactions of FPP (farnesyl pyrophosphate) with eight FT isopentenyl pyrophosphates to generate C55 UPP, which FT serves as a lipid carrier for bacterial peptidoglycan FT biosynthesis. Putative removed from product function. FT Functional classification - Synthesis and modification of FT macromolecules - Phospholipids" FT /note="PMID:9882662, PMID:12756244, PMID:15447632" FT /db_xref="GOA:Q9PP99" FT /db_xref="InterPro:IPR001441" FT /db_xref="InterPro:IPR018520" FT /db_xref="PDB:3UGS" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP99" FT /inference="protein motif:Pfam:PF01255" FT /protein_id="CAL34952.1" FT /translation="MNELKHLAVVMDGNRRWARAKGFLAKLGYSQGVKTMQKLMEVCME FT ENISNLSLFAFSTENWKRPKDEIDFIFELLDRCLDEALEKFEKNNVRLRAIGDLSRLED FT KVREKITLVEEKTKHCDALCVNLAISYGARDEIIRAAKRVIEKKLELNEENLTQNLDLP FT LDVDLMLRVGNAKRLSNFLLWQCSYAEIYFSETLFPSLTKREFKRIIKEFRNRERTFGK FT " FT misc_feature 771991..772629 FT /note="HMMPfam hit to PF01255, Putative undecaprenyl FT diphosphate syntha, score 2.6e-72" FT /inference="protein motif:Pfam:PF01255" FT CDS 772629..773405 FT /transl_table=11 FT /locus_tag="Cj0825" FT /product="putative processing peptidase" FT /note="Original (2000) note: Cj0825, possible processing FT peptidase, len: 258 aa; similar to e.g. LEP3_VIBCH type 4 FT prepilin-like protein specific leader peptidase (253 FT aa),fasta scores; opt: 261 z-score: 323.9 E(): 9.7e-11, FT 28.5% identity in 260 aa overlap. No Hp match. Contains FT several probable membrane spanning domains" FT /note="Updated (2006) note: Pfam domains PF06750 Bacterial FT Peptidase A24 N-terminal domain and PF01478 Type IV leader FT peptidase family were identified within CDS. Further FT support given to product function. No specific FT characterisation with acceptable identity score carried out FT yet. Putative kept within product function. Literature FT search identified literature giving further clues to FT product function. Functional classification - Protein FT translation and modification" FT /note="PMID:12949093, PMID:2553669" FT /db_xref="GOA:Q0PA65" FT /db_xref="InterPro:IPR000045" FT /db_xref="InterPro:IPR010627" FT /db_xref="UniProtKB/TrEMBL:Q0PA65" FT /inference="protein motif:Pfam:PF01478" FT /inference="protein motif:Pfam:PF06750" FT /protein_id="CAL34953.1" FT /translation="MIFFIIILGACLGSFCTSLASRIIEKKLFFISRSFCFSCDTKLKY FT YEIIPIFSYIFLKAKCQTCKCHLSISLLINEILGAILLILVYSLSQNFYDFLFLSLFLF FT NLFLLSLIDIKLKAVPQILLWSAFLFAFFYAFRESEILHFLIFKEFSGGFLLNAFSFGG FT FVFLLKSLVFFLMNFQKKDEILENLGDADIIIMSCIGGILGFEYGFLVLFIASILTLPF FT FIFFRIKAIKEQELAMIPFLNIAFVAVLFYKNLGLF" FT misc_feature 772629..772661 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT sig_peptide 772629..772694 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000386_772629_773405 by SignalP 2.0 FT HMM (Signal peptide probability 0.917) with cleavage site FT probability 0.704 between residues 22 and 23" FT misc_feature order(772641..772700,772827..772895,772905..772964, FT 772983..773036,773079..773147,773235..773303, FT 773331..773399) FT /note="7 probable transmembrane helices predicted for FT Cj0825 by TMHMM2.0 at aa 5-24, 67-89, 93-112, FT 119-136,151-173, 203-225 and 235-257" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 772647..772904 FT /note="HMMPfam hit to PF06750, Bacterial Peptidase A24 FT N-terminal doma, score 1.1e-39" FT /inference="protein motif:Pfam:PF06750" FT misc_feature 772926..773300 FT /note="HMMPfam hit to PF01478, Type IV leader peptidase FT family, score 2.3e-17" FT /inference="protein motif:Pfam:PF01478" FT CDS 773405..774430 FT /transl_table=11 FT /locus_tag="Cj0826" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0826, probable integral FT membrane protein, len: 341 aa; similar to hypothetical FT membrane proteins e.g. YJGP_HAEIN (372 aa), fasta scores; FT opt: 203 z-score: 236.9 E(): 6.8e-06, 21.7% identity in 314 FT aa overlap. 32.3% identity to HP0362" FT /note="Updated (2006) note: Pfam domain PF03739 Predicted FT permease YjgP/YjgQ family identified within CDS. Members of FT this family are predicted integral membrane proteins of FT unknown function. Also, six probable transmembrane helices FT predicted by TMHMM2.0. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PA64" FT /db_xref="InterPro:IPR005495" FT /db_xref="UniProtKB/TrEMBL:Q0PA64" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF03739" FT /protein_id="CAL34954.1" FT /translation="MKLSLRYVLNQFLSTNLSIFFVLFAIVSMVFFIQLAKLTSSIEIS FT FLDLLKLYGFMLPRILIFTLPISFFISLTLALFRLSKENESIVLFTLGFSPMILAKFFL FT KIASLISAFMLVVALVMIPIVFELQDNFVNYKSTQVKFNYKTGEFGQKFLDWMIFIEKQ FT DSDKYENIIMYRPKHKADDKEQLIIAKEAHVQRKDDSFAFSLNQGKMYNFEQGQSIFSG FT EFDTLVVNTQFNTDNLQTKKFYEYWNDLNENLQRAREFVIYTTIALFPLASTLFALCFG FT LVTYRYEKGYVYLGMFGVIAIYFGLLSSFSQPPILACLGIFSLSLFVSAYCFKKMILSR FT Y" FT sig_peptide 773405..773518 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000387_773405_774430 by SignalP 2.0 FT HMM (Signal peptide probability 0.980) with cleavage site FT probability 0.533 between residues 38 and 39" FT misc_feature 773420..774421 FT /note="HMMPfam hit to PF03739, Predicted permease YjgP/YjgQ FT family, score 1.5e-77" FT /inference="protein motif:Pfam:PF03739" FT misc_feature order(773441..773509,773567..773635,773720..773788, FT 774185..774253,774272..774325,774335..774403) FT /note="6 probable transmembrane helices predicted for FT Cj0826 by TMHMM2.0 at aa 13-35, 55-77, 106-128, FT 261-283,290-307 and 311-333" FT /inference="protein motif:TMHMM:2.0" FT CDS 774427..775152 FT /transl_table=11 FT /gene="truA" FT /locus_tag="Cj0827" FT /product="tRNA pseudouridine synthase" FT /EC_number="4.2.1.70" FT /note="Original (2000) note: Cj0827, truA, probable tRNA FT pseudouridine synthase, len: 241 aa; simimlar to e.g. FT TRUA_BACSU tRNA pseudouridine synthase A (EC 4.2.1.70) (247 FT aa), fasta scores; opt: 330 z-score: 409.6 E(): 1.6e-15, FT 29.7% identity in 246 aa overlap. 37.4% identity to HP0361" FT /note="Updated (2006) note: Pfam domains x2 PF01416 tRNA FT pseudouridine synthase identified within CDS. Further FT support given to product function. Characterised within FT Escherichia coli and Bacillus with marginal identity FT scores. Appropriate motifs present. Putative removed from FT product function. Functional classification - Aminoacyl FT tRNA synthetases and their modification" FT /note="PMID:10625422, PMID:10588695, PMID:14993303" FT /db_xref="GOA:Q9PP96" FT /db_xref="InterPro:IPR001406" FT /db_xref="InterPro:IPR020094" FT /db_xref="InterPro:IPR020095" FT /db_xref="InterPro:IPR020097" FT /db_xref="InterPro:IPR020103" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP96" FT /inference="protein motif:Pfam:PF01416" FT /protein_id="CAL34955.1" FT /translation="MMKIKIIFSYDGSAFLGSATQPHKKGVQDALSGALSHLGIFSPLL FT MASRTDKGVHASYAVASVECGDYFTNLEYLQKQLNKFSHPFIHIKKIEKVKDDFEVRFD FT VKSREYRYIFSHASYSPFMASYVHFYPKFDLGKANELLGFFVGKKDLKFFCKSGGDNKT FT TLREIFIARAYAYKDFSIFHFKANGFLRGQIRLSVASVLKVLEGKMSEKELKEQIEAKK FT QYNHFLAPPNGLYLSRICY" FT misc_feature 774442..774738 FT /note="HMMPfam hit to PF01416, tRNA pseudouridine synthase, FT score 1.1e-21" FT /inference="protein motif:Pfam:PF01416" FT misc_feature 774847..775149 FT /note="HMMPfam hit to PF01416, tRNA pseudouridine synthase, FT score 2.4e-12" FT /inference="protein motif:Pfam:PF01416" FT CDS complement(775149..776360) FT /transl_table=11 FT /gene="ilvA" FT /locus_tag="Cj0828c" FT /product="threonine dehydratase biosynthetic" FT /EC_number="4.3.1.19" FT /note="Original (2000) note: Cj0828c, ilvA, probable FT threonine dehydratase biosynthetic, len: 403 aa; similar to FT e.g. THD1_BACSU threonine dehydratase biosynthetic (EC FT 4.2.1.16) (422 aa), fasta scores; opt: 808 z-score: 906.6 FT E(): 0, 35.6% identity in 407 aa overlap. No Hp match. FT Contains PS00165 Serine/threonine dehydratases FT pyridoxal-phosphate attachment site, and Pfam match to FT entry PF00291 S_T_dehydratase, Pyridoxal-phosphate FT dependant enzymes" FT /note="Updated (2006) note: Characterised in Caulobacter FT crescentus and Bacillus subtilis with acceptable identity FT scores. Putative not added to product function. Functional FT classification - Amino acid biosynthesis - Branched chain FT family" FT /note="PMID:1991719, PMID:14688104" FT /db_xref="GOA:Q0PA62" FT /db_xref="InterPro:IPR000634" FT /db_xref="InterPro:IPR001926" FT /db_xref="InterPro:IPR005789" FT /db_xref="UniProtKB/TrEMBL:Q0PA62" FT /inference="protein motif:Pfam:PF00291" FT /inference="protein motif:Prosite:PS00165" FT /protein_id="CAL34956.1" FT /translation="MLELNKIYKAKQQISGFVNKTPFIYSSFLSDICQSEIYLKNENLQ FT ITGAYKIRGAYNKIANLSTEQKQHGVIAASAGNHAQGVAISAKKFSIKAVIVMPESTPL FT LKVSATKALGAEVILRGDNFDEAYAFATSYAKENNLSFIHPFEDEFVMAGQGTLMLEML FT DEISDLDMIIAPVGGGGLISGISSTAKQINPNIKIIGVGAKGAPAMYESFHAKKIKNAK FT SVRTIADGIAVRDANPINFNIILECVDDFIQVDDEEIANAVLFLLEKHKIIVEGAGAAS FT VAALLHQKINTQNHKKIGVVLSGGNIDAQMLNIIIEKGLFKSYRKMQIYVTLVDKPGAL FT LHLTDSLKIANANIVKIDYDRFSTKLDYGDAMISITLETKGKEHQEEIRKILTQKAFNF FT YESF" FT misc_feature complement(775446..776321) FT /note="HMMPfam hit to PF00291, Pyridoxal-phosphate FT dependent enzyme, score 1e-81" FT /inference="protein motif:Pfam:PF00291" FT misc_feature complement(776196..776237) FT /note="PS00165 Serine/threonine dehydratases FT pyridoxal-phosphate attachment site" FT /inference="protein motif:Prosite:PS00165" FT CDS complement(776360..776773) FT /transl_table=11 FT /locus_tag="Cj0829c" FT /product="putative CoA binding domain containing protein" FT /note="Original (2000) note: Cj0829c, unknown, len: 137 aa; FT similar to hypothetical proteins e.g. TR:P75874 FT (EMBL:AE000198) E. coli b0965 (164 aa), fasta scores; opt: FT 240 z-score: 312.1 E(): 4.4e-10, 30.3% identity in 132 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF02629 CoA binding FT domain identified within CDS. Product modified to new FT family member based on motif match. No specific FT characterisation has been carried out yet. Putative kept FT within product function. Functional classification - Misc" FT /db_xref="GOA:Q0PA61" FT /db_xref="InterPro:IPR003781" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:Q0PA61" FT /inference="protein motif:Pfam:PF02629" FT /protein_id="CAL34957.1" FT /translation="MNEKETISYIINTSKNIVIFALSPDKTKASYRVAEFLQRKNYKIF FT PIYPKEEFILNEKVYRNLDQIEEKIDTLILFRKGEVALEILPKLVEKNIKNLWLQLDIS FT NETAKEECKKLDINFIQNRCIMLEYPHFKTKEK" FT misc_feature complement(776429..776743) FT /note="HMMPfam hit to PF02629, CoA binding domain, score FT 0.00014" FT /inference="protein motif:Pfam:PF02629" FT CDS 776892..777308 FT /transl_table=11 FT /locus_tag="Cj0830" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0830, probable integral FT membrane protein, len: 138 aa; 42.7% identity to HP1502" FT /note="Updated (2006) note: Pfam domain PF04323 Protein of FT unknown function (DUF474) identified within CDS. Also,four FT probable transmembrane helices predicted by TMHMM2.0. FT Literature search identified paper giving potential clues FT to product function. Functional classification -Membranes, FT lipoproteins and porins" FT /note="PMID:16045618" FT /db_xref="InterPro:IPR007418" FT /db_xref="UniProtKB/TrEMBL:Q0PA60" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF04323" FT /protein_id="CAL34958.1" FT /translation="MEEFYPYTLTIHLLCAILFIGYLFVDVFVLGVVKKKNPNFDKSLF FT SATGVKIMPFVVLLLFLSGGALAGFHFKPLNLLFAVKIILAFGILSLVVFSLFCHFILK FT KKNPLGVFIHPFVFVLCIAIVILAKLMNYFFIPC" FT misc_feature order(776919..776987,777024..777092,777120..777188, FT 777225..777293) FT /note="4 probable transmembrane helices predicted for FT Cj0830 by TMHMM2.0 at aa 10-32, 45-67, 77-99 and 112-134" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 777006..777290 FT /note="HMMPfam hit to PF04323, Protein of unknown function FT (DUF474), score 2.5e-45" FT /inference="protein motif:Pfam:PF04323" FT CDS complement(777295..778368) FT /transl_table=11 FT /gene="trmA" FT /locus_tag="Cj0831c" FT /product="tRNA (uracil-5-)-methyltransferase" FT /EC_number="2.1.1.35" FT /note="Original (2000) note: Cj0831c, trmA, probable tRNA FT (uracil-5-)-methyltransferase, len: 357 aa; similar to e.g. FT TRMA_ECOLI tRNA (uracil-5-)-methyltransferase (EC 2.1.1.35) FT (366 aa), fasta scores; opt: 791 z-score: 952.0 E(): 0, FT 37.0% identity in 351 aa overlap. No Hp match. Contains FT PS01230 RNA methyltransferase trmA family signature 1" FT /note="Updated (2006) note: Pfam domain PF05958 tRNA FT (Uracil-5-)-methyltransferase identified within CDS. FT Further support given to product function. Characterised in FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification - FT Aminoacyl tRNA synthetases and their modification" FT /note="PMID:2999071" FT /db_xref="GOA:Q9PP92" FT /db_xref="InterPro:IPR010280" FT /db_xref="InterPro:IPR011869" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP92" FT /inference="protein motif:Pfam:PF05958" FT /inference="protein motif:Prosite:PS01230" FT /protein_id="CAL34959.1" FT /translation="MSLENFGNFLTLDEKHSFIKKYFKEFYTKDFKLFASKDKHYRTRA FT ELSFYHENDTLFYAMFDPKSKKKYIIEYLDFADEKICAFMPRLLEYLRQDNKLKEKLFG FT VEFLTTKQELSITLLYHKNIEDIKSNLENLSNILHINLIARSKGKKLIFKTENLRQTLN FT IQDRKIFYEFNNDCFIQPNTAINEKMITWVCEILNTQKRMDLLELYCGYGNFTLALAPF FT FFKILATEISKSNINFALKNCELNNTTNIHFARLSSEELSLAIKKEREFFRLKDIRLDD FT FNFSHVLVDPPRAGLDKSVIDLIKKYGNIIYISCNPMTLKENLKELSLTHRVEEFALFD FT QFVNTPHLECGVFLSKV" FT misc_feature complement(777298..778350) FT /note="HMMPfam hit to PF05958, tRNA FT (Uracil-5-)-methyltransferase, score 2.6e-240" FT /inference="protein motif:Pfam:PF05958" FT misc_feature complement(777412..777501) FT /note="PS01230 RNA methyltransferase trmA family signature FT 1" FT /inference="protein motif:Prosite:PS01230" FT CDS complement(778365..780098) FT /transl_table=11 FT /locus_tag="Cj0832c" FT /product="putative Na+/H+ antiporter family protein" FT /note="Original (2000) note: Cj0832c, probable integral FT membrane protein, len: 577 aa; similar to hypothetical FT proteins e.g. TR:O59530 (EMBL:AP000007) Pyrococcus FT horikoshii PH1889 (533 aa), fasta scores; opt: 628 z-score: FT 744.4 E(): 0, 39.2% identity in 558 aa overlap. 26.9% FT identity to HP0946" FT /note="Updated (2006) note: Pfam domain PF03553 Na+/H+ FT antiporter family identified within CDS. Also, thirteen FT probable transmembrane helices predicted by TMHMM2. Product FT modified to more specific family member based on motif FT match. No specific characterisation carried out yet,so FT putative kept within product function. Functional FT classification - Transport/binding proteins - Cations" FT /db_xref="GOA:Q0PA58" FT /db_xref="InterPro:IPR018461" FT /db_xref="UniProtKB/TrEMBL:Q0PA58" FT /inference="protein motif:Pfam:PF03553" FT /protein_id="CAL34960.1" FT /translation="MNKFLVSLFLPLVAFANSSEAAANANLFGAFTLIPPLVAIALAFI FT TKDVILSLFTGVLSGTFLLSLSTNIFKAQHLTFVNYYNTTVESFSKIISYILGSTSDPV FT NAGIILQILCIGGLVALITKMGGAKAVALKFAKRAKSAVSAQVNTWFLGLLIFFDDYAN FT LLIVGPIMRPLADKFKISREKFAFIIDSTAAPVAGIAVISTWIGLEVSLIKTAYEHIGI FT SNISAFGIFVETIPYRFYNIFMLFFVVMTAIMGREFGSMYKAEVRARTTGQIAPLPKSG FT TLDTTELEDQFLAPKEGIKIRAFDAIVPIFTLIILAILGFYFNGLSTLEGEELAKASTN FT PLSFETFRAAFGNADSSVVLFQAALFAAIVAIFIGVRRKIFNLKEAVETWIYGWKTMIF FT TIVLLLFAWSLSSIVKDLGTSLFITSLLADKLPEFILPATIFAFASAISFAIGTSYGTM FT GILMPLAVPLAHEIAKINGMDANAMHHYMVINISCVLTGAIFGNHCSPISDNVILSSMS FT AKCDHMEHVRTQIPYALFICGISLIAGYIPVSLGLSVWFVLPLNFILIALLLRLIGKKV FT P" FT misc_feature complement(join(779967..780035,779886..779954, FT 779715..779783,779586..779654,779475..779543, FT 779388..779441,779322..779375,779115..779183, FT 778968..779027,778863..778931,778731..778799, FT 778458..778511,778380..778448)) FT /note="13 probable transmembrane helices predicted for FT Cj0832c by TMHMM2.0 at aa 22-44, 49-71, 106-128, FT 149-171,186-208, 220-237, 242-259, 306-328, 358-377, FT 390-412,434-456, 530-547 and 551-573" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(778449..779513) FT /note="HMMPfam hit to PF03553, Na+/H+ antiporter FT family,score 5.2e-102" FT /inference="protein motif:Pfam:PF03553" FT sig_peptide complement(780036..780098) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000390_778365_780098 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.516 between residues 21 and 22" FT CDS complement(780095..780844) FT /transl_table=11 FT /locus_tag="Cj0833c" FT /product="putative oxidoreductase" FT /note="Original (2000) note: Cj0833c, probable FT oxidoreductase, len: 249 aa; simlar to e.g. YDFG_ECOLI FT probable oxidoreductase (248 aa), fasta scores; opt: 796 FT z-score: 943.5 E(): 0, 48.8% identity in 244 aa overlap. FT 47.3% identity to HP0357. Contains PS00061 Short-chain FT dehydrogenases/reductases family signature, and Pfam match FT to entry PF00106 adh_short, Alcohol/other FT dehydrogenases,short chain type" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT kept within product function. Functional classification FT -Misc" FT /note="PMID:12535615" FT /db_xref="GOA:Q0PA57" FT /db_xref="InterPro:IPR002198" FT /db_xref="InterPro:IPR002347" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR020904" FT /db_xref="UniProtKB/TrEMBL:Q0PA57" FT /inference="protein motif:Pfam:PF00106" FT /inference="protein motif:Prosite:PS00061" FT /protein_id="CAL34961.1" FT /translation="MKTAFITGASSGFGRACVEAFIQEGYKAIALARRKERLEELKNAY FT KDKIYTLCIDVRNQKEIFEAIENLPKEFQEIDVLFNNAGLALGVDEFDKLNLEDINTMV FT DTNIKGFLYVAKAIIPILRKQKNAYIFNLGSVAGRNPYFGGNVYCGTKAFVGQFSLALR FT NDLRGSNIKVTNIAPGLCKTEFSEVRFKGDIQKADAVYENTQFISANDIAKVVMSIINL FT PSHINVNEIELMPVTQTWNGFYIERDE" FT misc_feature complement(780113..780835) FT /note="HMMPfam hit to PF00106, short chain FT dehydrogenase,score 7.9e-49" FT /inference="protein motif:Pfam:PF00106" FT misc_feature complement(780356..780442) FT /note="PS00061 Short-chain dehydrogenases/reductases family FT signature" FT /inference="protein motif:Prosite:PS00061" FT CDS complement(780841..782079) FT /transl_table=11 FT /locus_tag="Cj0834c" FT /product="ankyrin repeat-containing putative periplasmic FT protein" FT /note="Original (2000) note: Cj0834c, possible periplasmic FT protein, len: 412 aa; similar in C-terminus to ankyrin FT repeat-containing proteins e.g. ANKH_CHRVI ankyrin homolog FT precursor (323 aa), fasta scores; opt: 194 z-score: 229.9 FT E(): 1.7e-05, 28.9% identity in 194 aa overlap. No Hp FT match. Some similarity to ankyrin repeats in Cj1386 (29.3% FT identity in 99 aa overlap). Contains 2x Pfam match to entry FT PF00023 ank, Ank repeat, and possible N-terminal signal FT sequence" FT /note="Updated (2006) note: No specific characterisation FT with acceptable identity scores carried out yet. Putative FT kept within product function. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="GOA:Q0PA56" FT /db_xref="InterPro:IPR002110" FT /db_xref="InterPro:IPR006034" FT /db_xref="InterPro:IPR020683" FT /db_xref="UniProtKB/TrEMBL:Q0PA56" FT /inference="protein motif:Pfam:PF00023" FT /protein_id="CAL34962.1" FT /translation="MKLLFTSFCCFASLMASDAINCDNIKNNKTLLNESSNLDYLNIAS FT SCKESLKNQDFTKKLYAISNEIRGSNSSCNGVAYLPKLQQFDFLLLKIAIDPIAYQKTL FT DTPENLEKKYDILKSYFRYWAYQSIGNFRLYKAFWQEYNNAIEPLEKYFESNFNFDKGS FT NIYYTSNALNEFLNWAVGETKIYKDISPLAKIMSNKNYSVSYIQDFIFSNNPSQDDLTI FT ALQAALLNQREKEILELLIRFGARIDEGYESAIFYALESYENTNFLIQNGANVNQANAF FT GKTPLFYAIEFNRLDIIKLLLDNGANVNQKYINNNEKLALSANIGSNTPYFITFCALEH FT TSKNVLMHAAAYGNVEILKLLISKGANFNAVDDLGFNALDFALSAGKKENADYLKSLGL FT KANENLFYGGSLE" FT misc_feature complement(780961..781059) FT /note="HMMPfam hit to PF00023, Ankyrin repeat, score FT 1.8e-06" FT /inference="protein motif:Pfam:PF00023" FT misc_feature complement(781141..781239) FT /note="HMMPfam hit to PF00023, Ankyrin repeat, score FT 1.9e-07" FT /inference="protein motif:Pfam:PF00023" FT misc_feature complement(781240..781428) FT /note="HMMPfam hit to PF00023, Ankyrin repeat, score 7.2" FT /inference="protein motif:Pfam:PF00023" FT sig_peptide complement(782023..782079) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000392_780841_782079 by SignalP 2.0 FT HMM (Signal peptide probability 0.749) with cleavage site FT probability 0.732 between residues 19 and 20" FT CDS complement(782129..784675) FT /transl_table=11 FT /gene="acnB" FT /locus_tag="Cj0835c" FT /product="aconitate hydratase" FT /EC_number="4.2.1.3" FT /note="Original (2000) note: Cj0835c, acnB, probable FT aconitate hydratase, len: 848 aa; highly similar to e.g. FT ACO2_ECOLI aconitate hydratase 2 (EC 4.2.1.3) (865 FT aa),fasta scores; opt: 2785 z-score: 3084.1 E(): 0, 60.5% FT identity in 858 aa overlap. 65.8% identity to HP0779. FT Contains PS00450 and PS01244 Aconitase family signatures 1 FT and 2, and Pfam match to entry PF00330 aconitase" FT /note="Updated (2006) note: Pfam domain PF06434 Aconitate FT hydratase identified within CDS. Further support given to FT product function. Characterised within Escherichia coli FT with acceptable identity score. Putative not added to FT product function. Paper identified linking protein to FT glycoprotein. Functional classification - Energy metabolism FT - Tricarboxylic acid cycle" FT /note="PMID:12186869, PMID:10585860" FT /db_xref="GOA:Q0PA55" FT /db_xref="InterPro:IPR001030" FT /db_xref="InterPro:IPR004406" FT /db_xref="InterPro:IPR015928" FT /db_xref="InterPro:IPR015929" FT /db_xref="InterPro:IPR015930" FT /db_xref="InterPro:IPR015931" FT /db_xref="InterPro:IPR015933" FT /db_xref="InterPro:IPR015937" FT /db_xref="InterPro:IPR018136" FT /db_xref="UniProtKB/TrEMBL:Q0PA55" FT /inference="protein motif:Pfam:PF06434" FT /inference="protein motif:Pfam:PF00330" FT /inference="protein motif:Prosite:PS01244" FT /inference="protein motif:Prosite:PS00450" FT /protein_id="CAL34963.1" FT /translation="MSFMQEYNKLVEERAALGIPPLPLNANQTRELCKLLENENNEELA FT NLLENRVNPGVDDAALVKCEFLDSILKGKISAPNIDKKRALRMLGTMLGGYNVKVLIDA FT LKDENIAKDAAEVLKNIIFVHDNFHTIAELSKNNPHAKEVLQSWANADWFNKKEKLPQV FT IKCIVFKVAGETNTDDLSPAGDAFTRSDIPLHANAMLKVRQTGSLEKIKELKKSGREVV FT YVGDVVGTGSSRKSAINSIQWHLGKEIEGVPNKHSGGIIMGSTIAPIFFNTAQDSGALP FT IICDVTNLEMGDEFEIHPYEGKIIKNGSTIAEFTLSPNTLLDEVRAGGRIPLIIGRGLC FT TKAREFLGMESENIFTKPEQPKSSSGGYTLAQKMLGRACGVEGVRPGMYIEPITLTVGS FT QDTTGPMTRDEIKELASLGFNADFVMQSFCHTAAYPKVSDSNLHKTLPNFMTSRGGVSL FT KPGDGVIHSWLNRFVLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAVTGSMPLNVPES FT VLVRFSGELQAGVTLRDLVNAIPYYAIKQGQLTVEKKNKKNIFAGKILEIEGLPNLKVE FT QAFELSDASAERSAAACSVDLSIESVSEYIKSNISLIEAMIEVGYENKATLARRAEKMR FT EWLKNPTLLRADKDAKYAYIIDINLNNIKEPILACPNDPDDVATLSEILADDKRPKNID FT EVFVGSCMTNIGHYRALGEILKDKGILKTRLWVVPPTKMDKAQLINEGYYSIFGAAGAR FT IEVPGCSLCMGNQARVNDGAVVFSTSTRNFDNRMGMGAKVYLGSAELAAVCAILGKIPS FT KEEYLQIVSEKLSNEHKANIYRYLNFNEIENFKLEN" FT misc_feature complement(782252..783571) FT /note="HMMPfam hit to PF00330, Aconitase family (aconitate FT hydratase), score 2.3e-09" FT /inference="protein motif:Pfam:PF00330" FT misc_feature complement(782384..782425) FT /note="PS01244 Aconitase family signature 2" FT /inference="protein motif:Prosite:PS01244" FT misc_feature complement(782546..782599) FT /note="PS00450 Aconitase family signature 1" FT /inference="protein motif:Prosite:PS00450" FT misc_feature complement(783572..784666) FT /note="HMMPfam hit to PF06434, Aconitate hydratase, score FT 3.2e-259" FT /inference="protein motif:Pfam:PF06434" FT CDS 784730..785182 FT /transl_table=11 FT /gene="ogt" FT /locus_tag="Cj0836" FT /product="methylated-DNA--protein-cysteine FT methyltransferase" FT /EC_number="2.1.1.63" FT /note="Original (2000) note: Cj0836, ogt, probable FT methylated-DNA--protein-cysteine methyltransferase, len: FT 150 aa; similar to many e.g. OGT_ECOLI FT methylated-DNA--protein-cysteine methyltransferase (EC FT 2.1.1.63) (171 aa), fasta scores; opt: 274 z-score: 355.6 FT E(): 1.6e-12, 43.7% identity in 103 aa overlap, and FT DAT1_BACSU methylated-DNA--protein-cysteine FT methyltransferase (165 aa), fasta scores; opt: 358 z-score: FT 460.7 E(): 2.3e-18, 44.5% identity in 137 aa overlap. 45.3% FT identity to HP0676. Contains PS00374 FT Methylated-DNA--protein-cysteine methyltransferase active FT site and Pfam match to entry PF01035 FT Methyltrans,6-O-methylguanine DNA methyltransferase" FT /note="Updated (2006) note: Characterised in Escherichia FT coli and Bacillus subtilis with acceptable identity score. FT Putative not added to product function. Functional FT classification - DNA replication,restriction/modification, FT recombination and repair" FT /note="PMID:2506524" FT /db_xref="GOA:Q0PA54" FT /db_xref="InterPro:IPR001497" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR014048" FT /db_xref="UniProtKB/TrEMBL:Q0PA54" FT /inference="protein motif:Pfam:PF01035" FT /inference="protein motif:Prosite:PS00374" FT /protein_id="CAL34964.1" FT /translation="MFKVYYKMPLCYLSLHSDGKFLTRVDFCDNKRSEKNCSLLDLAKY FT ELDLYFTHKLRKFSIPVLIQGTDFESKVYKALMEIPYGKIATYKDIAEKINHPKAFRAV FT GNANSKNQIPIFIPCHRVIASNGIGGYNGGLEIKRFLLENEGVNLK" FT misc_feature 784925..785179 FT /note="HMMPfam hit to PF01035, 6-O-methylguanine DNA FT methyltransferas, score 1.1e-41" FT /inference="protein motif:Pfam:PF01035" FT misc_feature 785078..785098 FT /note="PS00374 Methylated-DNA--protein-cysteine FT methyltransferase active site" FT /inference="protein motif:Prosite:PS00374" FT CDS complement(785174..786115) FT /transl_table=11 FT /locus_tag="Cj0837c" FT /product="conserved hypothetical protein Cj0837c" FT /note="Original (2000) note: Cj0837c, unknown, len: 313 aa; FT no Hp match. Contains PS00179 Aminoacyl-transfer RNA FT synthetases class-II signature 1, and PS00030 Eukaryotic FT putative RNA-binding region RNP-1 signature. Functional FT classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PA53" FT /inference="protein motif:Prosite:PS00030" FT /inference="protein motif:Prosite:PS00179" FT /protein_id="CAL34965.1" FT /translation="MQISNLGELLNATLIHEGSVLSVEGFAINLNELKTGFAFFNNDKK FT EIAQAVKKGAYAIITENDITIEDKEIFYFRVENLERALVRFLRFFCEDKECEFLLFKSY FT ELSLCKAFYFNILKGNIFADFEKLIKAKKGEIFCYCEENYLNKLCTYSHSLKDANFTLL FT SRSSFFFTTLICENLYFKNLNLPFFYANSFAKIISFLKEKSQKIIFDFNKIDDFKIYFI FT DDKFEITPFGSSSQAFIVSNNQNTFEFWKEKFKNIKDFKIASKNSLFCDFSYNQLSDLR FT KLKNFKYCLILENYDIFEQEFENKENQTPSLF" FT misc_feature complement(785741..785764) FT /note="PS00030 Eukaryotic putative RNA-binding region RNP-1 FT signature" FT /inference="protein motif:Prosite:PS00030" FT misc_feature complement(785837..785896) FT /note="PS00179 Aminoacyl-transfer RNA synthetases class-II FT signature 1" FT /inference="protein motif:Prosite:PS00179" FT CDS complement(786119..788005) FT /transl_table=11 FT /gene="metS" FT /locus_tag="Cj0838c" FT /product="methionyl-tRNA synthetase" FT /EC_number="6.1.1.10" FT /note="Original (2000) note: Cj0838c, metS, probable FT methionyl-tRNA synthetase, len: 628 aa; similar to many FT e.g. SYM_BACST methionyl-tRNA synthetase (EC 6.1.1.10) (649 FT aa), fasta scores; opt: 1502 z-score: 1694.5 E(): 0,43.7% FT identity in 647 aa overlap. 49.7% identity to HP0417. FT Contains Pfam match to entry PF00133 tRNA-synt_1,tRNA FT synthetases class I" FT /note="Updated (2006) note: Pfam domain PF01588 Putative FT tRNA binding domain identified within CDS. Further support FT given to product function. Characterised in Bacillus FT stearothermophilus with acceptable identity score. Putative FT not added to product function. Functional classification - FT Aminoacyl tRNA synthetases and their modification" FT /note="PMID:1852609" FT /db_xref="GOA:Q9PP85" FT /db_xref="InterPro:IPR002547" FT /db_xref="InterPro:IPR004495" FT /db_xref="InterPro:IPR009080" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR014729" FT /db_xref="InterPro:IPR014758" FT /db_xref="InterPro:IPR015413" FT /db_xref="InterPro:IPR016027" FT /db_xref="InterPro:IPR023457" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP85" FT /inference="protein motif:Pfam:PF01588" FT /inference="protein motif:Pfam:PF00133" FT /protein_id="CAL34966.1" FT /translation="MRYITTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRFLTG FT TDEHGQKIEEAAKLRNSTPQEYADKISFEFKKLWDEFEITYDIYARTTDTRHIEFIKAM FT FLKMWQKGDIYKDEYEGHYCISCESFFTQSQLINDCSCPDCGKQTRILKEESYFFKLSK FT YQDKILQWYEEKDPILPKNKKNELINFVQNGLKDLSITRTSFDWGIKLPQEINDDKHII FT YVWLDALFIYVSSLDFQNKGENAKFWPAHVHLVGKDILRFHAIYWPAFLMSVDLPLPKF FT IGAHGWWTKEGEKMSKSKGNVVKPKEVVDAYGSEAFRYFLLREVPFGNDGDFSENMLIN FT RINAELSNEFGNLLNRIIGMSTKYSQGNISKEGVLKFYNAELNQAKEHLNLAVEFLENL FT QCNRYLEELFKALSVANLAISKYEPWSLIKENKHEQANALVALCANILAKTSLLLSPTL FT PKSSQKVALALNFEISSANYTKMILDNELLDFKANPCEALFPKVEKALLKQEIKEEPKK FT EESPKIKIDDFAKIEIKVAKVLDCQNIEGSEKLLKFQLELDDKEIRQVLSGIAKYYKAS FT DLIGKQVCVISNLKKAKIFGHESDGMILSAKSGDKLVLIAPEQLVQNGSLVG" FT misc_feature complement(786128..786409) FT /note="HMMPfam hit to PF01588, Putative tRNA binding FT domain, score 3.8e-30" FT /inference="protein motif:Pfam:PF01588" FT misc_feature complement(787004..788002) FT /note="HMMPfam hit to PF00133, tRNA synthetases class I (I, FT L, M and V), score 8.9e-08" FT /inference="protein motif:Pfam:PF00133" FT CDS complement(788015..788212) FT /transl_table=11 FT /locus_tag="Cj0839c" FT /product="hypothetical protein Cj0839c" FT /note="Original (2000) note: Cj0839c, unknown, len: 65 aa; FT 43.1% identity to HP1384. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PA51" FT /protein_id="CAL34967.1" FT /translation="MNEVRDEFEQDMDKKKEILLSCQNSKNLNSCYNCDEIFNCQTRKN FT YVDAVYNSMSKGKTEGGFDF" FT CDS complement(788205..789047) FT /transl_table=11 FT /gene="fbp" FT /locus_tag="Cj0840c" FT /product="fructose-1,6-bisphosphatase" FT /EC_number="3.1.3.11" FT /note="Original (2000) note: Cj0840c, fbp, probable FT fructose-1,6-bisphosphatase, len: 280 aa; similar to many FT e.g. F16Q_SACHY fructose-1,6-bisphosphatase, cytosolic (EC FT 3.1.3.11) (331 aa), fasta scores; opt: 376 z-score: 455.9 FT E(): 4.3e-18, 37.5% identity in 272 aa overlap. 39.9% FT identity to HP1385. Contains 2x Pfam match to entry PF00316 FT FBPase, Fructose-1-6-bisphosphatase" FT /note="Updated (2006) note: Characterisation work carried FT out in Escherichia coli and Bacillus subtilis with marginal FT identity scores. Appropriate motifs present. Putative FT removed form product function. Functional classification - FT Central intermediary metabolism -Gluconeogenesis" FT /note="PMID:12053203, PMID:10913263, PMID:9696785" FT /db_xref="GOA:Q0PA50" FT /db_xref="InterPro:IPR000146" FT /db_xref="InterPro:IPR023079" FT /db_xref="UniProtKB/Swiss-Prot:Q0PA50" FT /inference="protein motif:Pfam:PF00316" FT /protein_id="CAL34968.1" FT /translation="MQEVISYIQKAVLEISNALKFPDTSYSQNQNFTGDTQLKFDVLSD FT EIITKTLSQCSSIKAIISEEKDEILTLNERANFIVAYDPLDGSSLMDVNFAIGSIFAIY FT EEKASAKNLRAALYSMYGARLELVICKDQPKLYRLNANNEFIFIKDLRMNEKGKINATG FT GTQKFWEEKHAKFIKSLFDEGYRLRYSGAMVSDINQILLKGGGIFSYPATQDAPNGKLR FT AFFEVFPLAFIIEKAGGKTTNGKNRSLLELEFDKIHATTPCFFGSEYEISKLLKAYNE" FT misc_feature complement(788208..789047) FT /note="HMMPfam hit to PF00316,Fructose-1-6-bisphosphatase, FT score 1.1e-52" FT /inference="protein motif:Pfam:PF00316" FT CDS complement(789049..789540) FT /transl_table=11 FT /gene="mobB" FT /locus_tag="Cj0841c" FT /product="putative molybdopterin-guanine dinucleotide FT biosynthesis protein" FT /note="Original (2000) note: Cj0841c, probable ATP/GTP FT binding protein, len: 163 aa; some similarity to e.g. FT MOBB_ECOLI molybdopterin-guanine dinucleotide biosynthesis FT protein B (174 aa), fasta scores; opt: 148 z-score: 194.1 FT E(): 0.0016, 25.6% identity in 168 aa overlap. No Hp match. FT Contains S00017 ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF03205 FT Molybdopterin guanine dinucleotide synthesis protein B FT identified within CDS. Further support for product FT function. Characterisation papers form Escherichia coli FT have been attached. This information and identification of FT appropriate motifs has led to product function being FT modified to a more specific family member. Putative kept FT within product function. Functional classification FT -Biosynthesis of cofactors, prosthetic groups and carriers FT - Molybdopterin" FT /note="PMID:12372836, PMID:9219527" FT /db_xref="GOA:Q0PA49" FT /db_xref="InterPro:IPR004435" FT /db_xref="UniProtKB/TrEMBL:Q0PA49" FT /inference="protein motif:Pfam:PF03205" FT /protein_id="CAL34969.1" FT /translation="MKQLIIAFSGPSNSGKTTLITKIADNFLQQNLKVLIIKHDPADKA FT QFDFNGKDSFKFFQSGAEVMVLSPTRTTFFSHENRDILKALKLSPDFDICLVEGLKTLD FT LPRISVFCKEIDESYFIFSNAIASYEKISHPYLTWLDLNDIQAICQYILKNAKNLQGEL FT " FT misc_feature complement(789148..789531) FT /note="HMMPfam hit to PF03205, Molybdopterin guanine FT dinucleotide synthesis, score 1.2e-21" FT /inference="protein motif:Pfam:PF03205" FT misc_feature complement(789490..789513) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS 789636..790121 FT /transl_table=11 FT /locus_tag="Cj0842" FT /product="putative lipoprotein" FT /note="Original (2000) note: Cj0842, probable FT lipoprotein,len: 161 aa; no Hp match. Contains probable FT N-terminal signal sequence and appropriately positioned FT PS00013 Prokaryotic membrane lipoprotein lipid attachment FT site. Functional classification - Membranes, lipoproteins FT and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PA48" FT /inference="protein motif:Prosite:PS00013" FT /protein_id="CAL34970.1" FT /translation="MKIYSVILGAFLLGACSLKDQAIVDTNLKSQTLMFTQKYKITQDK FT INAIITMSYLNPILDKTSKDDVLALSFTPNTLKIQNLEVFINNKKANIEKLDDEYLKYI FT IQNNYTDYFKASLPSVKEETRLVAKICLDHLPCFELNFQKYPKSLYYRSEDVDTQYN" FT sig_peptide 789636..789707 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000395_789636_790121 by SignalP 2.0 FT HMM (Signal peptide probability 0.939) with cleavage site FT probability 0.479 between residues 24 and 25" FT misc_feature 789651..789683 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(790018..791643) FT /transl_table=11 FT /locus_tag="Cj0843c" FT /product="putative secreted transglycosylase" FT /note="Original (2000) note: Cj0843c, probable secreted FT transglycosylase, len: 541 aa; some simialarity in FT C-terminus to SLT_ECOLI soluble lytic murein FT transglycosylase precursor (645 aa), fasta scores; opt: 257 FT z-score: 285.7 E(): 1.3e-08, 29.3% identity in 208 aa FT overlap. 31.4% identity to HP0645. Contains PS00922 FT Prokaryotic transglycosylases signature and N-terminal FT signal sequence" FT /note="Updated (2006) note: Pfam domain PF01464 FT Transglycosylase SLT domain identified within CDS. Further FT support given to product function. Putative kept within FT product function as identity scores were marginal and FT alignment was only partial. Paper identified linking FT product function to glycosylation. Functional FT classification - Degradation of macromolecules - FT Proteins,peptides and glycopeptides" FT /note="PMID:12186869" FT /db_xref="GOA:Q0PA47" FT /db_xref="InterPro:IPR000189" FT /db_xref="InterPro:IPR008258" FT /db_xref="InterPro:IPR023346" FT /db_xref="UniProtKB/TrEMBL:Q0PA47" FT /inference="protein motif:Pfam:PF01464" FT /inference="protein motif:Prosite:PS00922" FT /protein_id="CAL34971.1" FT /translation="MIKKILVFLFIFSSLNATQYSIEKLKKEENSLAKDYYIYRLLEKN FT KISKKDAQDLNSHIFRYIGKIKSELEKIIPLKPYINPKYAKCYTYTANTILDANLTCQS FT VRLNSLVFIASLNSKDRTTLAQTFKNQRPDLTNLLLAFNTSDPMSYIVQKEDINGFFKL FT YNYSKKYDLDLNTGLVNKLPNHIGFKDFAQNIIIKKENPKFRYSMLEINPENVSEDSAF FT YLGVNALTYDKTELAYDFFKKAAQSFKSQSNKDNAIFWMWLIKNNEEDLKTLSQSSSLN FT IYSLYAKELTNTPFPKIESLNPSKKKNNFNMQDPFAWQKINKQIRDANASQLDVLAKEF FT DTQETLPIYAYILERKNNFKKHYFIMPYYDNIKDYNKTRQALILAIARQESRFIPTAIS FT VSYALGMMQFMPFLANHIGEKELKIPNFDQDFMFKPEIAYYFGNYHLNYLESRLKSPLF FT VAYAYNGGIGFTNRMLARNDMFKTGKFEPFLSMELVPYQESRIYGKKVLANYIVYRHLL FT NDSIKISDIFENLIQNKANDLNKS" FT misc_feature complement(790186..790545) FT /note="HMMPfam hit to PF01464, Transglycosylase SLT domain, FT score 1.1e-20" FT /inference="protein motif:Pfam:PF01464" FT misc_feature complement(790402..790488) FT /note="PS00922 Prokaryotic transglycosylases signature" FT /inference="protein motif:Prosite:PS00922" FT CDS complement(791640..791921) FT /transl_table=11 FT /locus_tag="Cj0844c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0844c, possible integral FT membrane protein, len: 93 aa; 38.4% identity to HP0644" FT /note="Updated (2006) note: Pfam domain PF02325 YGGT family FT identified within CDS. This family consists of a repeat FT found in conserved hypothetical integral membrane proteins. FT The function of this region and the proteins which possess FT it is unknown. Also, two probable transmembrane helices FT predicted by TMHMM2.0. Functional classification - FT Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PA46" FT /db_xref="InterPro:IPR003425" FT /db_xref="UniProtKB/TrEMBL:Q0PA46" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF02325" FT /protein_id="CAL34972.1" FT /translation="MVIDSFIISIFQVLQIVINIYTWIIIITALLSWVNPDPYNPIVQI FT LYKLSYPAYALVRKIPTRIGNIDLAPLIIVLALQFLGIFLGNILRSIL" FT misc_feature complement(join(791835..791903,791655..791723)) FT /note="2 probable transmembrane helices predicted for FT Cj0844c by TMHMM2.0 at aa 7-29 and 67-89" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(791658..791903) FT /note="HMMPfam hit to PF02325, YGGT family, score 6.1e-20" FT /inference="protein motif:Pfam:PF02325" FT CDS complement(791924..793219) FT /transl_table=11 FT /gene="gltX" FT /locus_tag="Cj0845c" FT /product="glutamyl-tRNA synthetase" FT /EC_number="6.1.1.17" FT /note="Original (2000) note: Cj0845c, gltX, probable FT glutamyl-tRNA synthetase, len: 431 aa; similar to many e.g. FT SYE_ECOLI glutamyl-tRNA synthetase (EC 6.1.1.17) (471 aa), FT fasta scores; opt: 726 z-score: 808.6 E(): 0, 33.8% FT identity in 447 aa overlap. 51.0% identity to HP0643. Also FT similar to Cj1288c, gltX2, (37.0% identity in 449 aa FT overlap). Contains PS00178 Aminoacyl-transfer RNA FT synthetases class-I signature, and Pfam match to entry FT PF00749 tRNA-synt_1c, tRNA synthetases class I" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with marginal identity score. Appropriate FT motifs present. Putative not added to product function. FT Functional classification - Aminoacyl tRNA synthetases and FT their modification" FT /note="PMID:3015933" FT /db_xref="GOA:Q9PP78" FT /db_xref="InterPro:IPR000924" FT /db_xref="InterPro:IPR001412" FT /db_xref="InterPro:IPR004527" FT /db_xref="InterPro:IPR008925" FT /db_xref="InterPro:IPR014729" FT /db_xref="InterPro:IPR020058" FT /db_xref="InterPro:IPR020061" FT /db_xref="InterPro:IPR020751" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP78" FT /inference="protein motif:Pfam:PF00749" FT /inference="protein motif:Prosite:PS00178" FT /protein_id="CAL34973.1" FT /translation="MYRFAPSPTGDMHIGNLRAAIFNYICARQKNMDFILRIEDTDKAR FT NIAGKEEEIKEILNLFSISWQHYYIQSENLKFHRQMALKLVSEKKAFACFCTEEELEAK FT KELAKKQGKAYRYDGTCEKLADIDVLECEKPFVIRLKKPTHTMKFTDFIKGELSFEPEN FT IDSFVIMRTDKTPTYNFACAVDDMLENVTCIIRGEDHVSNTPKQEHIRASLGYNKAMTY FT AHLPIILNEEGVKMSKREAHSSVKWLLESGILPSAIANYLIMLGNKTPCEIFTLEEAIK FT WFDISKVSKAPARFDLKKLLQINREHIKMIKDDELNKILDLNKDLAQLAKFYTQETSTI FT KELKEKMQAIFNAKDFGEFETEYKILKELLKDIELFENYEDFKNELLNKSNLKGKKFFM FT PLRIILTGNIHGPELSDLYPYIKNFIHELARI" FT misc_feature complement(792314..793213) FT /note="HMMPfam hit to PF00749, tRNA synthetases class I (E FT and Q), cata, score 1.1e-85" FT /inference="protein motif:Pfam:PF00749" FT misc_feature complement(793169..793204) FT /note="PS00178 Aminoacyl-transfer RNA synthetases class-I FT signature" FT /inference="protein motif:Prosite:PS00178" FT CDS 793305..794429 FT /transl_table=11 FT /locus_tag="Cj0846" FT /product="putative metallophosphoesterase" FT /note="Original (2000) note: Cj0846, probable integral FT membrane protein, len: 374 aa; contains several probable FT membrane spanning regions in N-terminal half, C-terminal FT half is simalar to several hypothetical proteins e.g. FT YPBG_BACSU (259 aa), fasta scores; opt: 197 z-score: 233.7 FT E(): 1e-05, 28.6% identity in 238 aa overlap. 38.8% FT identity to HP1044" FT /note="Updated (2006) note: Pfam domain PF00149 FT Calcineurin-like phosphoesterase and Prosite domain PS00142 FT Peptidase M, neutral zinc metallopeptidases,zinc-binding FT site identified within CDS. Also, four probable FT transmembrane helices predicted by TMHMM2.0. Product FT function modified to more specific family member based on FT motif matches. No specific characterisation with acceptable FT identity score carried out yet. Putative kept within FT product function. Functional classification - Misc" FT /db_xref="GOA:Q9PP77" FT /db_xref="InterPro:IPR024654" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP77" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00149" FT /inference="protein motif:Prosite:PS00142" FT /protein_id="CAL34974.1" FT /translation="MIFLIFSFIVLLIFGLANVYIYKRLIKKITLFKYFYKIFSFIFIV FT LFLAQAVFLIFRRDEYLSDTWYEILAMFYAPTYCLFFMTLAWDFVKLILALMGKRDKTY FT NLILRLIFELSLIVLSVFLIYASINNALKTPEVKSVDVEIPNLKKDLKIVMLTDIHLGK FT NLHENFLDKLITKVNLQSPDMVVIVGDLIDTNPKDLKNYISKLNDFNSTYGTFYALGNH FT EYYHGINEVLDLLRKHTNMKILVNQNLDLGFIDIAGLGDLAGLDRGLYAPDLARIKVDL FT NTSKASILLTHQPKTALLYDLSDFDLVLSGHTHGGQIFPFMFLVKLQQGFVHGLYDLGE FT KTKLYVSSGAGFWGPSLRVFAPSEIVILNLKGKK" FT misc_feature order(793314..793370,793404..793472,793515..793583, FT 793620..793688) FT /note="4 probable transmembrane helices predicted for FT Cj0846 by TMHMM2.0 at aa 4-22, 34-56, 71-93 and 106-128" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 793755..794252 FT /note="HMMPfam hit to PF00149, Calcineurin-like FT phosphoesterase, score 1.2e-12" FT /inference="protein motif:Pfam:PF00149" FT misc_feature 793959..793988 FT /note="PS00142 Neutral zinc metallopeptidases,zinc-binding FT region signature" FT /inference="protein motif:Prosite:PS00142" FT CDS 794426..795226 FT /transl_table=11 FT /gene="psd" FT /locus_tag="Cj0847" FT /product="phosphatidylserine decarboxylase proenzyme" FT /EC_number="4.1.1.65" FT /note="Original (2000) note: Cj0847, psd, possible FT phosphatidylserine decarboxylase, len: 266 aa; similar to FT e.g. DPSD_ECOLI phosphatidylserine decarboxylase proenzyme FT (EC 4.1.1.65) (322 aa), fasta scores; opt: 380 z-score: FT 461.6 E(): 2.1e-18, 31.6% identity in 272 aa overlap. 48.0% FT identity to HP1357" FT /note="Updated (2006) note: Pfam domain PF02666 FT Phosphatidylserine decarboxylase identified within CDS. FT Further support given to product function. Characterised in FT Escherichia coli with marginal identity score. Appropriate FT motifs present. Putative removed from product function. FT Also, product function modified with proenzyme added. This FT is becuase there are alpha and beta chain versions. FT Functional classification - Synthesis and modification of FT macromolecules - Phospholipids" FT /note="PMID:3042771, PMID:9422599" FT /db_xref="GOA:Q9PP76" FT /db_xref="InterPro:IPR003817" FT /db_xref="InterPro:IPR005221" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP76" FT /inference="protein motif:Pfam:PF02666" FT /protein_id="CAL34975.1" FT /translation="MSFSKESSRLFGFVAGIKFPKMIQKVINENYVKYFNINMSEFKAP FT CEYESLNALFTRTLQIPRKFEEGFISPSDGKILECGSTFLANEEHFAFSIKGHAYSVEE FT LLKDSFEKDELKNGLDYVNIYLSPKDYHRYHSPCDMQILSATYTSGVLYSVNEKHLERI FT SNLYVKNERVSLKCQNEKGIFWLVFVGAQNVGKMRFNFDASIQTNAKISHNFTRKYENL FT NFKKGEELGNFELGSTIVLISQKGLLTFNLKVGQGIKFGEKIAD" FT misc_feature 794576..795223 FT /note="HMMPfam hit to PF02666, Phosphatidylserine FT decarboxylase, score 1.8e-45" FT /inference="protein motif:Pfam:PF02666" FT CDS complement(795223..795504) FT /transl_table=11 FT /locus_tag="Cj0848c" FT /product="conserved hypothetical protein Cj0848c" FT /note="Original (2000) note: Cj0848c, unknown, len: 93 aa; FT similar to hypothetical proteins e.g. TR:O34867 FT (EMBL:AJ000975) B. subtilis YLQH protein (93 aa), fasta FT scores; opt: 284 z-score: 365.6 E(): 4.5e-13, 47.3% FT identity in 91 aa overlap. Also similar to C-terminus of FT flhB possible flagellar transport proteins e.g. FLHB_ECOLI FT flagellar biosynthetic protein FLHB (382 aa), fasta scores; FT opt: 182 z-score: 232.8 E(): 1.1e-05, 41.6% identity in 77 FT aa overlap. 39.2% identity to HP1575 (annotated as flhB). FT Also similar to C-terminus of Cj0335,flhB (40.7% identity FT in 81 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF01312 FT Bac_export_2, FlhB HrpN YscU SpaS Family identified within FT CDS. All of these proteins export peptides using the type FT III secretion system. The peptides exported are quite FT diverse. Functional classification - Conserved hypothetical FT proteins" FT /db_xref="GOA:Q0PA42" FT /db_xref="InterPro:IPR004683" FT /db_xref="InterPro:IPR006135" FT /db_xref="UniProtKB/TrEMBL:Q0PA42" FT /inference="protein motif:Pfam:PF01312" FT /protein_id="CAL34976.1" FT /translation="MSKIKRSIKKAVALGYQKEKNSAPKVLASGKGESAAKIISLAKEH FT GVPIKEDEDLIEILSKLDLGDEIPPNMYKAVAEVFAFIYQMANKTPKN" FT CDS complement(795501..797660) FT /transl_table=11 FT /locus_tag="Cj0849c" FT /product="conserved hypothetical protein Cj0849c" FT /note="Original (2000) note: Cj0849c, unknown, len: 719 aa; FT no Hp ortholog, some similarity to Cj0041 (23.1% identity FT in 566 aa overlap). Contain Asn-rich region near centre" FT /note="Updated (2006) note: Prosite domain PS00063 FT Aldo/keto reductase family putative active site signature FT found within CDS. Functional classification - Conserved FT hypothetical proteins" FT /db_xref="InterPro:IPR021136" FT /db_xref="UniProtKB/TrEMBL:Q0PA41" FT /inference="protein motif:Prosite:PS00063" FT /protein_id="CAL34977.1" FT /translation="MINTQLASQIANTQKNDLKVDNSASKDKTNLKDNPKEALAQALKQ FT NLGLSKDASSEEILAKFVQNETGTKLKELVNKLLDQINAQKNPDSPVLKQGKNLNLAPN FT FANELKILSTELAKSDTFTQVLDRLNQILKPASEIKNNNLAPLFKNSGVFLEAKLKDAL FT NEELLPKSFHSLLSTIKGLSSEKLSVQIAQLANTNLSPKDTLKELKNIINSSKNENKQI FT LNQSSFKALLNLSSKLENFKNYISKNPSHAQEKITPIANKILKELNSIKNDFFKALNKP FT ENLMIKDPNILKQTATAFEKLENTLKNILGNQASKIQDKENILENLLSNKENMKEEKLN FT HNTKNQDEEKHIKASKEDENLDSGIKTHEEDTQDTKNDIQNNETENKPDNDIKNSTPNQ FT EKIKDEKQEKSKENIKENPKFYETKTENKTSINTNTNTSNPNTNNTQNLNNTQNIQSNN FT NQTMQNIFKNQEFIKQNIVKNLAFNVENLDLEQVQDLSKNLSNLSRRLNESLKELEPYT FT QNAKLNQAELKNLEHKLNLSIKDLAQIKPKTEQDIAESLHHDVKSTLLQISNLAKNEGN FT EAVYNQANRLLAQIEINQLMSLANDSINTYLPFSWDDLNDSKIMFRRGKKDKFFAQIKL FT EFAKLGDLEILISLNNEKYIDINIMAENIEFRKTIYENAHELKRNINKAGLLSANFFVG FT DIIRSKFDTRNMKNLDLEMGMDKKV" FT misc_feature complement(795528..795575) FT /note="PS00063 Aldo/keto reductase family putative active FT site signature" FT /inference="protein motif:Prosite:PS00063" FT CDS complement(797653..798840) FT /transl_table=11 FT /locus_tag="Cj0850c" FT /product="putative MFS (Major Facilitator Superfamily) FT transport protein" FT /note="Original (2000) note: Cj0850c, transmembrane FT transport protein, len: 395 aa; similar to hypothetical FT transport proteins e.g. YCAD_ECOLI (382 aa), fasta scores; FT opt: 431 z-score: 481.6 E(): 1.6e-19, 27.6% identity in 366 FT aa overlap. No Hp ortholog. Contains S00216 Sugar transport FT proteins signature 1, and Pfam match to entry PF00083 FT sugar_tr, Sugar (and other) transporters" FT /note="Updated (2006) note: Pfam domain PF07690 Major FT Facilitator Superfamily identified within CDS. Also,twelve FT probable transmembrane helices predicted by TMHMM2.0. The FT MFS family contains functions such as uniporters, FT symporters or antiporters. MFS proteins typically contain FT 12 transmembrane regions. Product modified to more specific FT family based on motif match. Functional classification - FT Transport/binding proteins -Other" FT /db_xref="GOA:Q0PA40" FT /db_xref="InterPro:IPR005829" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR016196" FT /db_xref="InterPro:IPR020846" FT /db_xref="UniProtKB/TrEMBL:Q0PA40" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF07690" FT /inference="protein motif:Pfam:PF00083" FT /protein_id="CAL34978.1" FT /translation="MSPKKIIKSMTALFAGMAFLFAGNALIVSSIGVILKENGESSLAV FT GVVSSCFFVGALIGTISTHKIISRIGHIRSFGLFGAIFGISAMLHTVSENLIFWAVLRF FT FIGICYYGLLMVIESWLNEKSKNAIRSRILGFYEIVFYLAFGIGVLIIALNLSKHSVFI FT LSATLILLSSLPLNLIKIKEPVLPASSPISIPKIFDIAPLAIVTSFIAGMLINGFFSMA FT SLFILLQGFDTKAVSYFIFCGVLGGFIAQTIIGTISDKLGRKFAIITCASIGFITMLIF FT IFFKLHLYMQYFLGITLGIGIFCLYALALARANDVLVSKNKGVELGRGVLFCYSLGSLF FT GPLILGFLMQYFEIKGFIWFYIVSLAFLILFAINKPNILNKKFKKKPGNMVIFDD" FT misc_feature complement(797671..798819) FT /note="HMMPfam hit to PF00083, Sugar (and other) FT transporter, score 4.6e-05" FT /inference="protein motif:Pfam:PF00083" FT misc_feature complement(join(798739..798807,798652..798711, FT 798574..798633,798478..798546,798373..798441, FT 798304..798363,798163..798231,798067..798135, FT 797989..798048,797911..797979,797785..797853, FT 797704..797772)) FT /note="12 probable transmembrane helices predicted for FT Cj0850c by TMHMM2.0 at aa 12-34, 44-63, 70-89, FT 99-121,134-156, 160-179, 204-226, 236-258, 265-284, FT 288-310,330-352 and 357-379" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(797791..798804) FT /note="HMMPfam hit to PF07690, Major Facilitator FT Superfamily, score 3.5e-24" FT /inference="protein motif:Pfam:PF07690" FT misc_feature complement(798028..798081) FT /note="PS00216 Sugar transport proteins signature 1" FT /inference="protein motif:Prosite:PS00216" FT misc_feature complement(798688..798720) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT sig_peptide complement(798751..798840) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000401_797653_798840 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.843 between residues 30 and 31" FT CDS complement(798818..799321) FT /transl_table=11 FT /locus_tag="Cj0851c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0851c, probable integral FT membrane protein, len: 167 aa; some similarity to FT YCIB_BUCAP putative integral membrane protein from Buchnera FT aphidicola (177 aa), fasta scores; opt: 139 z-score: 180.5 FT E(): 0.0093, 30.0% identity in 160 aa overlap. No Hp match" FT /note="Updated (2006) note: Four probable transmembrane FT helices predicted by TMHMM2.0. Paper identified giving FT further clues to product function. Functional FT classification - Membranes, lipoproteins and porins" FT /note="PMID:16045618" FT /db_xref="UniProtKB/TrEMBL:Q0PA39" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34979.1" FT /translation="MEHKKALFCIFAIIHLFFWIIFSSLNHFKLDTFLSYEIAFFSVLL FT IIFASYLNYKKVIIKKSKNYEKDFNFISSLFIKKKQNLSKIIHFKVLKDDLKPNVKEKI FT HFFAMFFTLFKLMAYVILVAGFLFLHRQDKLDIFAYICGISSLLVCVFIFILYIKKYES FT KKNY" FT misc_feature complement(join(799256..799303,799160..799228, FT 798944..799012,798848..798916)) FT /note="4 probable transmembrane helices predicted for FT Cj0851c by TMHMM2.0 at aa 7-22, 32-54, 104-126 and 136-158" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(799321..799650) FT /transl_table=11 FT /locus_tag="Cj0852c" FT /product="putative integral membrane protein" FT /note="Original (2000) note: Cj0852c, possible integral FT membrane protein, len: 109 aa; some similarity to FT hypothetical proteins e.g. TR:O27758 (EMBL:AE000929) FT Methanobacterium thermoautotrophicum MTH1725 (92 aa),fasta FT scores; opt: 123 z-score: 165.5 E(): 0.064, 32.7% identity FT in 98 aa overlap. 55.0% identity to HP0307" FT /note="Updated (2006) note: Two probable transmembrane FT helices predicted by TMHMM2.0. Functional classification FT -Membranes, lipoproteins and porins" FT /db_xref="UniProtKB/TrEMBL:Q0PA38" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34980.1" FT /translation="MSNILKEEKNHLENSNSKRQKIIRKTLEAADGLSLGISMVVAVFI FT GVGIGYLLKKFTPYPWLFWLGVFWGISAAILNVYKAYKVQVKSYEEFKERDELIKEKIQ FT KEKNK" FT misc_feature complement(join(799498..799566,799414..799470)) FT /note="2 probable transmembrane helices predicted for FT Cj0852c by TMHMM2.0 at aa 29-51 and 61-79" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(799647..800921) FT /transl_table=11 FT /gene="hemL" FT /locus_tag="Cj0853c" FT /product="glutamate-1-semialdehyde 2,1-aminomutase" FT /EC_number="5.4.3.8" FT /note="Original (2000) note: Cj0853c, hemL, probable FT glutamate-1-semialdehyde 2,1-aminomutase, len: 424 aa; FT highly similar to many e.g. GSA_ECOLI FT glutamate-1-semialdehyde 2,1-aminomutase (EC 5.4.3.8) (426 FT aa), fasta scores; opt: 1377 z-score: 1553.3 E(): 0, 49.9% FT identity in 417 aa overlap. 59.8% identity to HP0306 FT Contains PS00600 Aminotransferases class-III FT pyridoxal-phosphate attachment site, and Pfam match to FT entry PF00202 aminotran_3, Aminotransferases class-III FT pyridoxal-phosphate" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Biosynthesis of cofactors, prosthetic groups and carriers FT - Heme" FT /note="PMID:2045363" FT /db_xref="GOA:Q9PP70" FT /db_xref="InterPro:IPR004639" FT /db_xref="InterPro:IPR005814" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP70" FT /inference="protein motif:Pfam:PF00202" FT /inference="protein motif:Prosite:PS00600" FT /protein_id="CAL34981.1" FT /translation="MTNKKAFKETCKFIAGGVNSPVRAFANVQSEPKFISHGKGAYIFD FT IDGNSYIDYVQSWGPLLFGHCDKDIQKACQKALHKGSSFGAPTLLETELAKLVLSDFPH FT LEKIRFVSSGTEATMSAIRLARGFTKKDKILKFEGCYHGHSDSLLVSAGSGAATFNSPS FT SLGVLEDVAKHTLVAKYNDINSVKELFEKNKDIACVIIEPIAGNMGLVPAKQDFLEELA FT KICKNNQTLLIFDEVMSGYRASYLGSYGINHIQADIITFGKVIGGGLPAAAFASRAEIM FT DILSPLGGVYQAGTLSGNPLAMAAGIASLTKAKKKTKLYDKLGKLAKKLTQGMKKLADE FT KGLPLQACHVGSMFGYFFTKDPVSNYQDALKSDLALFSKFHKNMLENGIYLAPSQFETG FT FICSKMDDKIIDTTLEAVRESFKRI" FT misc_feature complement(799659..800858) FT /note="HMMPfam hit to PF00202, Aminotransferase FT class-III,score 3.5e-96" FT /inference="protein motif:Pfam:PF00202" FT CDS complement(800918..801265) FT /transl_table=11 FT /locus_tag="Cj0854c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0854c, probable periplasmic FT protein, len: 115 aa; 37.9% identity to HP0236. Contains FT N-terminal signal sequence and PS00190 Cytochrome c family FT heme-binding site signature. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="GOA:Q0PA36" FT /db_xref="InterPro:IPR009056" FT /db_xref="UniProtKB/TrEMBL:Q0PA36" FT /inference="protein motif:Prosite:PS00190" FT /protein_id="CAL34982.1" FT /translation="MKIVLMFFLFSISLFGADFITLKEYSKMLYENPRGISCKECHGAD FT GSEQILGYYMKNGIKTAYKVPSIQNLSFENFKNSLNQSKDAKSIMPNYSLTNDEIVTLY FT NYIKQFSKEEK" FT misc_feature complement(801137..801154) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT CDS 801345..802193 FT /transl_table=11 FT /gene="folD" FT /locus_tag="Cj0855" FT /product="methylenetetrahydrofolate FT dehydrogenase/methenyltetrahydrofolate cyclohydrolase" FT /EC_number="1.5.1.5" FT /EC_number="3.5.4.9" FT /note="Original (2000) note: Cj0855, folD, probable FT methylenetetrahydrofolate FT dehydrogenase/methenyltetrahydrofolate cyclohydrolase,len: FT 282 aa; highly similar to many e.g. FOLD_ECOLI FT methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5) / FT methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) (287 FT aa), fasta scores; opt: 920 z-score: 1106.6 E(): 0,54.2% FT identity in 275 aa overlap. 54.9% identity to HP0577. FT Contains PS00766 and PS00767 Tetrahydrofolate FT dehydrogenase/cyclohydrolase signatures 1 and 2, and Pfam FT match to entry PF00763 THF_DHG_CYH, Tetrahydrofolate FT dehydrogenase/cyclohydrolase" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with acceptable identity score. Appropriate motifs FT present. Putative not added to product function. Functional FT classification - Biosynthesis of cofactors,prosthetic FT groups and carriers - Folic acid" FT /note="PMID:1748668, PMID:10386884" FT /db_xref="GOA:Q0PA35" FT /db_xref="InterPro:IPR000672" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR020630" FT /db_xref="InterPro:IPR020631" FT /db_xref="InterPro:IPR020867" FT /db_xref="PDB:3P2O" FT /db_xref="UniProtKB/Swiss-Prot:Q0PA35" FT /inference="protein motif:Pfam:PF00763" FT /inference="protein motif:Prosite:PS00767" FT /inference="protein motif:Prosite:PS00766" FT /protein_id="CAL34983.1" FT /translation="MTLLDGKALSAKIKEELKEKNQFLKSKGIESCLAVILVGDNPASQ FT TYVKSKAKACEECGIKSLVYHLNENITQNELLALINTLNHDDSVHGILVQLPLPDHICK FT DLILESIISSKDVDGFHPINVGYLNLGLESGFLPCTPLGVMKLLKAYEIDLEGKDAVII FT GASNIVGRPMATMLLNAGATVSVCHIKTKDLSLYTRQADLIIVAAGCVNLLRSDMVKEG FT VIVVDVGINRLESGKIVGDVDFEEVSKKSSYITPVPGGVGPMTIAMLLENTVKSAKNRL FT N" FT misc_feature 801348..801698 FT /note="HMMPfam hit to PF00763, Tetrahydrofolate FT dehydrogenase/cyclohyd, score 3.6e-53" FT /inference="protein motif:Pfam:PF00763" FT misc_feature 801561..801638 FT /note="PS00766 Tetrahydrofolate FT dehydrogenase/cyclohydrolase signature 1" FT /inference="protein motif:Prosite:PS00766" FT misc_feature 801702..802187 FT /note="HMMPfam hit to PF02882, Tetrahydrofolate FT dehydrogenase/cyclohyd, score 8.6e-103" FT /inference="protein motif:Pfam:PF02882" FT misc_feature 802116..802142 FT /note="PS00767 Tetrahydrofolate FT dehydrogenase/cyclohydrolase signature 2" FT /inference="protein motif:Prosite:PS00767" FT CDS 802203..803051 FT /transl_table=11 FT /gene="lepP" FT /locus_tag="Cj0856" FT /product="signal peptidase I" FT /EC_number="3.4.21.89" FT /note="Original (2000) note: Cj0856, lepP, probable signal FT peptidase I, len: 282 aa; similar to many e.g. LEP_ECOLI FT signal peptidase I (EC 3.4.21.89) (324 aa), fasta scores; FT opt: 339 z-score: 395.2 E(): 1e-14, 33.7% identity in 270 FT aa overlap. 46.2% identity to HP0576. Contains PS00761 FT Signal peptidases I signature 3 and Pfam match to entry FT PF00461 signal_pept_I, Signal peptidases I" FT /note="Updated (2006) note: Pfam domain PF00717 Peptidase FT S24-like identified within CDS. Also, one probable FT transmembrane helix predicted by TMHMM2.0. Further support FT given to product function. Characterised within Escherichia FT coli with marginal identity score. Putative not added to FT product function. Functional classification -Protein and FT peptide secretion" FT /note="PMID:9823901" FT /db_xref="GOA:Q0PA34" FT /db_xref="InterPro:IPR000223" FT /db_xref="InterPro:IPR011056" FT /db_xref="InterPro:IPR015927" FT /db_xref="InterPro:IPR019758" FT /db_xref="InterPro:IPR019759" FT /db_xref="UniProtKB/TrEMBL:Q0PA34" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00717" FT /inference="protein motif:Pfam:PF00461" FT /inference="protein motif:Prosite:PS00761" FT /protein_id="CAL34984.1" FT /translation="MEILKKLYKFSQSWTGTVVIVLLVIFFFIQAFVIPSGSMKNTLLV FT GDFLFVKKFSYGIPTPHIPWLEIPVLPDFNKDGHLIKAQGPQRGDIVVFRNPRNEKEHF FT VKRCVGTGGDRIVYANKTLYVRMHEGDEFMKEHYPNDLVTLGGQIYVKEPYKQKGIHYD FT PKKDIESDILRFLSIGDFAMSPAYIKELGNHIGFSGGNAYVFDVPENEYFMMGDNRDYS FT YDSRFWGSVPYRLIVGKPWFVYFSWDKDKNVRWERIGRFVDTLENDEQYIHDHDDEDKL FT S" FT sig_peptide 802203..802316 FT /note="Signal peptide predicted for lepP by SignalP 2.0 HMM FT (Signal peptide probability 0.985) with cleavage site FT probability 0.566 between residues 38 and 39" FT misc_feature 802239..802307 FT /note="1 probable transmembrane helix predicted for Cj0856 FT by TMHMM2.0 at aa 13-35" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 802299..802586 FT /note="HMMPfam hit to PF00717, Peptidase S24-like, score FT 6e-18" FT /inference="protein motif:Pfam:PF00717" FT misc_feature 802836..802877 FT /note="PS00761 Signal peptidases I signature 3" FT /inference="protein motif:Prosite:PS00761" FT CDS complement(803073..804233) FT /transl_table=11 FT /gene="moeA" FT /locus_tag="Cj0857c" FT /product="putative molybdopterin biosynthesis protein" FT /note="Original (2000) note: Cj0857c, moeA, possible FT molybdopterin biosynthesis protein, len: 386 aa; similar to FT many e.g. MOEA_ECOLI molybdopterin biosynthesis MOEA FT protein (411 aa), fasta scores; opt: 602 z-score: 691.1 FT E(): 3.4e-31, 29.2% identity in 387 aa overlap. 37.0% FT identity to HP0172. Also similar to Cj1519 (33.3% identity FT in 378 aa overlap). Contains Pfam match to entry PF00994 FT MoCF_biosynth, Molybdenum cofactor biosynthesis protein" FT /note="Updated (2006) note: Pfam domains PF03454 MoeA FT C-terminal region (domain IV) and PF03453 MoeA N-terminal FT region (domain I and II) were identified within CDS. FT Further support given to product function. Characterised in FT Escherichia coli with marginal similaritly score. Putative FT kept within product function. Functional classification - FT Biosynthesis of cofactors, prosthetic groups and carriers - FT Molybdopterin" FT /note="PMID:9515915, PMID:12719427" FT /db_xref="GOA:Q0PA33" FT /db_xref="InterPro:IPR001453" FT /db_xref="InterPro:IPR005110" FT /db_xref="InterPro:IPR005111" FT /db_xref="UniProtKB/TrEMBL:Q0PA33" FT /inference="protein motif:Pfam:PF03453" FT /inference="protein motif:Pfam:PF03454" FT /inference="protein motif:Pfam:PF00994" FT /protein_id="CAL34985.1" FT /translation="MKNIFETLKDLENQISCLDESELISLEKAKDRILAKDLYARKNLP FT SFDNAALDGYAFNYTDINEALEIKGTIFAGDKNFYTVAKNECYKIMTGAKMPKNADTIL FT MLEDECIEENKLIIKKVPKQYNAYRYKGEELKKGEILLQKGTKLNDKHIALLASQGLYK FT IEVIRKIRIGIFSSGNELKEPWQECDEESIYNANALPLLTMLQNASYLGIIKDDFKSTK FT EALENTNFDLLITSGGASVGEADFMEKALDELGFTPLFKGLKARPARPTKLYRKGENFV FT LILPGNPMAAYLSCFIFAKKIINLLSGNLDNPLTFYGKMGMDLKLKSGRNNLILGNLEK FT GIFTPFNENKFGSGMILPLIKSEFLLISEENTGELKKGDEITLLKI" FT misc_feature complement(803079..803285) FT /note="HMMPfam hit to PF03454, MoeA C-terminal region FT (domain IV), score 0.01" FT /inference="protein motif:Pfam:PF03454" FT misc_feature complement(803340..803726) FT /note="HMMPfam hit to PF00994, Probable molybdopterin FT binding domain, score 4.8e-24" FT /inference="protein motif:Pfam:PF00994" FT misc_feature complement(803754..804233) FT /note="HMMPfam hit to PF03453, MoeA N-terminal region FT (domain I and II, score 6.8e-67" FT /inference="protein motif:Pfam:PF03453" FT CDS complement(804230..805486) FT /transl_table=11 FT /gene="murA" FT /locus_tag="Cj0858c" FT /product="UDP-N-acetylglucosamine FT 1-carboxyvinyltransferase" FT /EC_number="2.5.1.7" FT /note="Original (2000) note: Cj0858c, FT murA,UDP-N-acetylglucosamine 1-carboxyvinyltransferase, FT len: 418 aa; highly similar to e.g. MURA_ECOLI FT UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC FT 2.5.1.7) (419 aa), fasta scores; opt: 1216 z-score: 1386.5 FT E(): 0, 48.6% identity in 420 aa overlap. 59.6% identity to FT HP0648. Contains PS00017 ATP/GTP-binding site motif A FT (P-loop) and Pfam match to entry PF00275 EPSP_syntase,EPSP FT synthase (3-phosphoshikimate 1-carboxyvinyltransferase)" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with acceptable identity score. Putative not added to FT product function. Functional classification - Murein FT sacculus and peptidoglycan" FT /note="PMID:8664284, PMID:9654090" FT /db_xref="GOA:Q9PP65" FT /db_xref="InterPro:IPR001986" FT /db_xref="InterPro:IPR005750" FT /db_xref="InterPro:IPR013792" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP65" FT /inference="protein motif:Pfam:PF00275" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL34986.1" FT /translation="MTYLEIEGTNHLSGNVTISGAKNAALPLIVSSILAKNEVKINNVP FT NVADIKTLISLLENLGAKVNFQNNSALLNTNTLNQTIAKYDIVRKMRASILTLGPLLAR FT FGHCEVSLPGGCAIGQRPIDLHLLALEKMGANIQIKQGYVVASGNLKGNEILFDKITVT FT GSENIIMAAALAKGKTKLLNVAKEPEVVQLCEVLKDAGLEIKGIGTDELEIYGSDGELL FT EFKEFSVIPDRIEAGTYLCAGAITNSKITLDKVNATHLSAVLAKLHQMGFETLITEDSI FT TLLPAKEIKPVEIMTSEYPGFPTDMQAQFMALALKANGTSIIDERLFENRFMHVSELLR FT MGADIKLNGHIATIVGGKELNAADVMATDLRASSALILAALAAKGTSKVHRIYHLDRGY FT ENLEEKFKDLGAKITRLEE" FT misc_feature complement(804269..805465) FT /note="HMMPfam hit to PF00275, EPSP synthase FT (3-phosphoshikimate 1-car, score 6.4e-129" FT /inference="protein motif:Pfam:PF00275" FT misc_feature complement(804950..804973) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(805552..805980) FT /transl_table=11 FT /locus_tag="Cj0859c" FT /product="hypothetical protein Cj0859c" FT /note="Original (2000) note: Cj0859c, unknown, len: 142 aa; FT no Hp match. Gln-rich in C-term" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="GOA:Q0PA31" FT /db_xref="UniProtKB/TrEMBL:Q0PA31" FT /protein_id="CAL34987.1" FT /translation="MQINNSLNSLSQYVKVNSNEENQNSKNQEQNALAQDPAVEVNISK FT EAKEKSNTSNQNNSQAPAQALNAQNNTQQDSSSNSEDKLTELTQKLAEIQAKIVELTAK FT MSKANEDQIKSIESQIATLNAQASTIQAQIQELQSQQA" FT CDS 806075..806947 FT /transl_table=11 FT /locus_tag="Cj0860" FT /product="putative integral membrane protein" FT /note="Updated (2006) note: Ten probable transmembrane FT helices predicted by TMHMM2.0" FT /note="Original (2000) note: Cj0860, probable integral FT membrane protein, len: 290 aa; similar to hypothetical FT proteins e.g. YICL_ECOLI (307 aa), fasta scores; opt: 516 FT z-score: 611.4 E(): 9.3e-27, 32.0% identity in 284 aa FT overlap. No Hp match. Contains 2x Pfam match to entry FT PF00892 DUF6, Integral membrane protein. Functional FT classification - Membranes, lipoproteins and porins" FT /db_xref="GOA:Q0PA30" FT /db_xref="InterPro:IPR000620" FT /db_xref="UniProtKB/TrEMBL:Q0PA30" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00892" FT /protein_id="CAL34988.1" FT /translation="MGVFLVLLGGIFWAISGVLAEYLFKNNYSVDWVCFYRLLSTGLIL FT IFLSFKAQKILVFTNLKESLSICMFGFFGLLLTQFGYFKAIYYTDAGTATMIQYCAPLI FT IMLYLCFKNKKFPKLIEIFALILIIFALFLLATKGDIEAVVLNYWGIFWAVIGAFGVAF FT YSLSAREVILKYGLFWIMGWASLFASFVFLLILQFDKGLIHYAFNLKAFFSMGGIVFIG FT TIGAFCLYLKGVEYIGALRASMIASIEPVAAALMSFLFLKTRYSLLDIFAFVLIILSVI FT LNAKKTKVS" FT misc_feature order(806078..806146,806156..806224,806261..806320, FT 806348..806407,806426..806482,806510..806578, FT 806597..806665,806708..806767,806786..806854, FT 806867..806926) FT /note="10 probable transmembrane helices predicted for FT Cj0860 by TMHMM2.0 at aa 2-24, 28-50, 63-82, FT 92-111,118-136, 146-168, 175-197, 212-231, 238-260 and FT 265-284" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 806105..806485 FT /note="HMMPfam hit to PF00892, Integral membrane protein FT DUF6, score 4.2e-14" FT /inference="protein motif:Pfam:PF00892" FT misc_feature 806549..806929 FT /note="HMMPfam hit to PF00892, Integral membrane protein FT DUF6, score 5.2e-17" FT /inference="protein motif:Pfam:PF00892" FT CDS complement(806934..807500) FT /transl_table=11 FT /gene="pabA" FT /locus_tag="Cj0861c" FT /product="para-aminobenzoate synthase glutamine FT amidotransferase component II" FT /EC_number="4.1.3.-" FT /EC_number="6.3.5.8" FT /note="Original (2000) note: Cj0861c, pabA, probable FT para-aminobenzoate synthase glutamine amidotransferase FT component II, len: 188 aa; simlar to e.g. PABA_BACSU FT para-aminobenzoate synthase glutamine amidotransferase FT component II (EC 4.1.3.-) (194 aa), fasta scores; opt: 534 FT z-score: 632.3 E(): 6.4e-28, 44.6% identity in 186 aa FT overlap, and PABA_ECOLI (187 aa), fasta scores; opt: 475 FT z-score: 564.2 E(): 4e-24, 36.8% identity in 185 aa FT overlap. 38.6% identity to HP1281 annotated as anthranilate FT synthase component II (trpD). Contains Pfam match to entry FT PF00117 GATase, Glutamine amidotransferases class-I" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with acceptable identity score. Putative not added to FT product function. Functional classification - Biosynthesis FT of cofactors, prosthetic groups and carriers - Folic acid" FT /note="PMID:8096767, PMID:2123867" FT /db_xref="GOA:Q0PA29" FT /db_xref="InterPro:IPR006221" FT /db_xref="InterPro:IPR017926" FT /db_xref="UniProtKB/TrEMBL:Q0PA29" FT /inference="protein motif:Pfam:PF00117" FT /protein_id="CAL34989.1" FT /translation="MKKILFIDNYDSFSYTIIYYLKELSFECKVIKNDGFKKAKELEKF FT DFTHLIISPGPHSPKESKLSLKAIKYFKKNKKILGICLGHQCIAEIFGGRVSKMQNPMH FT GKISKLYFKKDPIFKGIKKEIEICLYHSLHISSMPEKCKILAHNSENIIMAIKHKKYPI FT YGLQFHPEAVLTQKGKKILKNFMKL" FT misc_feature complement(806937..807488) FT /note="HMMPfam hit to PF00117, Glutamine amidotransferase FT class-I, score 1.2e-59" FT /inference="protein motif:Pfam:PF00117" FT CDS complement(807497..809281) FT /transl_table=11 FT /gene="pabB" FT /locus_tag="Cj0862c" FT /product="para-aminobenzoate synthase component I" FT /EC_number="4.1.3.-" FT /EC_number="6.3.5.8" FT /note="Original (2000) note: Cj0862c, pabB, probable FT para-aminobenzoate synthase component I, len: 594 aa; FT simlar to e.g. PABB_ECOLI para-aminobenzoate synthase FT component I (EC 4.1.3.-) (453 aa), fasta scores; opt: 541 FT z-score: 604.3 E(): 2.3e-26, 35.7% identity in 252 aa FT overlap. 39.3% identity to HP0293. Contains Pfam match to FT entry PF00425 chorismate_bind, chorismate binding enzyme" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with acceptable identity score. Putative not added to FT product function. Functional classification - Biosynthesis FT of cofactors, prosthetic groups and carriers - Folic acid" FT /note="PMID:11841211, PMID:2251281" FT /db_xref="GOA:Q0PA28" FT /db_xref="InterPro:IPR001544" FT /db_xref="InterPro:IPR005801" FT /db_xref="InterPro:IPR015890" FT /db_xref="UniProtKB/TrEMBL:Q0PA28" FT /inference="protein motif:Pfam:PF00425" FT /protein_id="CAL34990.1" FT /translation="MTLENYAVFGKYFYHDLKHTLKAFNHKESKKCFKFIEKYKNDFYI FT LMLTDYELYRYFQDKNFTSKKAYLSVFAFKKRKKFQKEDIDEEKFIPEFINFLDQDNYK FT ENFIKVKEAISKGRVYQINLTQNFKFHSKMDSFELFKLLLSRQDTEFKAFIKDETREIL FT SFSPELFFKTKKRKIFTKPMKGTIKRDKDPIKDEENKIFLQNDTKNLSENVMICDLLRN FT DLSKIITKKSLKTKLFEIQSHPTLHQMTSRAQGKLKKNISLHQIFKALFPCGSITGAPK FT LESIKFIEELEQRDRGIYCGTIGLIHKNKNKFSVAIRTLEKQDEIYTYSTGSGLVWDSK FT FKDEFEELKLKSAILNPCDFHLFETMYFKNSQILFLKEHLLRLINSALKFNFNTHKLFK FT DFYNILNQKSSYKKYQNFTLFKLDEKIFHKKHSLFYNFPLPFKNPHKEGILKLILYKDG FT RYEFQQSALKQNSNDILLLSDDKINSKSDNLYHKSSLRTFYNQHSYKWQQNLCYDIAFF FT NEKDELCEGSRTNLILEKNSQFYTPQIQSGMLNGVYRNFLINLGLIKEKALFKQDLFEA FT ENIYCINSVRGLKKVKLQ" FT misc_feature complement(808220..808987) FT /note="HMMPfam hit to PF00425, chorismate binding FT enzyme,score 7.6e-45" FT /inference="protein motif:Pfam:PF00425" FT CDS complement(809271..810335) FT /transl_table=11 FT /gene="xerD" FT /locus_tag="Cj0863c" FT /product="DNA recombinase" FT /note="Original (2000) note: Cj0863c, xerD, probable DNA FT recombinase, len: 354 aa; similar to e.g. XERD_ECOLI FT integrase/recombinase XERD (298 aa), fasta scores; opt: 336 FT z-score: 389.2 E(): 2.2e-14, 29.5% identity in 298 aa FT overlap. 47.5% identity to HP0675 (xerC) and 30.5% identity FT to HP0995 (xerD). Contains Pfam match to entry PF00589 FT Phage_integrase, 'Phage' integrase family" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with acceptable identity score. Putative not added to FT product function. Functional classification - DNA FT replication, restriction/modification, recombination and FT repair" FT /note="PMID:9311978, PMID10635320, PMID11832210" FT /db_xref="GOA:Q0PA27" FT /db_xref="InterPro:IPR002104" FT /db_xref="InterPro:IPR011010" FT /db_xref="InterPro:IPR013762" FT /db_xref="UniProtKB/TrEMBL:Q0PA27" FT /inference="protein motif:Pfam:PF00589" FT /protein_id="CAL34991.1" FT /translation="MKYPLDCEENFEKSFLFWLAKYVKFKLNSLSNKELKNPQALAEVN FT FALTKGVKNIDELDALAKKARNAGLSGVNTYFNPLKKVFEYLNFYKLYSLKQIDEELIV FT EVLASITGALSDASKKNYRIAVINFFDFLDKQNEEDEKAHIFDINLKNWAGIAGSKGVK FT LPEFMSKEELKKFLDAIENADFKNNTIRNKLIIKIIIFTGIRVSEAINIKMGDISEEND FT LYIIRIRAKGNKYRVVMIKKELIYDLLKNVSINYISKDALLFVNKKGTPLTQSYVSRIV FT EQLLFRAGIRKQKNGAHMLRHTFATLLYKKQKDLVLVQEALGHASLNTSRIYTHFDNDK FT LKLAAQVAKELSDS" FT misc_feature complement(809307..809834) FT /note="HMMPfam hit to PF00589, Phage integrase family,score FT 9.8e-27" FT /inference="protein motif:Pfam:PF00589" FT CDS 810963..811322 FT /transl_table=11 FT /locus_tag="Cj0864" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0864, probable periplasmic FT protein, len: 119 aa; some similarity in C-terminus to FT C-terminus of thiol:disulfide interchange proteins (not FT including active site) e.g. TR:P97037 (EMBL:U32616) FT Klebsiella pneumoniae disulfide isomerase (222 aa), fasta FT scores; opt: 184 z-score: 240.3 E(): 4.4e-06, 36.9% FT identity in 84 aa overlap. No Hp match. Also similar to FT C-term of Cj0872 dsbA (57.3% identity in 82 aa overlap)" FT /note="Updated (2006) note: Interpro result (ipr012335) FT shows a thioredoxin fold within the CDS. Further support FT given to product function. No specific characterisation FT with acceptable identity score carried out yet. Putative FT kept within product function. Functional classification FT -Miscellaneous periplasmic proteins" FT /db_xref="InterPro:IPR012336" FT /db_xref="UniProtKB/TrEMBL:Q0PA26" FT /protein_id="CAL34992.1" FT /translation="MKFPVKLARSIVVCAFLAGISASALSEGKEYVILKNPIANADNYS FT VGLKAMNVSKADFENFLKTPEAAELLKSYEIANPISQNYGTPAFVVNGKYQIVPSAINS FT PEALIEITKELSKQK" FT sig_peptide 810963..811040 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000407_810963_811322 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.340 between residues 26 and 27" FT CDS 811319..812119 FT /transl_table=11 FT /gene="dsbB" FT /locus_tag="Cj0865" FT /product="putative disulphide oxidoreductase" FT /note="Original (2000) note: Cj0865, dsbB, possible FT disulfide oxidoreductase, len: 266 aa; similar to e.g. FT DSBB_ECOLI disulfide bond formation protein B (disulfide FT oxidoreductase) (176 aa), fasta scores; opt: 200 z-score: FT 250.0 E(): 1.3e-06, 29.9% identity in 137 aa overlap (the FT essential Cysteine residues are conserved). No Hp match" FT /note="Updated (2006) note: Four probable transmembrane FT helices predicted by TMHMM2.0. This CDS has been FT characterised as DsbB protein (PMID:15632440). It has been FT demonstrated that Cj0865 is indeed a disulfide FT oxidoreductase. This has been shown via in silico and in FT vivo work in E. coli and also complementation and enzymatic FT tests in C. jejuni. There is an alignment of different DsbB FT proteins (including Cj0865) with prediction of 5 FT transmembranehelises (not 4 as stated in annotation); FT (P24-A39; F60-I74; S87-L101; F194-A214; F231-G246). There FT are some differences in amino acid sequences between Cj0865 FT and its ortholog from 81-176 (CJJ81176_0881). It is stated FT that its translation starts from the second Met (although FT the predicted N-terminal amino acid sequences of both FT proteins are identical), there is also an insertion of 3 FT amino acids at the COOH end of protein. Thus, not added to FT protein function. Functional classification -Protein FT translation and modification" FT /note="PMID:15632440, PMID:7957076" FT /db_xref="GOA:Q0PA25" FT /db_xref="InterPro:IPR003752" FT /db_xref="InterPro:IPR023380" FT /db_xref="InterPro:IPR023792" FT /db_xref="UniProtKB/Swiss-Prot:Q0PA25" FT /inference="protein motif:TMHMM:2.0" FT /protein_id="CAL34993.1" FT /translation="MSCIKMKDKCRNFSLSKWQDTRKPWLILIIVTIGLTCIAHFLFQE FT YLFMKPCEQCVYIRFDMLVMAIGGMIALINPANNIIKIFSYSLAFYGIWLGLEHCLTLN FT HIHEVVHSENPFAGVDGCREIPIYPFNLPLYKWASSWFLPTGECGMDTPVVPENAYNHL FT NAFQKFFIGTPPDFENGLYSNGWYLIPSLKFMNMAICCLIAFLCCFVVLFAMFIAYVLD FT KNKPNAKIFALVIVALVLVLKFIGESKNPNQNIASLNQVVLRYS" FT misc_feature order(811391..811459,811502..811561,811910..811978, FT 812006..812059) FT /note="4 probable transmembrane helices predicted for FT Cj0865 by TMHMM2.0 at aa 25-47, 62-81, 198-220 and 230-247" FT /inference="protein motif:TMHMM:2.0" FT CDS join(812155..812364,812363..812470,812466..812564, FT 812566..812751,812753..812902,812902..812952, FT 812954..812980,812983..813018,813011..813019, FT 813021..813278,813275..813445,813448..813591) FT /pseudo FT /transl_table=11 FT /locus_tag="Cj0866" FT /product="pseudogene (arylsulfatase)" FT /EC_number="2.8.2.22" FT /note="Original (2000) note: Cj0866, ast, arylsulfatase FT pseudogene, len: 1434 bp; almost identical to parts of FT TR:Q46098 (EMBL:U38280 Campylobacter jejuni strain 81-176 FT arylsulfatase (620 aa), and similar to parts of TR:P97036 FT (EMBL:U32616) Klebsiella pneumoniae arylsulfate FT sulfotransferase (EC 2.8.2.22) (598 aa). No Hp match" FT /note="Updated (2006) note: Pfam domain PF05935 FT Arylsulfotransferase (ASST) identified within CDS. Part of FT stem loop also identified within C-terminal. Further FT support given to product function. Characterisation paper FT with Campylobacter jejuni included. Thus, putative not FT added to product function. Coding sequence has been updated FT to reflect the complete amino acid sequence for the encoded FT protein regardless of its expression. This will cause FT differences from the amino acid sequence of the previous FT annotation. Functional classification - Central FT intermediary metabolism - Sulphur metabolism" FT /note="PMID:8655516" FT /inference="protein motif:Pfam:PF05935" FT misc_feature order(812218..812363,812364..812466,812470..812564, FT 812566..812751,812753..812902,812902..812952, FT 812954..812980,812983..813011,813018..813019, FT 813021..813275,813278..813445,813448..813573) FT /note="HMMPfam hit to PF05935, Arylsulfotransferase (ASST), FT score 8.2e-179" FT /inference="protein motif:Pfam:PF05935" FT stem_loop 813583..813628 FT CDS 813675..814316 FT /transl_table=11 FT /gene="dsbA" FT /locus_tag="Cj0872" FT /product="putative protein disulphide isomerase" FT /note="Original (2000) note: Cj0872, dsbA, possible protein FT disulphide isomerase, len: 213 aa; some similarity to e.g. FT DSBA_ECOLI thiol:disulfide interchange protein DSBA FT precursor (208 aa), fasta scores; opt: 128 z-score: 159.8 FT E(): 0.13, 23.1% identity in 216 aa overlap (active site is FT conserved). No Hp match" FT /note="Updated (2006) note: Pfam domain PF01323 DSBA-like FT thioredoxin domain identified within CDS. Further support FT given to product function. No specific characterisation FT with acceptable identity score identified yet. Putative FT kept within product function. Functional classification FT -Protein translation and modification" FT /note="PMID:8494885" FT /db_xref="GOA:Q0PA24" FT /db_xref="InterPro:IPR001853" FT /db_xref="InterPro:IPR012336" FT /db_xref="UniProtKB/TrEMBL:Q0PA24" FT /inference="protein motif:Pfam:PF01323" FT /protein_id="CAL34995.1" FT /translation="MRNFFCKFVLALVFYSSFALANNSFITLNPSLPSSENSVIEAFSY FT KCIHCYNHHKFGTLEKLREAFPNLHFKLYPVSLMNGEFSKEMNELFTFAQYKDEQNGKD FT ASYSDSLSHKLADVYFVSYFLNKQRNFSNLDEFYDIGLKAMNVNKNEVLNFLNTPKAKE FT ILSEFQRANDIAKTYGTPAFVVNGKYQINPSAINSMQDLEDLVKKLSNMK" FT sig_peptide 813675..813800 FT /note="Signal peptide predicted for dsbA by SignalP 2.0 HMM FT (Signal peptide probability 0.998) with cleavage site FT probability 0.458 between residues 42 and 43" FT misc_feature 813786..814295 FT /note="HMMPfam hit to PF01323, DSBA-like thioredoxin FT domain, score 1.1e-05" FT /inference="protein motif:Pfam:PF01323" FT terminator 814319..814352 FT /note="15 bp stem-loop; possible termination of FT replication?" FT CDS complement(814351..814563) FT /transl_table=11 FT /locus_tag="Cj0873c" FT /product="hypothetical protein Cj0873c" FT /note="Original (2000) note: Cj0873c, unknown, len: 70 aa; FT no Hp match" FT /note="Updated (2006) note: Similar to hypothetical FT proteins from other bacteria. Functional classification FT -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PA23" FT /protein_id="CAL34996.1" FT /translation="MPQGAPDLSLEDAYDVAAYMNSQARPIKANRNKDFPDRKIKPLDM FT DVGPYDDSFSTTQHRYGPYTNMIKK" FT CDS complement(814539..815099) FT /transl_table=11 FT /locus_tag="Cj0874c" FT /product="putative cytochrome C" FT /note="Original (2000) note: Cj0874c, possible cytochrome FT C, len: 186 aa; very weak similarity to many cytochrome C FT proteins e.g. CYC_APIME cytochrome C (107 aa), fasta FT scores; opt: 106 z-score: 137.1 E(): 2.5, 36.5% identity in FT 52 aa overlap. No Hp match. Contains 2x PS00190 Cytochrome FT c family heme-binding site signature. Also some similarity FT to Cj0037c possible cytochrome C (36.0% identity in 178 aa FT overlap)" FT /note="Updated (2006) note: No specific characterisation in FT related bacteria with acceptable identity score. FT Appropriate motifs present. Putative added to product FT function. Functional classification - Energy metabolism FT -Electron transport" FT /db_xref="GOA:Q0PA22" FT /db_xref="InterPro:IPR003088" FT /db_xref="InterPro:IPR009056" FT /db_xref="UniProtKB/TrEMBL:Q0PA22" FT /inference="protein motif:Prosite:PS00190" FT /protein_id="CAL34997.1" FT /translation="MWVHKPKILKKRFAGNNLSCSSCHANGGSVQNQSGFVGIWARFPQ FT YNARGDKVITLADRINGCFERSTNGKRMPSDTPEMKAMLTYMQWLSQGVPVGAKIEGQG FT LKKIDFILKAADPKKGKAIYMDKCAVCHQENGLGLKNEDSTGAYYLYPPLWGDDSYNTG FT AGMYRLSKLLLILKKICLKVRLT" FT misc_feature complement(814701..814718) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT misc_feature complement(815025..815042) FT /note="PS00190 Cytochrome c family heme-binding site FT signature" FT /inference="protein motif:Prosite:PS00190" FT CDS complement(815050..815337) FT /transl_table=11 FT /locus_tag="Cj0876c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0876c, probable periplasmic FT protein, len: 96 aa; no Hp match. Functional classification FT - Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PA21" FT /protein_id="CAL34998.1" FT /translation="MNKFSIVLTLLLCGSCALALDPNLEKTKSATGIDLPTAKWNLPKE FT LNEDGTIDETKMPKNSEYSKMVILGNKILNETSKYVGPQAKDPKKKICGK" FT sig_peptide complement(815251..815337) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000410_815050_815337 by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.614 between residues 29 and 30" FT CDS complement(815432..815524) FT /transl_table=11 FT /locus_tag="Cj0877c" FT /product="very hypothetical protein Cj0877c" FT /note="Original (2000) note: Cj0877c, questionable ORF,len: FT 30 aa; no Hp match. Functional classification -Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PA20" FT /protein_id="CAL34999.1" FT /translation="MQDFIIAKKLYFCFKYISSILNINEYYFKV" FT CDS 815545..815691 FT /transl_table=11 FT /locus_tag="Cj0878" FT /product="hypothetical protein Cj0878" FT /note="Original (2000) note: Cj0878, unknown, len: 48 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PA19" FT /protein_id="CAL35000.1" FT /translation="MKNLSIQEKKDLDNCVFQNLGRQDTFTLSVVFKNFYLKIKAFILN FT NTT" FT CDS complement(815669..816301) FT /transl_table=11 FT /locus_tag="Cj0879c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0879c, probable periplasmic FT protein, len: 210 aa; no Hp match. Functional FT classification - Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PA18" FT /protein_id="CAL35001.1" FT /translation="MKKCILIFFSLYSLSFANIYEKLNDFAYEKKPNKDFKIQEVKLVQ FT FSQENKDCLELLIEASQVRILNSYNSCQKLSKDESFQKFLNEDFLKLYKNNGYLINENL FT QNLKNTMQDIMIYYKLRYSFSKDVKDMSKNKNLDILNIDEKDGGTLLYKINNQACVGIE FT LTRHDSRMAMKIYGIENLDKECKLFIQSPSFKDLSYTKKDFKWYYLE" FT CDS complement(816298..816540) FT /transl_table=11 FT /locus_tag="Cj0880c" FT /product="hypothetical protein Cj0880c" FT /note="Original (2000) note: Cj0880c, unknown, len: 240 aa; FT no Hp match. Functional classification - Unknown" FT /db_xref="UniProtKB/TrEMBL:Q0PA17" FT /protein_id="CAL35002.1" FT /translation="MNQNNNKTLKNELEDLQYELSIVLEAMLLYAGVKREKLENAIEAY FT IDNIDNVLENSNKEGVDEILEVVEFLKNKYKDFFQ" FT CDS complement(816524..817570) FT /transl_table=11 FT /locus_tag="Cj0881c" FT /product="hypothetical protein Cj0881c" FT /note="Original (2000) note: Cj0881c, unknown, len: 348 aa; FT 40.6% identity to HP1042. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="GOA:Q0PA16" FT /db_xref="InterPro:IPR001667" FT /db_xref="UniProtKB/TrEMBL:Q0PA16" FT /protein_id="CAL35003.1" FT /translation="MKIYHLSHTDLDGYACQFIVNFYFKSVKFYNSNYGKEINENFNSI FT IGDIEKDENFGKAIILITDLNLNLNQCEEFEKICKEKNTKIFLLDHHQSGEECAQKYSW FT YLLDSKRCATKIVYDFFSKICTPVLELSKFVDVVNAVDIWLSEDENFELGKVFLGLIAN FT AKEINRVMFKESQIDYMFFLLDKAWKFIGKENANILLDNATHFIKKDYFARKNDDTLSN FT LISYFVVEKLSELKENFSIEYEGHKGILTSNIGNTSVIGNDFLVKNPDYDFFIDVSSRK FT TLSFRANGKIDVSLMAKNLVGGGGHKNASGGLFATFKDGANYNYIKAQIIDLIKSKELK FT KENNESKQ" FT CDS complement(817579..819753) FT /transl_table=11 FT /gene="flhA" FT /locus_tag="Cj0882c" FT /product="flagellar biosynthesis protein" FT /note="Original (2000) note: Cj0882c, flhA, probable FT flagellar biosynthesis protein, len: 724 aa; similar to FT e.g. FLHA_ECOLI flagellar biosynthesis protein FLHA (692 FT aa), fasta scores; opt: 1065 z-score: 1153.9 E(): 0,39.6% FT identity in 694 aa overlap. 51.1% identity to HP1041. FT Contains Pfam match to entry PF00771 FHIPEP,FHIPEP family" FT /note="Updated (2006) note: Seven probable transmembrane FT helices predicted by TMHMM2.0. Further support given to FT product function. Characterised within more than one genus FT with acceptable identity scores. Putative not added to FT product function. Functional classification - Surface FT structures" FT /note="PMID:8002587, PMID:16332888, PMID:8063102" FT /db_xref="GOA:Q0PA15" FT /db_xref="InterPro:IPR001712" FT /db_xref="InterPro:IPR006301" FT /db_xref="UniProtKB/TrEMBL:Q0PA15" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00771" FT /protein_id="CAL35004.1" FT /translation="MAKNKIVDLVFPFLGPLIAPVLKAKSLTIVGFLVCILAIIIVPLP FT SPILDFFLALSIALSVLIILISIYIPKPTDLTTFPTLILIITLFRLSLNIATTRMILSE FT GQNGPEAVSEIIAAFGEFVVGGNMVIGVIVFCILVLINFMVVTKGSTRVSEVQARFTLD FT AMPGKQMAIDADLNAGLIDEQTARARRQEVIAEANFYGAMDGSSKFIKGDAVAGIIITI FT INIIGGFLIGSFQHDMALSDAASTYTILTIGDGLVSQIPGLITSTATAIIITRASKDEE FT NFAEGTLTQLLSEYRTLLIVGFVLFIFALVPGLPTLSLGFMALVFLSLGYLTKQVKEGK FT IDITTVKKSKPSAAAASQSGAGGTTAAPAKKSEEEILKEEEHKINDILKVEILELELGY FT GLIKLAENELTERIRSMRRSIAESLGFLMPKIRIRDNLRLKPNEYSFKLKGVSIASAEI FT YPDKYLAMDSGFITEEIEGIATKEPAFNSDALWIDANLKDEATLNGYIVIDPASVISTH FT MSELIKAHASELLTRQEVQNLLDKVKNDYPIIVEGALGVAPVSLIQKILKDLLKHHIPI FT KDMLTILESVSDIAEVSKSFDMIIEHVRASLARMITNMYLDDKGNLDIFILDSASSAVL FT MENVQFRDGSYHLPLSVAQTGTLVDTLRAEVAAVANGRIKPFILCVEPQLRKFIADICY FT NFSINIVVLSFAEIAENTNFNTEGIIRIEL" FT misc_feature complement(817612..819651) FT /note="HMMPfam hit to PF00771, FHIPEP family, score FT 4.4e-295" FT /inference="protein motif:Pfam:PF00771" FT misc_feature complement(join(819625..819693,819544..819612, FT 819448..819510,819322..819390,819046..819114, FT 818935..819003,818794..818862)) FT /note="7 probable transmembrane helices predicted for FT Cj0882c by TMHMM2.0 at aa 21-43, 48-70, 82-102, FT 122-144,214-236, 251-273 and 298-320" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(819682..819753) FT /note="Signal peptide predicted for flhA by SignalP 2.0 HMM FT (Signal peptide probability 0.735) with cleavage site FT probability 0.589 between residues 24 and 25" FT CDS complement(819740..820150) FT /transl_table=11 FT /locus_tag="Cj0883c" FT /product="putative transcriptional regulator" FT /note="Original (2000) note: Cj0883c, unknown, len: 136 aa; FT identical to TR:Q46090 (EMBL:U06951) Campylobacter jejuni FT 81-176 ORF3 in region upstream of the flhA gene. (136 aa), FT and similar to hypothetical proteins e.g. Y379_HAEIN (150 FT aa), fasta scores; opt: 174 z-score: 226.5 E(): 2.6e-05, FT 28.3% identity in 138 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF02082 FT Transcriptional regulator identified within CDS. Product FT modified to more specific family member based on motif FT match. No specific characterisation carried out yet, so FT putative kept in product function. Literature search FT identified papers giving further clues to product function. FT Functional classification - Broad regulatory functions" FT /note="PMID:8063102, PMID:15066034, PMID:14985343" FT /db_xref="GOA:Q0PA14" FT /db_xref="InterPro:IPR000944" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:Q0PA14" FT /inference="protein motif:Pfam:PF02082" FT /protein_id="CAL35005.1" FT /translation="MLFTKASEYALLSLIYISQKETPQDVDSLALELDIPKSFLAKILQ FT TLAKDGLLKSFKGAKGGFVLIKEPSQYTIKEIVNSAEKKDISVFECSGGTCPNNKEENC FT TLMPMLVNLQNKVDEFLDSITLEDIMKNNGKK" FT misc_feature complement(819788..820150) FT /note="HMMPfam hit to PF02082, Transcriptional FT regulator,score 3e-31" FT /inference="protein motif:Pfam:PF02082" FT misc_feature complement(819956..820012) FT /note="PS01332 Uncharacterized protein family UPF0074 FT signature" FT /inference="protein motif:Prosite:PS01332" FT CDS 820325..820597 FT /transl_table=11 FT /gene="rpsO" FT /locus_tag="Cj0884" FT /product="30S ribosomal protein S15" FT /note="Original (2000) note: Cj0884, rpsO, 30S ribosomal FT protein S15, len: 90 aa; almost iedentical to RS15_CAMJE FT 30S ribosomal protein S15 (90 aa), and highly similar to FT many e.g. RS15_ECOLI (88 aa), fasta scores; opt: 286 FT z-score: 385.5 E(): 3.6e-14, 54.0% identity in 87 aa FT overlap. 58.9% identity to HP1040. Contains PS00362 FT Ribosomal protein S15 signature and Pfam match to entry FT PF00312 S15, Ribosomal protein S15" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Putative not added to product FT function. Functional classification - Ribosomal protein FT synthesis and modification" FT /note="PMID:8063102" FT /db_xref="GOA:Q0PA13" FT /db_xref="InterPro:IPR000589" FT /db_xref="InterPro:IPR005290" FT /db_xref="InterPro:IPR009068" FT /db_xref="PDB:3ULW" FT /db_xref="UniProtKB/Swiss-Prot:Q0PA13" FT /inference="protein motif:Pfam:PF00312" FT /inference="protein motif:Prosite:PS00362" FT /protein_id="CAL35006.1" FT /translation="MALDSAKKAEIVAKFAKKPGDTGSTEVQVALLTARIAELTEHLKI FT YKKDFSSRLGLLKLVGQRKRLLSYLKRKDYNSYSKLITELNLRDK" FT misc_feature 820340..820588 FT /note="HMMPfam hit to PF00312, Ribosomal protein S15,score FT 2.4e-33" FT /inference="protein motif:Pfam:PF00312" FT misc_feature 820439..820531 FT /note="PS00362 Ribosomal protein S15 signature" FT /inference="protein motif:Prosite:PS00362" FT CDS complement(820683..823523) FT /transl_table=11 FT /gene="ftsK" FT /locus_tag="Cj0886c" FT /product="putative cell division protein" FT /note="Original (2000) note: Cj0886c, ftsK, probable cell FT division protein, len: 946 aa; 96.7% identity to YRO1_CAMJE FT (941 aa), and similar to e.g. FTSK_ECOLI cell division FT protein FTSK (1329 aa), fasta scores; opt: 803 z-score: FT 772.9 E(): 0, 45.2% identity in 522 aa overlap,and FT SP3E_BACSU stage III sporulation protein E (787 aa),fasta FT scores; opt: 1488 z-score: 1436.1 E(): 0, 48.3% identity in FT 476 aa overlap. 52.0% identity to HP1090. Contains PS00017 FT ATP/GTP-binding site motif A (P-loop)" FT /note="Updated (2006) note: Pfam domain PF01580 FT FtsK/SpoIIIE family identified within CDS. Further support FT given to product function. Three probable transmembrane FT helices predicted by TMHMM2.0. Similar to more than one FT annotated function in different genus. Putative kept within FT product function. Functional classification - Cell FT division" FT /note="PMID:8063102, PMID:11778051, PMID:7592387" FT /db_xref="GOA:Q0PA12" FT /db_xref="InterPro:IPR002543" FT /db_xref="InterPro:IPR018541" FT /db_xref="UniProtKB/Swiss-Prot:Q0PA12" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01580" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL35007.1" FT /translation="MLAPGMGEWVYKANLFLFGEFAYYYPFFLFILNYVYYKRNYKLAN FT FTRRELFGIGFAFFSSLLLFAVFYPNSGYILELAYAIFSTILGHTGSGIFALLLLLFSL FT VLLFPKFAKEILKIELDFTYLLKVEQAFKSLLMRVFGGENEKEDVGKSEPIVPKLNILQ FT DSIYGNLQINKKGETNNLEQIIKDSNINASKNSITTAKENFEKLKNQILDETIEIDKQS FT LKESRSFVHEHSQQVRNFAQKASKMSISLDEDFNFISEEEVDMIPERFLKPKKLEDIKQ FT IDTNKNLDEPSYKRKNIEIPVSNQEVKPKIFTKELELRENLIKKEKLEQEYKAYQNEIL FT ENKVKQEIKKLEEYDAINSSDIIEGNKYSFNSPKTIKTETEESDKINENKNLDKADNIF FT EFAPIVEELNHPYIEPTPIKNINEIVIEEKNTLDFIQNTETKIDNEKTNDQEIKLQKAV FT LAKEIAINQALLREIEQGEIEKPKDFTLPPLDFLANPKEHKQEINESEIDKKIYNLLEK FT LRRFKIGGDVISTYVGPVVTTFEFRPSADVKVSRILNLQDDLTMALMAKSIRIQAPIPG FT KDVVGIEVPNDEIQTIYLREILQSEVFKNAKSPLTIALGKDIVGNAFVTDLKKLPHLLI FT AGTTGSGKSVGINSMLLSLLYRNSPKTLRLMMIDPKMLEFSIYNDIPHLLTPVITDPKK FT AVNALSNMVAEMERRYRLMADAKTKNIENYNEKMKELGGEKLPFIVVIIDELADLMMTA FT GKDVEFYIGRLAQMARASGIHLIVATQRPSVDVVTGLIKANLPSRISYKVGQKIDSKVI FT LDAMGAESLLGRGDCLFTPPGTSSIVRLHAPFASEFEIEKIVDFLKDQQSVEYDESFLK FT DQQSVGVTTNESFDGEADELYEEAKRVILEDGKTSISYLQRRLKIGYNRSANIIEQLTQ FT NGILSEPDAKGQREIL" FT misc_feature complement(821172..821747) FT /note="HMMPfam hit to PF01580, FtsK/SpoIIIE family, score FT 8.5e-94" FT /inference="protein motif:Pfam:PF01580" FT misc_feature complement(821592..821615) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature complement(join(823419..823487,823308..823376, FT 823203..823271)) FT /note="3 probable transmembrane helices predicted for FT Cj0886c by TMHMM2.0 at aa 13-35, 50-72 and 85-107" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(823633..825885) FT /transl_table=11 FT /gene="flaD" FT /locus_tag="Cj0887c" FT /product="putative flagellin" FT /note="Original (2000) note: Cj0887c, flaD possible FT flagellin, len: 750 aa; similar to e.g. FLAB_HELMU FT flagellin B (513 aa), fasta scores; opt: 251 z-score: 251.7 FT E(): 1e-06, 22.2% identity in 535 aa overlap. 29.7% FT identity to HP0295. Also similar to Cj1338c flaA (21.0% FT identity in 563 aa overlap) and Cj1339c flaB (20.2% FT identity in 560 aa overlap)" FT /note="Updated (2006) note: Pfam domain PF00669 Bacterial FT flagellin N-terminus identified within CDS. Further support FT given to product function. No specific characterisation FT work with acceptable identity score carried out yet. FT Putative kept within product function. Functional FT classification - Surface structures" FT /note="PMID:8932324, PMID:2121898" FT /db_xref="GOA:Q0PA11" FT /db_xref="InterPro:IPR001029" FT /db_xref="UniProtKB/TrEMBL:Q0PA11" FT /inference="protein motif:Pfam:PF00669" FT /protein_id="CAL35008.1" FT /translation="MRITNKLNFTNSVNNSMGGQSALYQISQQLASGLKIQNSYEDAST FT YIDNTRLEYEIKTLEQVKESTSRAQEMTQNSMKALQDMVKLLEDFKVKVTQAASDSNSQ FT TSREAIAKELERIKESIVQLANTSVNGQYLFAGSQVANKPFDSNGNYYGDKNNINVVTG FT AGTESPYNIPGWDLFFKADGDYKKQISTNVSFTDNRWDLNKDPDKTKYLTGDSKWQQLI FT GQSYVKDNSLDADKDFEYDDSKLDFPPTTLYVQGTRPDGTSFKSAVLVKPEDTLEDVME FT NIGALYGNTPNNKVVEVSMNDSGQIQITDLKQGNNKLDFHAVAFTPQADDKTELNNIIQ FT AAQDEGITMEDVTNRVMTAALGNPNNGDITNLNNPVTIQINGQNFEIDLKQTDFIKSKM FT TDTDGNAANGADYDNVYFEKNGNTVYGNVSQVIKGSNAYATDSTKLSEVMAGDSLNGTT FT LNLKVNSKGGNSYDVTINLQTSTVSYPDPNNPGQTISFPIMHTNPATGNSGVVTGSNDI FT TYGQINDIIGMFAADKIPTTTIQANNGQINNADYTQIQQLMKDSQATVDVSMDYKGRIS FT VTDKLSSGTNIEISLSDSQSGQFPAPPFTTTSTVQNGPNFSFSANNSLTIDEPNVDIIK FT DLDSMIDAVLKGNMRADSESENPRNTGMQGALERLDHLADHVSKLNTTMGAYHNTIEGV FT NTRTSFLSVNVQSIKSNVIDVDYGEAMMNLMQVQLAYQASLKASTTISQLSLLNYM" FT misc_feature complement(825397..825807) FT /note="HMMPfam hit to PF00669, Bacterial flagellin FT N-terminus, score 1.8e-05" FT /inference="protein motif:Pfam:PF00669" FT tRNA 826066..826152 FT /gene="tRNA-Leu" FT /note="tRNA Leu anticodon CAA, Cove score 75.00" FT tRNA 826163..826237 FT /gene="tRNA-Gly" FT /note="tRNA Gly anticodon GCC, Cove score 88.10" FT CDS complement(826268..828199) FT /transl_table=11 FT /locus_tag="Cj0888c" FT /product="ABC transport system ATP-binding protein" FT /note="Original (2000) note: Cj0888c, ABC transport system FT ATP-binding protein, len: 643 aa; similar to UUP_ECOLI ABC FT transporter atp-binding protein UUP (635 aa), fasta scores; FT opt: 744 z-score: 763.9 E(): 0, 37.1% identity in 634 aa FT overlap. No Hp ortholog. Contains 2x PS00017 FT ATP/GTP-binding site motif A (P-loop), 2x PS00211 ABC FT transporters family signature, and 2x Pfam match to entry FT PF00005 ABC_tran" FT /note="Updated (2006) note: Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Transport/binding proteins - Other" FT /note="PMID:9139905" FT /db_xref="GOA:Q0PA10" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/TrEMBL:Q0PA10" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00211" FT /inference="protein motif:Prosite:PS00017" FT /protein_id="CAL35009.1" FT /translation="MALIDLIEASKKFGDKIVLNEVNFSANEGEKIAIIGKNGEGKSTF FT LKTLLGALPLDSGRIIRQNGKSIAMLSQTVDFNANLSVKEAIKQELVEIYNTLEEYEIL FT HKKLEEDPSNKDYLQKIDTLMTLIDSKDAWSIESKIIRVLKEFSLLEYENRIISTLSGG FT EIRRVGLCILLLKNPDILLLDEPTNHLDVYMTSFLEELLKNSKMCVIFISHDRYFIDAI FT AHKCVEVEQGKLSIFKGGYANYLEKKTQILQSLAKSHETLLKQLKSEEEWLRRGVKARL FT KRNEGRKERIFKMREEAKKNPGAIKRLKLEISRAALNFNGEKTINRKKMLFELKNISKN FT INNKNLFKDFSTRILQGERIAIVGRNGCGKSTLLKILLGQIKQDSGEIKRGELKIGYFD FT QARSLVNSDKSLLEIFCPNGGDRVEVRGKNMHVYGYLKNFLFPKEFLDKSVALLSGGEK FT NRVALALLFAKEYDVLILDEPTNDLDIATINILEEYLLSFEGAILLVSHDRYFVDKIAT FT KLYAFEGNGYINILHTLYTEYLENEKEIEELDNFALELQTQEQNNNQKEKSSKKLSYKE FT NEILKNHPEKIDFLEQKIAKLNQDLSDPNVYQEIGINKLYQELEVMQKELEILENEYFL FT VLEKSENL" FT misc_feature complement(826625..827131) FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 2.1e-45" FT /inference="protein motif:Pfam:PF00005" FT misc_feature complement(826799..826843) FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature complement(827087..827110) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature complement(827504..828115) FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 7.2e-43" FT /inference="protein motif:Pfam:PF00005" FT misc_feature complement(827678..827722) FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature complement(828071..828094) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(828203..829492) FT /transl_table=11 FT /locus_tag="Cj0889c" FT /product="putative sensory trasnduction histidine kinase" FT /note="Original (2000) note: Cj0889c, probable sensory FT transduction histidine kinase, len: 429 aa; similar in FT C-terminus to many e.g. ENVZ_ECOLI osmolarity sensor FT protein ENVZ (450 aa), fasta scores; opt: 210 z-score: FT 229.3 E(): 1.8e-05. 26.5% identity in 204 aa overlap No Hp FT ortholog. Contains two probable transmembrane domains in FT N-terminus and Pfam match to entry PF00512 signal, Signal FT carboxyl-terminal domain" FT /note="Updated (2006) note: Pfam domain PF02518 Histidine FT kinase-, DNA gyrase B-, and HSP90-like ATPase identified FT within CDS. Further support given to product function. Some FT characterisation in Bacillus subtilitis, however,identity FT score not acceptable. Putative kept in product function. FT Functional classification - Signal transduction" FT /note="PMID:8002614, PMID:14612242, PMID:12890034" FT /db_xref="GOA:Q0PA09" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR003661" FT /db_xref="InterPro:IPR004358" FT /db_xref="InterPro:IPR005467" FT /db_xref="InterPro:IPR009082" FT /db_xref="UniProtKB/TrEMBL:Q0PA09" FT /inference="protein motif:Pfam:PF02518" FT /inference="protein motif:Pfam:PF00512" FT /protein_id="CAL35010.1" FT /translation="MLKTKNIFIVFFVVLALIFGFIFYTFTNSYLNFLLIKQYEQKIKS FT LDDVLKFSLLEHLNDANIKDFAKDTRADFIILNNDMKISSVKNPDFFSNLKEGEILNFN FT SKKILTKSFIYKGYKYIIIVYPRFLDLELFWTKMAIGFGVCLLFVFILMLLLGRRIEKN FT FNKILDFLDSIGDHKVVILEKGIFKEFNLLNEKLLKTKDKILKNTQKNKKQSDKITLKN FT TQLASVISAISHELKNPLSVIDLSLEMLKDEKLEDKKLKKELLEKISRQSVKLNALTHK FT LNFVFNLNSEALQMQEFDLFSLCEKITKNPGFERVALQGKSTKVKADEFLIEQVIINLL FT SNALKYSQKKVILTARDQKIIVQDFGKGIEEDKIKLITKKFYKIDVKSDNSFGLGLFLV FT KKILNIHKSYLEISSTLGYGSSFSFKLSQG" FT misc_feature complement(828206..828514) FT /note="HMMPfam hit to PF02518, Histidine kinase-, DNA FT gyrase B-, and HSP90, score 1.5e-20" FT /inference="protein motif:Pfam:PF02518" FT misc_feature complement(828620..828823) FT /note="HMMPfam hit to PF00512, His Kinase A FT (phosphoacceptor) domain, score 1.3e-11" FT /inference="protein motif:Pfam:PF00512" FT misc_feature complement(join(829415..829474,829025..829093)) FT /note="2 probable transmembrane helices predicted for FT Cj0889c by TMHMM2.0 at aa 7-26 and 134-156" FT /inference="protein motif:TMHMM:2.0" FT sig_peptide complement(829418..829492) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000418_828203_829492 by SignalP 2.0 FT HMM (Signal peptide probability 0.922) with cleavage site FT probability 0.489 between residues 25 and 26" FT CDS complement(829486..830148) FT /transl_table=11 FT /locus_tag="Cj0890c" FT /product="putative sensory transduction transcriptional FT regulator" FT /note="Original (2000) note: Cj0890c, probable sensory FT transduction transcriptional regulator, len: 220 aa; FT similar to many e.g. PHOB_SHIFL phosphate regulon FT transcriptional regulator (229 aa), fasta scores; opt: 396 FT z-score: 471.5 E(): 5.8e-19, 29.3% identity in 222 aa FT overlap. No Hp ortholog. Contains Pfam match to entry FT PF00072 response_reg, Response regulator receiver domain FT and Pfam match to entry PF00486 trans_reg_C,Transcriptional FT regulatory protein, C terminal" FT /note="Updated (2006) note: Characterisation within more FT than one genus, however, identity scores were marginal. FT Putative kept within product function. Functional FT classification - Signal transduction" FT /note="PMID:9141682" FT /db_xref="GOA:Q0PA08" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR001867" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR016032" FT /db_xref="UniProtKB/TrEMBL:Q0PA08" FT /inference="protein motif:Pfam:PF00486" FT /inference="protein motif:Pfam:PF00072" FT /protein_id="CAL35011.1" FT /translation="MLKFKILIIEDDIDLNELLVLKLKSSGYEVISLADFFGVEDLLDN FT EQIDLLIVDRNLPSGDSLEKIQDLREQGYKEAVIFLTAKALHQDLLEGFESGCDDYVCK FT PFDFNELLLRIKAILKRHKKEEEKLSFGDFILDLVSYEFFYKNQKLEISNLDYELLKCF FT FENPNTLLTRQFLSESVWKDDTTSDKTINIALTRLRNKFPKLKDHIISVRGIGYKLC" FT misc_feature complement(829492..829710) FT /note="HMMPfam hit to PF00486, Transcriptional regulatory FT protein, C te, score 3.4e-18" FT /inference="protein motif:Pfam:PF00486" FT misc_feature complement(829780..830139) FT /note="HMMPfam hit to PF00072, Response regulator receiver FT domain, score 5.5e-25" FT /inference="protein motif:Pfam:PF00072" FT CDS complement(830135..831718) FT /transl_table=11 FT /gene="serA" FT /locus_tag="Cj0891c" FT /product="D-3-phosphoglycerate dehydrogenase" FT /EC_number="1.1.1.95" FT /note="Original (2000) note: Cj0891c, serA, probable FT D-3-phosphoglycerate dehydrogenase, len: 527 aa; similar to FT e.g. SERA_BACSU D-3-phosphoglycerate dehydrogenase (EC FT 1.1.1.95) (525 aa), fasta scores; opt: 1151 z-score: 1318.2 FT E(): 0, 36.4% identity in 528 aa overlap. 50.7% identity to FT HP0397. Also similar to Cj0373 (30.1% identity in 309 aa FT overlap). Contains PS00065 D-isomer specific 2-hydroxyacid FT dehydrogenases NAD-binding signature, S00670 D-isomer FT specific 2-hydroxyacid dehydrogenases signature 2, and Pfam FT match to entry PF00389 2-Hacid_DH, D-isomer specific FT 2-hydroxyacid dehydrogenases" FT /note="Updated (2006) note: Characterised in Escerichia FT coli and Bacillus subtilis with acceptable identity score. FT Putative not added to product function. Functional FT classification - Amino acid biosynthesis - Serine family" FT /note="PMID:3017965" FT /db_xref="GOA:Q0PA07" FT /db_xref="InterPro:IPR002912" FT /db_xref="InterPro:IPR006139" FT /db_xref="InterPro:IPR006140" FT /db_xref="InterPro:IPR006236" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:Q0PA07" FT /inference="protein motif:Pfam:PF00389" FT /inference="protein motif:Prosite:PS00065" FT /protein_id="CAL35012.1" FT /translation="MKKKIIVCDAILDKGVDILRKAEDIELIEAAKFPKDELMQMLSDI FT EVAITRSSTDVDVNFLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAV FT ELTMAHLLTSARSFVNAHNFLKIERKWEREKWYGIELMNKTLGVIGFGNIGSRVAIRAK FT AFGMKILAYDPYISASKITDLDMEQAKNLDEILEKSDFITIHTPKTKETNGMIGKQEIA FT KMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDKEPATNHPLLDFENISVTS FT HLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTEDLPPFVAPYIELVSKMAF FT LAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGEKINYVNAEFVAKEKGV FT ELSCETLPNSGYNNKLSVKIITENSNISVSGTVFNENEQRIVGLNGFKTDFKPKGKMII FT FKNKDIPGVIAKISSVLAAKNINIADFRLGRDGFGYALAVVLIDEKVQKEVLDELKQLE FT ACVFVQYVEI" FT misc_feature complement(830144..830356) FT /note="HMMPfam hit to PF01842, ACT domain, score 1.1e-11" FT /inference="protein motif:Pfam:PF01842" FT misc_feature complement(830873..831412) FT /note="HMMPfam hit to PF02826, D-isomer specific FT 2-hydroxyacid dehydrog, score 5.9e-52" FT /inference="protein motif:Pfam:PF02826" FT misc_feature complement(831068..831136) FT /note="PS00670 D-isomer specific 2-hydroxyacid FT dehydrogenases signature 2" FT /inference="protein motif:Prosite:PS00670" FT misc_feature complement(831200..831283) FT /note="PS00065 D-isomer specific 2-hydroxyacid FT dehydrogenases NAD-binding signature" FT /inference="protein motif:Prosite:PS00065" FT misc_feature complement(831428..831712) FT /note="HMMPfam hit to PF00389, D-isomer specific FT 2-hydroxyacid dehydrog, score 2.1e-20" FT /inference="protein motif:Pfam:PF00389" FT CDS complement(831715..832203) FT /transl_table=11 FT /locus_tag="Cj0892c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0892c, probable periplasmic FT protein, len: 162 aa; no Hp match. Functional FT classification - Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0PA06" FT /protein_id="CAL35013.1" FT /translation="MKKYITISILSILLLILLAVVFTLLWQFKANVNFIPQFAKDTNTQ FT PSIQTQNQDLSWQEELAKWPTRDFTPAAEKFTLYFDADTSELKEKNKYYQLIVGKYDIY FT SMFCLRQTLNSFNVKYFLLKSGHSPEIFLDTGNEKLIDDIIKELKKYKINTEVKEIWL" FT sig_peptide complement(832084..832203) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000420_831715_832203 by SignalP 2.0 FT HMM (Signal peptide probability 0.999) with cleavage site FT probability 0.508 between residues 40 and 41" FT misc_feature complement(832126..832185) FT /note="1 probable transmembrane helix predicted for Cj0892c FT by TMHMM2.0 at aa 7-26" FT /inference="protein motif:TMHMM:2.0" FT CDS complement(832203..833873) FT /transl_table=11 FT /gene="rpsA" FT /locus_tag="Cj0893c" FT /product="30S ribosomal protein S1" FT /note="Original (2000) note: Cj0893c, rpsA, probable 30S FT ribosomal protein S1, len: 556 aa; similar to many e.g. FT RS1_ECOLI 30S ribosomal protein S1 (557 aa), fasta scores; FT opt: 1053 z-score: 1148.3 E(): 0, 33.4% identity in 548 aa FT overlap. 47.0% identity to HP0399. Contains 6x Pfam match FT to entry PF00575 S1, S1 RNA binding domain" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with marginal identity score. Appropriate motifs FT present. Putative not added to product function. Functional FT classification - Ribosomal protein synthesis and FT modification" FT /note="PMID:6267426" FT /db_xref="GOA:Q0PA05" FT /db_xref="InterPro:IPR000110" FT /db_xref="InterPro:IPR003029" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR016027" FT /db_xref="InterPro:IPR022967" FT /db_xref="UniProtKB/TrEMBL:Q0PA05" FT /inference="protein motif:Pfam:PF00575" FT /protein_id="CAL35014.1" FT /translation="MSEVNKKVQDGVDDYLEEEDFGQLLEAFDKSREEATTEGVIVEIK FT NDEVYVDIGKKSEGILALSEIQGDNSKLLFNVGDSIKVAVMGSRGGRSLLSHKKALRKE FT KVIEFIKNYQENQDDIFTVKVVGKNKGGLIVVDENDVEFFLPKSQYGFKETNNIIGKTF FT KVKIIKIDKDEQSIIVSRKKTLDDERRKRKELINNVAQQEDLIEGIVKKITTYGMFVDV FT GGVDGLVHYSEISYKGPVNPGTLYKEGDKVPVKVIKYDKERKHLSLSIKAALPDPWSEI FT KDTLDIGDTIKVIVSNIEPYGAFVDLGNDIEGFLHISEISWDKNIKNPKDYINKGQEID FT VEVIEINPNERRLRVSLRNLLSRPFDEFMKSYKIADVVEGEITSVTSFGAFVKLGGIEG FT LLHNEDASWDRNDKCKDKFSQGDKIKVKIIKIDEENQKISLSTKELSSSPVQEYAKIHK FT VGDIVKGAIRDIKDFGVFVELSKNVDALIHKEDISTSMLENLKIGDDIEAAIVFIDEKK FT NRIRLSVKNLVRIKEREVLNEINNDDKVTLGDIIKDQLA" FT misc_feature complement(832299..832508) FT /note="HMMPfam hit to PF00575, S1 RNA binding domain,score FT 4.8e-15" FT /inference="protein motif:Pfam:PF00575" FT misc_feature complement(832545..832763) FT /note="HMMPfam hit to PF00575, S1 RNA binding domain,score FT 3.1e-25" FT /inference="protein motif:Pfam:PF00575" FT misc_feature complement(832800..833024) FT /note="HMMPfam hit to PF00575, S1 RNA binding domain,score FT 1.9e-27" FT /inference="protein motif:Pfam:PF00575" FT misc_feature complement(833061..833279) FT /note="HMMPfam hit to PF00575, S1 RNA binding domain,score FT 5.7e-22" FT /inference="protein motif:Pfam:PF00575" FT misc_feature complement(833328..833534) FT /note="HMMPfam hit to PF00575, S1 RNA binding domain,score FT 1.8e-06" FT /inference="protein motif:Pfam:PF00575" FT CDS complement(834005..834838) FT /transl_table=11 FT /gene="ispH" FT /locus_tag="Cj0894c" FT /product="4-hydroxy-3-methylbut-2-enyl diphosphate FT reductase" FT /EC_number="1.17.1.2" FT /note="Original (2000) note: Cj0894c, lytB, homolog of E. FT coli lytB involved in in penicillin tolerance and control FT of the stringent response, len: 277 aa; 98.9% identical to FT TRP94644 (EMBL:X89371) C. jejuni lytB (277 aa), and similar FT to e.g. LYTB_ECOLI LYTB protein (316 aa), fasta scores; FT opt: 418 z-score: 486.6 E(): 8.3e-20, 29.2% identity in 288 FT aa overlap. 59.1% identity HP0400" FT /note="Updated (2006) note: Pfam domain PF02401 LytB FT protein identified within CDS. Now fully characterised in FT Escherichia coli and Campylobacter jejuni with marginal FT identity scores. Appropriate motifs were identified. FT Product function updated along with gene name and EC FT number. Putative not added to product function. Functional FT classification - Misc" FT /note="PMID:11818558, PMID:11418107, FT PMID:9418246,PMID:15469281" FT /db_xref="GOA:P0C632" FT /db_xref="InterPro:IPR003451" FT /db_xref="UniProtKB/Swiss-Prot:P0C632" FT /inference="protein motif:Pfam:PF02401" FT /protein_id="CAL35015.1" FT /translation="MIIELAKNYGFCFGVKRAIKKAEQIKDAATIGPLIHNNEEISRLQ FT KNFNVKTLENIQALSNEKKAIIRTHGITKQDLEELRKKDIEIFDATCPFVTKPQQICEQ FT MSKEGYEVVIFGDENHPEVKGVKSYVSTKAYVVLDKKELQNIKLPNKIAVVSQTTKKPE FT HFMEIVNFLILKTKEVRVFNTICDATFKNQDAIKELSLKSDVMVVVGGKNSANTKQLFL FT IAKTNCEDSYLIETEEELKKEWFLDKKHCGISAGASTPDWIIQKVIAKIENFRIN" FT misc_feature complement(834017..834832) FT /note="HMMPfam hit to PF02401, LytB protein, score FT 2.5e-160" FT /inference="protein motif:Pfam:PF02401" FT CDS complement(834828..836114) FT /transl_table=11 FT /gene="aroA" FT /locus_tag="Cj0895c" FT /product="3-phosphoshikimate 1-carboxyvinyltransferase" FT /EC_number="2.5.1.19" FT /note="Original (2000) note: Cj0895c, FT aroA,3-phosphoshikimate 1-carboxyvinyltransferase, len: 428 FT aa; 98.6% identical to AROA_CAMJE 3-phosphoshikimate FT 1-carboxyvinyltransferase (EC 2.5.1.19) (428 aa), and FT similar to many e.g. AROA_BACSU (428 aa), fasta scores; FT opt: 932 z-score: 1099.9 E(): 0, 38.3% identity in 433 aa FT overlap. 52.0% identity to HP0401. Contains PS00104 EPSP FT synthase signature 1 and Pfam match to entry PF00275 FT EPSP_syntase, EPSP synthase (3-phosphoshikimate FT 1-carboxyvinyltransferase)" FT /note="Updated (2006) note: Characterised in Campylobacter FT jejuni, so putative not added to product function. FT Functional classification - Amino acid biosynthesis FT -Aromatic amino acid family" FT /note="PMID:8973316" FT /db_xref="GOA:P0C630" FT /db_xref="InterPro:IPR001986" FT /db_xref="InterPro:IPR006264" FT /db_xref="InterPro:IPR013792" FT /db_xref="InterPro:IPR023193" FT /db_xref="UniProtKB/Swiss-Prot:P0C630" FT /inference="protein motif:Pfam:PF00275" FT /inference="protein motif:Prosite:PS00104" FT /protein_id="CAL35016.1" FT /translation="MKIYKLQTPVNAILENIAADKSISHRFAIFSLLTQEENKAQNYLL FT AQDTLNTLEIIKNLGAKIEQKDSCVKIIPPKEILSPNCILDCGNSGTAMRLMIGFLAGI FT SGFFVLSGDKYLNNRPMRRISKPLTQIGARIYGRNEANLAPLCIEGQKLKAFNFKSEIS FT SAQVKTAMILSAFRADNVCTFSEISLSRNHSENMLKAMKAPIRVSNDGLSLEINPLKKP FT LKAQNIIIPNDPSSAFYFVLAAIILPKSQIILKNILLNPTRIEAYKILQKMGAKLEMTI FT TQNDFETIGEIRVESSKLNGIEVKDNIAWLIDEAPALAIAFALAKGKSSLINAKELRVK FT ESDRIAVMVENLKLCGVEARELDDGFEIEGGCELKSSKIKSYGDHRIAMSFAILGLLCG FT IEIDDSDCIKTSFPNFIEILSNLGARIDY" FT misc_feature complement(834858..836099) FT /note="HMMPfam hit to PF00275, EPSP synthase FT (3-phosphoshikimate 1-car, score 2.1e-163" FT /inference="protein motif:Pfam:PF00275" FT misc_feature complement(835818..835862) FT /note="PS00104 EPSP synthase signature 1" FT /inference="protein motif:Prosite:PS00104" FT CDS complement(836111..838432) FT /transl_table=11 FT /gene="pheT" FT /locus_tag="Cj0896c" FT /product="phenylalanyl-tRNA synthetase beta chain" FT /EC_number="6.1.1.20" FT /note="Original (2000) note: Cj0896c, pheT, probable FT phenylalanyl-tRNA synthetase beta chain, len: 773 aa; FT similar to many e.g. SYFB_ECOLI phenylalanyl-tRNA FT synthetase beta chain (EC 6.1.1.20) (795 aa), fasta scores; FT opt: 585 z-score: 663.2 E(): 1.2e-29, 27.8% identity in 802 FT aa overlap. 36.0% identity to HP0402" FT /note="Updated (2006) note: Pfam domains PF03484 tRNA FT synthetase B5 domain, PF03483 B3/4 domain and PF01588 FT Putative tRNA binding domain were identified within CDS. FT Further support given to product function. Characterised in FT Escherichia coli with marginal identity score. Appropriate FT motfis present. Putative not added to product function. FT Functional classification - Aminoacyl tRNA synthetases and FT their modification" FT /note="PMID:8973316, PMID:2991205" FT /db_xref="GOA:Q9PP35" FT /db_xref="InterPro:IPR002547" FT /db_xref="InterPro:IPR003583" FT /db_xref="InterPro:IPR004532" FT /db_xref="InterPro:IPR005121" FT /db_xref="InterPro:IPR005146" FT /db_xref="InterPro:IPR005147" FT /db_xref="InterPro:IPR009061" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR016027" FT /db_xref="InterPro:IPR020825" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP35" FT /inference="protein motif:Pfam:PF01588" FT /inference="protein motif:Pfam:PF03483" FT /inference="protein motif:Pfam:PF03484" FT /protein_id="CAL35017.1" FT /translation="MIITKSWLNDWLELEEISSDKIAKTLNSIGIEVDRVGALKAPDKV FT VVGYVKEKIKHENSDKLSICQVDIGSETLQIVCGAANVDAGQFVAVATKGAIMSNGMEI FT KEAKLRGVDSCGMLCSSLELGFEKINEGIMLLDESIGKLELGRPLNTYEIFNDELIEVE FT LTPNRGDCLSIYGIARDLAAALNLNLKEPKPFKESENVLGIGRILRLAAEKELNGLYNY FT RAIGLKEEIQTNLLLSLRLAQIEGLGKNSIENLLNYATHSTGVLFNAYDLSSFSEKDEE FT FTINLSKQVHGETKVSYKDKLLSFSGIFQNNESRCKDDSKIIIIEANYTDPLVIADAKI FT YHKDQDEKMLYRSFRGSEPKLNLGMDFLLGIFEQIPNLVIYSSSQQILTDKELPIIPIS FT IEGISDIIGQNVDKDEVLKILKKLGFELILSGEGLINVKAPLHRPDIKNLSDICEEVVR FT IIGIDNIASKGLEFIEKNRLNSAYKNYIEFLNLRKRAVASGYFESLHYVLDNGEELKRL FT GFDSVKLKLINPITAELNTLRTTLLNHLLNAASLNAKNSKKIIKLFELGAVFNVNNQEL FT NRIAFIHSGLKEEAKISNKAKPESVQFYDFLLDIKNIIGDFKLKSSKYNILSPYEQADI FT YLSDIKVGFIGRLHLKIENERDLPKTYICELDLDLIRQDFKIAKPYSKFPAITRDLSVL FT IPKGFEYNQIKNCIEELNLEILENFRLVDIYSDENLKEFYSITISFSFRDINKTLEDNQ FT VNECMDKILNTLKNLGLDLR" FT misc_feature complement(836114..836389) FT /note="HMMPfam hit to PF03147, Ferredoxin-fold anticodon FT binding domain, score 4.8e-19" FT /inference="protein motif:Pfam:PF03147" FT misc_feature complement(837047..837256) FT /note="HMMPfam hit to PF03484, tRNA synthetase B5 FT domain,score 2.7e-21" FT /inference="protein motif:Pfam:PF03484" FT misc_feature complement(837302..837787) FT /note="HMMPfam hit to PF03483, B3/4 domain, score 5.4e-21" FT /inference="protein motif:Pfam:PF03483" FT misc_feature complement(837989..838300) FT /note="HMMPfam hit to PF01588, Putative tRNA binding FT domain, score 2.9e-27" FT /inference="protein motif:Pfam:PF01588" FT CDS complement(838429..839421) FT /transl_table=11 FT /gene="pheS" FT /locus_tag="Cj0897c" FT /product="phenylalanyl-tRNA synthetase alpha chain" FT /EC_number="6.1.1.20" FT /note="Original (2000) note: Cj0897c, pheS, probable FT phenylalanyl-tRNA synthetase alpha chain, len: 330 aa; FT similar to many e.g. SYFA_ECOLI phenylalanyl-tRNA FT synthetase alpha chain (EC 6.1.1.20) (327 aa), fasta FT scores; opt: 854 z-score: 1005.3 E(): 0, 51.2% identity in FT 326 aa overlap. 58.1% identity to HP0403. Contains PS00179 FT and PS00339 Aminoacyl-transfer RNA synthetases class-II FT signatures 1 and 2" FT /note="Updated (2006) note: Pfam domains PF01409 tRNA FT synthetases class II core domain and PF02912 Aminoacyl tRNA FT synthetase class II, N-terminal domain were identified FT within CDS. Further support given to product function. FT Characterised in Bacillus subtilis and Escherichia coli FT with acceptable identity score. Putative not added to FT product function. Functional classification -Aminoacyl tRNA FT synthetases and their modification" FT /note="PMID:6317865, PMID:1537809" FT /db_xref="GOA:Q9PP34" FT /db_xref="InterPro:IPR002319" FT /db_xref="InterPro:IPR004188" FT /db_xref="InterPro:IPR004529" FT /db_xref="InterPro:IPR006195" FT /db_xref="InterPro:IPR010978" FT /db_xref="InterPro:IPR022911" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP34" FT /inference="protein motif:Pfam:PF02912" FT /inference="protein motif:Pfam:PF01409" FT /inference="protein motif:Prosite:PS00339" FT /inference="protein motif:Prosite:PS00179" FT /protein_id="CAL35018.1" FT /translation="MQNFIEQIQKCENLNDLEAIRISVLGKKGILTEGFTKLKELEDEA FT KKEFAAKLNAQKEIFNEAYLAKFKDLENLALEERMKQDALNFNYFDESITTGALHPVMS FT TMDKIIEYFIALNFSIEKGPLIEDDFHNFEALNLPKSHPARDMQDTFYFDDKRLLRTQT FT SPVQIRTMLAQKPPIRMIAPGAVFRRDFDITHTPMFHQVEGLVVEEGQKVSFANLKSVL FT EDFLRYMFGDVKVRFRPSFFPFTEPSAEVDISCVFCKGKGCRVCKHTGWLEVLGCGIVD FT PNVYNFVGYENVSGYAFGLGVERFAMLLHQIPDLRSLFEGDLRLLEQFR" FT misc_feature complement(838474..839121) FT /note="HMMPfam hit to PF01409, tRNA synthetases class II FT core domain, score 7.2e-143" FT /inference="protein motif:Pfam:PF01409" FT misc_feature complement(838498..838527) FT /note="PS00339 Aminoacyl-transfer RNA synthetases class-II FT signature 2" FT /inference="protein motif:Prosite:PS00339" FT misc_feature complement(838813..838863) FT /note="PS00179 Aminoacyl-transfer RNA synthetases class-II FT signature 1" FT /inference="protein motif:Prosite:PS00179" FT misc_feature complement(839179..839397) FT /note="HMMPfam hit to PF02912, Aminoacyl tRNA synthetase FT class II, N, score 2.5e-23" FT /inference="protein motif:Pfam:PF02912" FT CDS 839544..839909 FT /transl_table=11 FT /locus_tag="Cj0898" FT /product="putative histidine triad (HIT) family protein" FT /note="Original (2000) note: Cj0898, HIT-family FT protein,len: 121 aa; similar to many members of the HIT FT family e.g. IPK1_HUMAN HINT protein (protein kinase C FT inhibitor 1) (125 aa), fasta scores; opt: 286 z-score: FT 385.9 E(): 3.4e-14, 40.6% identity in 106 aa overlap, and FT YCFF_ECOLI HYPOTHETICAL 13.2 KD PROTEIN HIT-LIKE PROTE (119 FT aa),fasta scores; opt: 276 z-score: 373.2 E(): 1.7e-13, FT 38.2% identity in 110 aa overlap. 56.6% identity to HP0404. FT Contains Pfam match to entry PF01230 HIT, HIT family" FT /note="Updated (2006) note: Specific characterisation has FT not been carried out, so putative kept in product function. FT Functional classification - Misc" FT /db_xref="GOA:Q0PA00" FT /db_xref="InterPro:IPR001310" FT /db_xref="InterPro:IPR011146" FT /db_xref="InterPro:IPR011151" FT /db_xref="InterPro:IPR019808" FT /db_xref="UniProtKB/TrEMBL:Q0PA00" FT /inference="protein motif:Pfam:PF01230" FT /protein_id="CAL35019.1" FT /translation="MQEKTIFELIVEGKLPCNKVLESDDFLAFHDIAPKAPIHILIIPK FT KYFKDFQEFDPELMAKMTSFIQELAVLLGVDKSGYRLVTNCGKNSGQEVFHLHFHMLGG FT FELPKEKTKKENPQALF" FT misc_feature 839556..839864 FT /note="HMMPfam hit to PF01230, HIT domain, score 3.2e-40" FT /inference="protein motif:Pfam:PF01230" FT CDS complement(839939..840508) FT /transl_table=11 FT /gene="thiJ" FT /locus_tag="Cj0899c" FT /product="4-methyl-5(beta-hydroxyethyl)-thiazole FT monophosphate synthesis protein" FT /note="Original (2000) note: Cj0899c, thiJ, probable FT 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate FT synthesis protein, len: 189 aa; simlar to e.g. THIJ_ECOLI FT 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate FT biosynthesis enzyme (198 aa), fasta scores; opt: 265 FT z-score: 330.3 E(): 4.2e-11, 32.6% identity in 181 aa FT overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF01965 DJ-1/PfpI FT family identified within CDS. Further support given to FT product function. Characterised in Escherichia coli with FT marginal identity score. Putative not added to protein FT function. Functional classification - Biosynthesis of FT cofactors, prosthetic groups and carriers - Thiamine" FT /note="PMID:10075431" FT /db_xref="InterPro:IPR002818" FT /db_xref="InterPro:IPR006287" FT /db_xref="UniProtKB/TrEMBL:Q0P9Z9" FT /inference="protein motif:Pfam:PF01965" FT /protein_id="CAL35020.1" FT /translation="MSKKVLIPLAQGFEEAEFIGIADVLKRAKELNPDLEVVIASLNSE FT LLVKGANSISIKADCSIEDVDIENLDAIALAGGFEGMMNLKNSNVILNIIKQLHSKNKI FT VAAICASPIVLNEAGVLEGEFACYPSCEVGLNGNRVNKAVVVNKNVITSAGPATAILFG FT LELAKKLCGDEIYQKLYEGMLLPLTK" FT misc_feature complement(839996..840403) FT /note="HMMPfam hit to PF01965, DJ-1/PfpI family, score FT 6.9e-32" FT /inference="protein motif:Pfam:PF01965" FT misc_feature complement(840434..840481) FT /note="PS00225 Crystallins beta and gamma 'Greek key' motif FT signature" FT /inference="protein motif:Prosite:PS00225" FT CDS complement(840501..840680) FT /transl_table=11 FT /locus_tag="Cj0900c" FT /product="small hydrophobic protein" FT /note="Original (2000) note: Cj0900c, small hydrophobic FT protein, len: 59 aa; 29.8% identity to HP0085. Functional FT classification - Conserved hypothetical proteins" FT /db_xref="UniProtKB/TrEMBL:Q0P9Z8" FT /protein_id="CAL35021.1" FT /translation="MLEFPKNKVVFMEILDFILIVIFVFLMIVLVIGFNHQMMQKNKER FT EERFKKYKKGEQNE" FT misc_feature complement(840585..840653) FT /note="1 probable transmembrane helix predicted for Cj0900c FT by TMHMM2.0 at aa 10-32" FT /inference="protein motif:TMHMM:2.0" FT CDS 840763..841506 FT /transl_table=11 FT /locus_tag="Cj0901" FT /product="putative amino acid ABC tansporter permease FT protein" FT /note="Original (2000) note: Cj0901, probable amino acid FT ABC tansporter permease protein, len: 247 aa; similar to FT many e.g. YQIY_BACSU probable amino-acid ABC transporter FT permease protein (219 aa), fasta scores; opt: 552 z-score: FT 683.2 E(): 9.3e-31, 43.6% identity in 204 aa overlap. 28.6% FT identity to HP0939. Contains PS00402 FT Binding-protein-dependent transport systems inner membrane FT comp signature, and Pfam match to entry PF00528 BPD_transp, FT Binding-protein-dependent transport systems inner membrane FT component" FT /note="Updated (2006) note: Four probable transmembrane FT helices predicted by TMHMM2.0. Further support given to FT product function. No specific characterisation with FT acceptable identity score carried out yet. Putative kept FT within product function. Functional classification FT -Transport/binding proteins - Amino acids and amines" FT /db_xref="GOA:Q0P9Z7" FT /db_xref="InterPro:IPR000515" FT /db_xref="InterPro:IPR001991" FT /db_xref="InterPro:IPR010065" FT /db_xref="UniProtKB/TrEMBL:Q0P9Z7" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00528" FT /inference="protein motif:Prosite:PS00402" FT /protein_id="CAL35022.1" FT /translation="MNQKNIRIFVFFVIIILWGYFSFPIEILKIQDPSGVASYGYTENA FT KAYLKSYLITLLLTACAVIIGVIIGFSLAILRFSKFKTLNFIIDEYIDIIRGTPVILQL FT MIFAFVIFTFIDNLYAAILALGLNSSAYIAEIVRSGINSVDKGQMEAARAMGLDYKTSM FT KEIILPQATKNILPALANEFISLFKETSVVGFISVIDITMQSQSLQAVLYNPKPIIFTG FT LVYYVSVKIFSYFAKKLELRMNKND" FT misc_feature order(840775..840843,840922..840990,841060..841128, FT 841411..841470) FT /note="4 probable transmembrane helices predicted for FT Cj0901 by TMHMM2.0 at aa 5-27, 54-76, 100-122 and 217-236" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 840904..841497 FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 2.6e-34" FT /inference="protein motif:Pfam:PF00528" FT misc_feature 840913..840945 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature 841183..841269 FT /note="PS00402 Binding-protein-dependent transport systems FT inner membrane comp. sign" FT /inference="protein motif:Prosite:PS00402" FT CDS 841499..842227 FT /transl_table=11 FT /gene="glnQ" FT /locus_tag="Cj0902" FT /product="putative glutamine transport ATP-binding protein" FT /note="Original (2000) note: Cj0902, glnQ, probable FT glutamine transport ATP-binding protein, len: 247 aa; FT highly similar to e.g. GLNQ_BACST glutamine transport FT ATP-binding protein (242 aa), fasta scores; opt: 940 FT z-score: 1074.4 E(): 0, 56.2% identity in 242 aa overlap. FT No Hp ortholog. Also similar to Cj0469 (52.9% identity in FT 238 aa overlap). Contains S00017 ATP/GTP-binding site motif FT A (P-loop), S00211 ABC transporters family signature, and FT Pfam match to entry PF00005 ABC_tran, ABC transporters" FT /note="Updated (2006) note: Characterised in Bacillus FT stearothermophilus with acceptable identity score. Putative FT kept within product function as not sure whether exact FT substrate is used in Campylobacter jejuni. Functional FT classification - Transport/binding proteins -Amino acids FT and amines" FT /note="PMID:1856180" FT /db_xref="GOA:Q0P9Z6" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/TrEMBL:Q0P9Z6" FT /inference="protein motif:Pfam:PF00005" FT /protein_id="CAL35023.1" FT /translation="MIEVKNLQKKYGELEVLKNINTTISKGDVIAIIGPSGGGKSTFLR FT CINRLELADSGEILINKQNILDKEIDINKIRQKVSMVFQHFNLFANKNVMENLCLTPIK FT TGILSQEEAIKKAKLLLAKVGLADKENIMPHKLSGGQKQRIAIARSLMMNPDVILFDEP FT TSALDPEMIGEVLSIMKDVAKEGLTMLVVTHEMGFARNVANRIFFMDKGKIAVDASPKE FT VFENPSNERLREFLNKVLNH" FT misc_feature 841577..842134 FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 2.6e-56" FT /inference="protein motif:Pfam:PF00005" FT misc_feature 841598..841621 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT misc_feature 841907..841951 FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT CDS complement(842255..843721) FT /transl_table=11 FT /locus_tag="Cj0903c" FT /product="putative amino-acid transport protein" FT /note="Original (2000) note: Cj0903c, probable amino-acid FT transport protein, len: 488 aa; simlar to many hypothetical FT membaer of the sodium:alanine symporter family e.g. FT ALST_BACSU amino acid carrier protein ALST (465 aa), fasta FT scores; opt: 821 z-score: 946.6 E(): 0,41.9% identity in FT 473 aa overlap. 33.6% identity to HP0942. Contains PS00873 FT Sodium:alanine symporter family signature, and Pfam match FT to entry PF01235 Na_Ala_symp,Sodium:alanine symporter FT family" FT /note="Updated (2006) note: Nine probable transmembrane FT helices predicted for TMHMM2.0. Further support given to FT product function. No specfic characterisation with FT acceptable identity score carried out yet. Putative kept FT within product function along with amino-acid designation FT as not sure whether exact substrate is used in FT Campylobacter jejuni. Literature search identified paper FT giving further clues about product function. Functional FT classification - Transport/binding proteins - Amino acids FT and amines" FT /note="PMID:15066034" FT /db_xref="GOA:Q0P9Z5" FT /db_xref="InterPro:IPR001463" FT /db_xref="UniProtKB/TrEMBL:Q0P9Z5" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF01235" FT /inference="protein motif:Prosite:PS00873" FT /protein_id="CAL35024.1" FT /translation="MNLDIMLDFANKASDIIANKIVPNTDIIMVVLLIVCGLYYSFLTR FT FVQFRMLSSVFKILTEKNEGHAKEHISPFQALMISTASRVGIGNIAGISLALATGGAGA FT LFWMWVMAFFGGASAFAESTLAQVYKSKDDTGGFKGGPAYYIKKALGSHFFGAFFAFIL FT IITYAYGFNGLQSQTMTSSFKVYYDMFNPNAAVDFASSSWPMIIGIVLTIFGAWMFFSH FT HTKIGKISSLIVPFMALAYVLLAVIAVLMNFDKIPSVIHMILQSAFDFKAIFGGFAGSA FT LVIGIKRGLFSNEAGMGSAPNAAAAALTSHPAKQGVIQAFSVLIDVVVCTSSGFLVLFS FT MAYLGLGENKIDGGMPLVQEAMREYYGSFGIHFITIAIVLFAITSLIGNYYYAQANVKY FT LTNSKFVMNLFRITAVAMIFIGSQMNLKLAWNLADLTMAFMATTNIISLLLLGGIVNKV FT LKDFNTQQKSGIDPKFNASKLGIKNAECWD" FT misc_feature complement(842285..843556) FT /note="HMMPfam hit to PF01235, Sodium:alanine symporter FT family, score 4.2e-138" FT /inference="protein motif:Pfam:PF01235" FT misc_feature complement(join(843575..843643,843401..843469, FT 843209..843277,843059..843127,842963..843031, FT 842687..842755,842543..842611,842456..842509, FT 842345..842413)) FT /note="9 probable transmembrane helices predicted for FT Cj0903c by TMHMM2.0 at aa 27-49, 85-107, 149-171, FT 199-221,231-253, 323-345, 371-393, 405-422 and 437-459" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(843377..843424) FT /note="PS00873 Sodium:alanine symporter family signature" FT /inference="protein motif:Prosite:PS00873" FT CDS complement(843825..844292) FT /transl_table=11 FT /locus_tag="Cj0904c" FT /product="putative RNA methylase" FT /note="Original (2000) note: Cj0904c, probable RNA FT methylase, len: 155 aa; similar to members of the spoU FT family e.g. YIBK_ECOLI (157 aa), fasta scores; opt: 373 FT z-score: 490.5 E(): 5e-20, 43.3% identity in 150 aa FT overlap. No Hp match. Contains Pfam match to entry PF00588 FT SpoU_methylase, SpoU rRNA Methylase family" FT /note="Updated (2006) note: Putative kept within product FT function, as full characterisation has not been carried FT out. Functional classification - RNA synthesis, RNA FT modification and DNA transcription" FT /db_xref="GOA:Q0P9Z4" FT /db_xref="InterPro:IPR001537" FT /db_xref="InterPro:IPR016914" FT /db_xref="UniProtKB/TrEMBL:Q0P9Z4" FT /inference="protein motif:Pfam:PF00588" FT /protein_id="CAL35025.1" FT /translation="MFNIVLVHPRIPQNTGSIGRMCFNAGFKLHIVKPIVFDISQKAVR FT RAGLDYWDKLEPIIWENLEEFLNENMIYKNRFFFATTKSQKAYFDAEFQKNDFLFFGSE FT SYGLPMELMQLNWENAITIPMKSYGRSLNLATSVGIISYEALRQNFRNFAS" FT misc_feature complement(843864..844292) FT /note="HMMPfam hit to PF00588, SpoU rRNA Methylase FT family,score 9.5e-32" FT /inference="protein motif:Pfam:PF00588" FT CDS complement(844295..845281) FT /transl_table=11 FT /gene="alr" FT /locus_tag="Cj0905c" FT /product="alanine racemase" FT /EC_number="5.1.1.1" FT /note="Original (2000) note: Cj0905c, alr, probable alanine FT racemase, len: 328 aa; similar to e.g. TR:O85045 FT (EMBL:AF038438) Listeria monocytogenes alanine racemase (EC FT 5.1.1.1) (368 aa), fasta scores; opt: 233 z-score: 286.6 FT E(): 1.2e-08, 32.6% identity in 359 aa overlap, and FT ALR1_ECOLI alanine racemase, biosynthetic (EC 5.1.1.1) (359 FT aa), fasta scores; opt: 193 z-score: 238.5 E(): 5.5e-06, FT 25.6% identity in 324 aa overlap. 28.6% identity to HP0941. FT Contains Pfam match to entry PF00842 Ala_racemase, Alanine FT racemase" FT /note="Updated (2006) note: Characterised in Bacillus FT stearothermophilus and others with marginal identity FT scores. Appropriate motifs present. Putative not added to FT product function. Functional classification - Murein FT sacculus and peptidoglycan" FT /note="PMID:9063881, PMID:2835089" FT /db_xref="GOA:Q9PP26" FT /db_xref="InterPro:IPR000821" FT /db_xref="InterPro:IPR001608" FT /db_xref="InterPro:IPR009006" FT /db_xref="InterPro:IPR011079" FT /db_xref="InterPro:IPR020622" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP26" FT /inference="protein motif:Pfam:PF00842" FT /protein_id="CAL35026.1" FT /translation="MSLIKIDQKAYEYNLRHIAKKIGSFQRLICVFKDNAYGHGAKLLA FT PLAKNLGVSFVAVKSEEEAREIEEFFENILILSHRPHGNENSRFIYALNDISQVKNYKQ FT DIKIHLKIDTGMHRNGICVENLEHAINLIQGSDLKLTGMFTHFASADEMDGSFFVQKEN FT FQKAKKIVKKYFSNLLFHSYNSAALFRGKIPEDEYCRVGLVQFGYGDSNLKRVLSLYAH FT RLSQRILQKGQSIGYGGIFTAAKDMEVATYDLGYADGLFRYNGRGELVLGNGKAMLGKM FT SMDSFSCENSGEEICVFKDADIWADFFHTINYEILVKLNPNIQRVLV" FT misc_feature complement(844298..844636) FT /note="HMMPfam hit to PF00842, Alanine racemase,C-terminal FT domain, score 6.9e-39" FT /inference="protein motif:Pfam:PF00842" FT misc_feature complement(844649..845281) FT /note="HMMPfam hit to PF01168, Alanine racemase,N-terminal FT domain, score 6.2e-57" FT /inference="protein motif:Pfam:PF01168" FT CDS complement(845282..846259) FT /transl_table=11 FT /locus_tag="Cj0906c" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0906c, probable periplasmic FT protein, len: 325 aa; similar to hypothetical proteins e.g. FT TR:O66569 (EMBL:AE000677) Aquifex aeolicus AQ_183 (397 aa), FT fasta scores; opt: 380 z-score: 432.9 E(): 8.2e-17, 31.1% FT identity in 270 aa overlap. 36.6% identity to HP0518. FT Contains probable N-terminal signal sequence" FT /note="Updated (2006) note: Paper identified linking FT protein to glycoprotein. Functional classification FT -Miscellaneous periplasmic proteins" FT /note="PMID:12186869" FT /db_xref="GOA:Q0P9Z2" FT /db_xref="InterPro:IPR005490" FT /db_xref="UniProtKB/TrEMBL:Q0P9Z2" FT /protein_id="CAL35027.1" FT /translation="MLKRLALLIALSSLMLHASDLVKIYLNQGLDAVGVAIEKELTQKD FT FWLSEIGDKNISLGYYDDNVAIVLTNKTDKILRVYSYEDGKIRKDFEQKEIITGLMGDK FT KIEGDLKTPVGFYELGRKFNPGDPYYGPFAFATTYPNLLDKVQGKTGGGIWIHGYPLDG FT SRLDEFKTRGCIALFNNNLEKFAKVVQDKKVFVMTEEKEKIRAKKDQIASLLADLFTWK FT LAWTNSDTNAYLSFYDEQEFKRFDKMKFEQFASMKKSIFSRKEDKKIKFSDINISPYPN FT LENETMYRISFYEDYYTKNYRFRGDKILYVKIDSKGKMKILAEQ" FT sig_peptide complement(846206..846259) FT /note="Signal peptide predicted for FT signalp2embl_unknown_000426_845282_846259 by SignalP 2.0 FT HMM (Signal peptide probability 0.971) with cleavage site FT probability 0.926 between residues 18 and 19" FT CDS 846415..846885 FT /transl_table=11 FT /locus_tag="Cj0908" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0908, probable periplasmic FT protein, len: 156 aa; no Hp match. Contains probable FT N-terminal signal sequence. Similar to downstream gene FT Cj0910 (41.3% identity in 143 aa overlap). Functional FT classification - Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0P9Z1" FT /protein_id="CAL35028.1" FT /translation="MIRNFFIGMSFLGILFLAFYTLYDKKKESIFSLNTCQPLTCDLNL FT QDCVFSFNKKNIEVSAYPKPIKIFNKTTIKIKNFPHYSNLKIKIYSLNSYIGDIIPKFN FT IVNGDILINFIGRSITDDSRFRVEFLNNNAPTGFFFDFDVTMQKNFQTGNTH" FT sig_peptide 846415..846492 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000427_846415_846885 by SignalP 2.0 FT HMM (Signal peptide probability 0.661) with cleavage site FT probability 0.480 between residues 26 and 27" FT misc_feature 846427..846483 FT /note="1 probable transmembrane helix predicted for Cj0908 FT by TMHMM2.0 at aa 5-23" FT /inference="protein motif:TMHMM:2.0" FT CDS 846971..847390 FT /transl_table=11 FT /locus_tag="Cj0909" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0909, probable periplasmic FT protein, len: 139 aa; similar to TR:O67294 (EMBL:AE000731) FT Aquifex aeolicus AQ_1253 (151 aa), fasta scores; opt: 208 FT z-score: 273.4 E(): 6.3e-08, 34.3% identity in 134 aa FT overlap. No Hp match. Contains probable N-terminal signal FT sequence" FT /note="Updated (2006) note: Pfam domain PF04314 Protein of FT unknown function (DUF461) identified within CDS. This Pfam FT is linked to being a putative membrane or periplasmic FT protein. Functional classification - Miscellaneous FT periplasmic proteins" FT /db_xref="InterPro:IPR007410" FT /db_xref="UniProtKB/TrEMBL:Q0P9Z0" FT /inference="protein motif:Pfam:PF04314" FT /protein_id="CAL35029.1" FT /translation="MKKILLLGALFAVNLWAVNDIEVKNAFVKQTPPHAQNSAIFLTIF FT NNTNKDIALISAKSDISEVSELHTHIHKDGKMMMQKIPEIIIKAHSSTELKSGGYHIML FT LKLKKPIIKDTKVNLDLKFNNHKTIELKNIDSKEF" FT sig_peptide 846971..847021 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000428_846971_847390 by SignalP 2.0 FT HMM (Signal peptide probability 0.939) with cleavage site FT probability 0.359 between residues 17 and 18" FT misc_feature 847037..847384 FT /note="HMMPfam hit to PF04314, Protein of unknown function FT (DUF461), score 1.3e-62" FT /inference="protein motif:Pfam:PF04314" FT CDS 847394..847846 FT /transl_table=11 FT /locus_tag="Cj0910" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0910, probable periplasmic FT protein, len: 150 aa; no Hp match. Contains probable FT N-terminal signal sequence. Similar to downstream gene FT Cj0908 (41.3% identity in 145 aa overlap). Functional FT classification - Miscellaneous periplasmic proteins" FT /db_xref="UniProtKB/TrEMBL:Q0P9Y9" FT /protein_id="CAL35030.1" FT /translation="MRKIIFILAFAFVIAILYIIFDFYVIKDSQKITKTDFSTPLTCDL FT NVKDCTYSFNNKKVLISLNPKPLQSLDVTNLKIVNLGNYNNLGIKIYGLNMYMGEIKPK FT IHRLNSTDYESKIVLAACVLDTMRFRVEFMDNNKPIGFYFDFELKK" FT sig_peptide 847394..847486 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000429_847394_847846 by SignalP 2.0 FT HMM (Signal peptide probability 0.680) with cleavage site FT probability 0.422 between residues 31 and 32" FT misc_feature 847403..847471 FT /note="1 probable transmembrane helix predicted for Cj0910 FT by TMHMM2.0 at aa 4-26" FT /inference="protein motif:TMHMM:2.0" FT CDS 847843..848403 FT /transl_table=11 FT /locus_tag="Cj0911" FT /product="putative periplasmic protein" FT /note="Original (2000) note: Cj0911, probable periplasmic FT protein, len: 186 aa; similar to bacterial hypotheticals FT e.g. TR:O67113 (EMBL:AE000717) Aquifex aeolicus AQ_988 (197 FT aa), fasta scores; opt: 260 z-score: 314.1 E(): 3.4e-10, FT 28.1% identity in 167 aa overlap, and to N-terminus of FT eukaryotic proteins e.g. SCO1_YEAST SCO1 protein precursor FT (295 aa), opt: 213 z-score: 257.2 E(): 5e-07, 32.1% FT identity in 137 aa overlap. No Hp match. Contains probable FT N-terminal signal sequence" FT /note="Updated (2006) note: Pfam domain PF02630 SCO1/SenC FT identified within CDS. Characterization has been carried FT out in Rhodobacter capsulatus, however, identity scores was FT unnacceptable. Putative kept in product function. FT Functional classification - Miscellaneous periplasmic FT proteins" FT /note="PMID:7592491" FT /db_xref="InterPro:IPR003782" FT /db_xref="InterPro:IPR012336" FT /db_xref="UniProtKB/TrEMBL:Q0P9Y8" FT /inference="protein motif:Pfam:PF02630" FT /protein_id="CAL35031.1" FT /translation="MKKNIILFIVIVAIILGVIFFIKNHQNSYDFILKSDLKEETTLKD FT FKGDKLIIYFGYTYCPDVCPATLSLVGKALKQINNPKAHLLFISLDPNRDNNLSNTNEW FT LRYFYPKADALIAKDEKTLQKITKQYNVQYQKIDLNDSFMGYSIAHSNMLYLIDEKGHF FT YKEINDLNPQEILRELRIFLNSQ" FT sig_peptide 847843..847920 FT /note="Signal peptide predicted for FT signalp2embl_unknown_000430_847843_848403 by SignalP 2.0 FT HMM (Signal peptide probability 0.854) with cleavage site FT probability 0.336 between residues 26 and 27" FT misc_feature 847855..847908 FT /note="1 probable transmembrane helix predicted for Cj0911 FT by TMHMM2.0 at aa 5-22" FT /inference="protein motif:TMHMM:2.0" FT misc_feature 847858..848352 FT /note="HMMPfam hit to PF02630, SCO1/SenC, score 2.3e-09" FT /inference="protein motif:Pfam:PF02630" FT CDS complement(848410..849309) FT /transl_table=11 FT /gene="cysM" FT /locus_tag="Cj0912c" FT /product="cysteine synthase" FT /EC_number="2.5.1.47" FT /note="Original (2000) note: Cj0912c, cysM, cysteine FT synthase, len: 299 aa; 98.7% identical to CYSM_CAMJE FT cysteine synthase B (EC 4.2.99.8) (299 aa), and similar to FT many e.g. CYSK_BACSU CYSTEINE SYNTHASE (EC 4.2.99.8) (307 FT aa), fasta scores; opt: 907 z-score: 1020.2 E(): 0, 48.5% FT identity in 305 aa overlap. 38.9% identity to HP0107. FT Contains PS00165 Serine/threonine dehydratases FT pyridoxal-phosphate attachment site, PS00901 Cysteine FT synthase/cystathionine beta-synthase P-phosphate attachment FT site, and Pfam match to entry PF00291 S_T_dehydratase, FT Pyridoxal-phosphate dependant enzymes" FT /note="Updated (2006) note: Characterised in Campylobacter FT jejuni, so putative not added to product function. FT Functional classification - Amino acid biosynthesis -Serine FT family" FT /note="PMID:9034314" FT /db_xref="GOA:P71128" FT /db_xref="InterPro:IPR000634" FT /db_xref="InterPro:IPR001216" FT /db_xref="InterPro:IPR001926" FT /db_xref="InterPro:IPR005856" FT /db_xref="InterPro:IPR005859" FT /db_xref="UniProtKB/Swiss-Prot:P71128" FT /inference="protein motif:Pfam:PF00291" FT /inference="protein motif:Prosite:PS00901" FT /inference="protein motif:Prosite:PS00165" FT /protein_id="CAL35032.1" FT /translation="MKVHEKVSELIGNTPIIHLKKFGINVFAKCEFLNPSHSIKDRAAF FT EMIKDALDSKKINQDTTIVEATSGNTGISLAMICADLGLKFIAVMPESMSLERRKMITL FT FGARLELTPANLGMKGAVDKANEILLNTPNSFMVSQFENISNKNAHRKNTALEILRDLD FT NELDIFVAGFGTGGTISGVGEILKEKLEKVHIVGVEPLNSPLLSKGEAGSHKIQGIGAN FT FIPAILNKEVIDEVITVSNEDAINTAKELAKSGLMVGISSGANVFAASMLAKKFPDKRI FT LTMLNDTAERYLSTDLFA" FT misc_feature complement(848446..849291) FT /note="HMMPfam hit to PF00291, Pyridoxal-phosphate FT dependent enzyme, score 2.3e-116" FT /inference="protein motif:Pfam:PF00291" FT misc_feature complement(849169..849225) FT /note="PS00901 Cysteine synthase/cystathionine FT beta-synthase P-phosphate attachment site" FT /inference="protein motif:Prosite:PS00901" FT misc_feature complement(849178..849219) FT /note="PS00165 Serine/threonine dehydratases FT pyridoxal-phosphate attachment site" FT /inference="protein motif:Prosite:PS00165" FT CDS complement(849436..849732) FT /transl_table=11 FT /gene="hupB" FT /locus_tag="Cj0913c" FT /product="DNA-binding protein HU homolog" FT /note="Original (2000) note: Cj0913c, hupB, DNA-binding FT protein HU homolog, len: 98 aa; identical to TR:Q46121 FT (EMBL:L25627) DNA-binding protein HU homolog (98 aa), and FT highly similar to many e.g. DBHB_ECOLI DNA-binding protein FT HU-beta (90 aa), fasta scores; opt: 272 z-score: 356.7 E(): FT 1.4e-12, 44.9% identity in 89 aa overlap. 42.2% identity to FT HP0835. Contains Pfam match to entry PF00216 FT Bac_DNA_binding, Bacterial DNA-binding protein" FT /note="Updated (2006) note: Characterised in Campylobacter FT jejuni and many others. Putative not added to product FT function. Functional classification - Synthesis and FT modification of macromolecules - Nucleoproteins" FT /note="PMID:8063109" FT /db_xref="GOA:Q46121" FT /db_xref="InterPro:IPR000119" FT /db_xref="InterPro:IPR010992" FT /db_xref="InterPro:IPR023630" FT /db_xref="UniProtKB/Swiss-Prot:Q46121" FT /inference="protein motif:Pfam:PF00216" FT /protein_id="CAL35033.1" FT /translation="MTKADFISLVAQTAGLTKKDATTATDAVISTITDVLAKGDSISFI FT GFGTFSTQERAAREARVPSTGKTIKVPATRVAKFKVGKNLKEAVAKASGKKKK" FT misc_feature complement(849463..849732) FT /note="HMMPfam hit to PF00216, Bacterial DNA-binding FT protein, score 1.9e-42" FT /inference="protein motif:Pfam:PF00216" FT CDS complement(849834..851666) FT /transl_table=11 FT /gene="ciaB" FT /locus_tag="Cj0914c" FT /product="CiaB protein" FT /note="Original (2000) note: Cj0914c, ciaB, unknown FT function, len: 610 aa; no Hp match. Product is translocated FT into host cells. Mutants fail to translocate,and fail to FT translocate other proteins. Contains PS00142 Neutral zinc FT metallopeptidases, zinc-binding region signature" FT /note="Updated (2006) note: Papers attached giving further FT information regarding this CDS. Functional classification - FT Pathogenicity" FT /note="PMID:10361274, PMID:10540297, FT PMID:10659361,PMID:15722140" FT /db_xref="UniProtKB/TrEMBL:Q0P9Y5" FT /inference="protein motif:Prosite:PS00142" FT /protein_id="CAL35034.1" FT /translation="MNNFKEIAKLVRKYKERNNALYEFLDKEDVGEYFRSLISLSELKQ FT DKTTMLAILRRLIDLKEENLVQEWKKNNFKEDKIIELKHKFYEEVRKFYEKEHQNLINE FT IKEKKLLNNFYQSLIQGVHNIGLIMNIFEISWTKEIIEKNNKILSTQFPNLDDAMEFLR FT KNHLYQKTPEGEICERSYGVLVRIGNLWKFVPYARFFENEILKLEFAFENMIDQLKIFA FT SSEEEKAYIEYFEKLKLAFCEKDEDRVIKAWQEAEFAWMKVKSPLQVGHPLEYYEDNYT FT HAVALEWDIRIEDENDFDVLKFGNEIKESFEHVYKNIGLEDCELEKEVLSNIEKTQLYI FT CTPMIFYGAELKGLFSAQVVPNDEFVSSKAGKKIFAFINFVYENAKTKPFMKISSEVFD FT KEFLDFGRNILFYQEKIWKRVYEVSTIGHEFGHIFFIANDTEKTMNQSGFFKNIEEYKA FT TTGGLINFFYHEQDDLIMPVFHELIKRAIGLISWQRVDEVRPYYTEGLIHLSLLFESEV FT LIFENNNLKINFDLGYYEKFKELTLKNYHELAKHYALRLDAKEFLSRFCEIEDNIFLPI FT MPKCKEFVKFYYDLYEKIGNEIDNSGEFERYKKK" FT misc_feature complement(850365..850394) FT /note="PS00142 Neutral zinc metallopeptidases,zinc-binding FT region signature" FT /inference="protein motif:Prosite:PS00142" FT CDS 851728..852141 FT /transl_table=11 FT /locus_tag="Cj0915" FT /product="putative hydrolase" FT /note="Original (2000) note: Cj0915, possible FT hydrolase,len: 137 aa; similar to prokaryotic hypotheticals FT e.g. YCIA_ECOLI (132 aa), fasta scores; opt: 351 z-score: FT 440.7 E(): 3e-17, 41.5% identity in 123 aa overlap, and to FT eukaryotic acyl-CoA hydrolases e.g. THCC_HUMAN cytosolic FT acyl coenzyme A thioester hydrolase (372 aa), fasta scores; FT opt: 174 z-score: 220.2 E(): 5.7e-05, 31.6% identity in 114 FT aa overlap. 25.4% identity to HP0891 (VDLD_HELPY)" FT /note="Updated (2006) note: Pfam domain PF03061 FT Thioesterase superfamily identified within CDS. No specific FT characterisation with acceptable identity score has been FT carried out yet. Putative kept within product function. FT Functional classification - Misc" FT /note="PMID:12426338" FT /db_xref="GOA:Q0P9Y4" FT /db_xref="InterPro:IPR006683" FT /db_xref="PDB:3D6L" FT /db_xref="UniProtKB/TrEMBL:Q0P9Y4" FT /inference="protein motif:Pfam:PF03061" FT /protein_id="CAL35035.1" FT /translation="MRDMGEPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIAARELS FT PERVVTISMDKVVFKEPVFIGDIISCYSKVVNVGNTSISVEVEVTAQRVDSQGCTSCIN FT VTSALVTYVSVTRDGKKNPISEELKRIHGFLNA" FT misc_feature 851788..852021 FT /note="HMMPfam hit to PF03061, Thioesterase FT superfamily,score 7.8e-17" FT /inference="protein motif:Pfam:PF03061" FT CDS complement(852181..852378) FT /transl_table=11 FT /locus_tag="Cj0916c" FT /product="conserved hypothetical protein Cj0916c" FT /note="Original (2000) note: Cj0916c, unknown, len: 65 aa; FT similar to two hypothetical E. coli proteins; YBDD_ECOLI FT (65 aa), fasta scores; opt: 154 z-score: 227.0 E(): FT 2.5e-05, 41.3% identity in 46 aa overlap, and YJIX_ECOLI FT (67 aa), fasta scores; opt: 141 z-score: 209.5 E(): FT 0.00023, 35.8% identity in 67 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domain PF04328 Protein of FT unknown function (DUF466) identified within CDS. Conserved FT added to product function. Functional classification FT -Conserved hypothetical proteins" FT /db_xref="InterPro:IPR007423" FT /db_xref="UniProtKB/TrEMBL:Q0P9Y3" FT /inference="protein motif:Pfam:PF04328" FT /protein_id="CAL35036.1" FT /translation="MNFKKFKYYYEKAERFFHPLVGLSSYDKYLEHMKQKHPGKIPKTR FT GEFFKECLDKKYNSGGLNKC" FT misc_feature complement(852184..852378) FT /note="HMMPfam hit to PF04328, Protein of unknown function FT (DUF466), score 1.2e-39" FT /inference="protein motif:Pfam:PF04328" FT CDS complement(852359..854470) FT /transl_table=11 FT /gene="cstA" FT /locus_tag="Cj0917c" FT /product="putative integral membrane protein (CstA FT homolog)" FT /note="Original (2000) note: Cj0917c, cstA, integral FT membrane protein, homolog of carbon starvation protein FT A,len: 703 aa; highly similar to e.g. CSTA_ECOLI carbon FT starvation protein A (701 aa), fasta scores; opt: 2523 FT z-score: 2823.2 E(): 0, 56.0% identity in 707 aa overlap. FT 65.6% identity to HP1168" FT /note="Updated (2006) note: Pfam domain PF02554 Carbon FT starvation protein CstA identified within CDS. Further FT support given to product function. Characterised within FT Escherichia coli with acceptable identity score. Putative FT not added to product function. Functional classification FT -Membranes, lipoproteins and porins" FT /note="PMID:1848300" FT /db_xref="GOA:Q0P9Y2" FT /db_xref="InterPro:IPR003706" FT /db_xref="UniProtKB/TrEMBL:Q0P9Y2" FT /inference="protein motif:Pfam:PF02554" FT /protein_id="CAL35037.1" FT /translation="MTQLSTKILWLFVAALGAICFGYLALQNGESVSAIYLVVAAVCIY FT MIGYRFYGSFVAYKVLELDKNRATPALVENDGRDFVPTNKAVLFGHHFAAIAGAGPLVG FT PILAAQMGYLPSMLWILVGGVLAGAVHDFVVLFISTRRKGRSLGEMIKDEMGKFTGGVA FT MVAIFGIMLIIIAILAMVVVKALAESPWGLFTIAMTIPIAIFMGIYMRFIRPGRVGEAS FT IIGFVLLILAIHYGSVIAADPYWAKIFTLEAPTLAIVMMAYGFIASVLPVWFLLAPRDY FT LSTFLKIGVIVVMAVAIVLVAPDLQMPKANTQYFDGTGPVFAGGVFPFLFITIACGAIS FT GFHALISSGTTPKMLENETHTLAVGYGSMLAESAVAIMALICACILHPGLYFAINSSSA FT LIGTDVVNVAQTISSWGFSITPEEITTLTTNIGEYTILSRTGGAPTFAIGVALILHELF FT GGVDLMAFWYHFAILFEALFILTAVDAGTRACRFMVQDILGNVYKPLGDIHNYPAGLLA FT TALSVAGWGYFLYQGAIDPKGGIYTLWPLFGVSNQMLAGMALLLATTILVKMGKARYTW FT VTLVPAVFVLVATLYGGIQKIMPYEEGNKIANAVSHVAAVSIQSQKIKDLEFKLNNTKD FT EKEISTIRKEISIATQNKVGNLLNAILCVFFMIATLLVIISCIGICLGKIKIPLKETKY FT IKIDEFQKI" FT misc_feature complement(join(854393..854452,854297..854365, FT 854144..854212,854057..854116,853928..853996, FT 853832..853900,853751..853819,853640..853708, FT 853553..853621,853442..853510,853313..853381, FT 853010..853078,852881..852949,852785..852853, FT 852689..852748,852422..852490)) FT /note="16 probable transmembrane helices predicted for FT Cj0917c by TMHMM2.0 at aa 7-26, 36-58, 87-109, FT 119-138,159-181, 191-213, 218-240, 255-277, 284-306, FT 321-343,364-386, 465-487, 508-530, 540-562, 575-594 and FT 661-683" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(852440..852472) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature complement(853175..854377) FT /note="HMMPfam hit to PF02554, Carbon starvation protein FT CstA, score 3.2e-248" FT /inference="protein motif:Pfam:PF02554" FT misc_feature complement(853319..853351) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT misc_feature complement(853463..853495) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT sig_peptide complement(854369..854470) FT /note="Signal peptide predicted for cstA by SignalP 2.0 HMM FT (Signal peptide probability 0.990) with cleavage site FT probability 0.617 between residues 34 and 35" FT CDS complement(854637..855566) FT /transl_table=11 FT /gene="prsA" FT /locus_tag="Cj0918c" FT /product="ribose-phosphate pyrophosphokinase" FT /EC_number="2.7.6.1" FT /note="Original (2000) note: Cj0918c, prsA, probable FT ribose-phosphate pyrophosphokinase, len: 309 aa; highly FT similar to many e.g. KPRS_ECOLI ribose-phosphate FT pyrophosphokinase (EC 2.7.6.1) (314 aa), fasta scores; opt: FT 1167 z-score: 1345.2 E(): 0, 57.1% identity in 310 aa FT overlap. 71.4% identity to HP0742. Contains PS00114 FT Phosphoribosyl pyrophosphate synthetase signature, PS00103 FT Purine/pyrimidine phosphoribosyl transferases signature,and FT Pfam match to entry PF00492 PRPP_synt, Phosphoribosyl FT pyrophosphate synthetase" FT /note="Updated (2006) note: Characterised in Escherichia FT coli with acceptable identity score, so putative not added FT to product function. Functional classification - Purine FT ribonucleotide biosynthesis" FT /note="PMID:2542328, PMID:16689801" FT /db_xref="GOA:Q9PP15" FT /db_xref="InterPro:IPR000836" FT /db_xref="InterPro:IPR000842" FT /db_xref="InterPro:IPR005946" FT /db_xref="UniProtKB/Swiss-Prot:Q9PP15" FT /inference="protein motif:Pfam:PF00492" FT /inference="protein motif:Prosite:PS00103" FT /inference="protein motif:Prosite:PS00114" FT /protein_id="CAL35038.1" FT /translation="MRGYKIFSGSANVEFARQVSKYLSLPLSDAGVKRFSDGEISVQID FT ESVRGKDVFIIQSTCAPTNDNLMELLILTDALRRSSANSITAIIPYFGYARQDRKANPR FT VPITAKLVANLIQAAGIDRVATIDLHAGQIQGFFDIPVDNLYGSIVFNDYIKAKHFKNA FT IIGSPDIGGVARARSVAKHLGLDIVIVDKRREKANESEVMNIIGDVKDKEVILVDDIID FT TAGTIVKAAEALKEKGAKSVMACCTHAVLSGKAYERIASGVLDELVVTDTIPLKEQLPN FT IKVLSVTPVFAEVIRRVYHNESVNSLFI" FT misc_feature complement(854760..855152) FT /note="HMMPfam hit to PF00156, Phosphoribosyl transferase FT domain, score 2.6e-35" FT /inference="protein motif:Pfam:PF00156" FT misc_feature complement(854889..854927) FT /note="PS00103 Purine/pyrimidine phosphoribosyl FT transferases signature" FT /inference="protein motif:Prosite:PS00103" FT misc_feature complement(855138..855185) FT /note="PS00114 Phosphoribosyl pyrophosphate synthetase FT signature" FT /inference="protein motif:Prosite:PS00114" FT misc_feature complement(855186..855215) FT /note="PS00339 Aminoacyl-transfer RNA synthetases class-II FT signature 2" FT /inference="protein motif:Prosite:PS00339" FT CDS complement(855674..856333) FT /transl_table=11 FT /locus_tag="Cj0919c" FT /product="putative ABC-type amino-acid transporter permease FT protein" FT /note="Original (2000) note: Cj0919c, probable ABC-type FT amino-acid transporter permease protein, len: 219 aa; FT similar to many e.g. GLTK_ECOLI glutamate/aspartate FT transport system permease protein (224 aa), fasta scores; FT opt: 380 z-score: 457.9 E(): 3.3e-18, 32.6% identity in 221 FT aa overlap. No Hp ortholog. Contains PS00402 FT Binding-protein-dependent transport systems inner membrane FT comp sign., and Pfam match to entry PF00528 FT BPD_transp,Binding-protein-dependent transport systems FT inner membrane component" FT /note="Updated (2006) note: Three probable transmembrane FT helices predicted by TMHMM2.0. No specific characterisation FT with acceptable identity score carried out yet. Putative FT kept within product function. Functional classification - FT Transport/binding proteins - Amino acids and amines" FT /note="PMID:16689801" FT /db_xref="GOA:Q0P9Y0" FT /db_xref="InterPro:IPR000515" FT /db_xref="InterPro:IPR010065" FT /db_xref="UniProtKB/TrEMBL:Q0P9Y0" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00528" FT /inference="protein motif:Prosite:PS00402" FT /protein_id="CAL35039.1" FT /translation="MENVFNAQNIEFLMQGLFLTLKIALATCIISIVFGTFLAITKNYG FT DRLSKFLAACYIDIFRNTPLLLWMLAACFVLPVFFGQFPQAFWGTIGFSLYTSSVMAEI FT IRGGLNSIPKGQFEAAYSQGFGKFFTLFYIILPQTFRKIIPALLSQIVTTVKDTAYLAG FT LGIAELTYNSKTILAKLTSFEEILAMIGVVAGIYFIICFSLSMLVRYYAKKTAYIS" FT misc_feature complement(855683..856297) FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 7.4e-18" FT /inference="protein motif:Pfam:PF00528" FT misc_feature complement(join(856199..856267,856070..856138, FT 855710..855778)) FT /note="3 probable transmembrane helices predicted for FT Cj0919c by TMHMM2.0 at aa 23-45, 66-88 and 186-208" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(855923..856009) FT /note="PS00402 Binding-protein-dependent transport systems FT inner membrane comp. sign" FT /inference="protein motif:Prosite:PS00402" FT misc_feature complement(856115..856147) FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site" FT /inference="protein motif:Prosite:PS00013" FT CDS complement(856344..857096) FT /transl_table=11 FT /locus_tag="Cj0920c" FT /product="putative ABC-type amino-acid transporter permease FT protein" FT /note="Original (2000) note: Cj0920c, probable ABC-type FT amino-acid transporter permease protein, len: 250 aa; FT similar to many e.g. YCKA_BACSU probable amino-acid ABC FT transporter permease protein (226 aa), fasta scores; opt: FT 448 z-score: 560.9 E(): 6e-24, 32.0% identity in 219 aa FT overlap. No Hp ortholog. Contains PS00402 FT Binding-protein-dependent transport systems inner membrane FT comp sign., and Pfam match to entry PF00528 FT BPD_transp,Binding-protein-dependent transport systems FT inner membrane component" FT /note="Updated (2006) note: Three probable transmembrane FT helices predicted by TMHMM2.0. No specific characterisation FT has been carried out yet. Putative kept within product FT function. Functional classification -Transport/binding FT proteins - Amino acids and amines" FT /note="PMID:16689801" FT /db_xref="GOA:Q0P9X9" FT /db_xref="InterPro:IPR000515" FT /db_xref="InterPro:IPR010065" FT /db_xref="UniProtKB/TrEMBL:Q0P9X9" FT /inference="protein motif:TMHMM:2.0" FT /inference="protein motif:Pfam:PF00528" FT /inference="protein motif:Prosite:PS00402" FT /protein_id="CAL35040.1" FT /translation="MNESVGFVEHLRQILTSWGLYDENSISPFAVWKFLDALDNKDAFI FT NGFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELFQNVPLVIQIFFLF FT YALPVLGIRLDIFTIGVLGVGAYHGAYVSEVVRSGILAVPRGQFEASASQGFTYIQQMR FT YIIVPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSADSYAADYGNYAPAYIFAA FT VLYFIICYPLAYFAKAYENKLKKAHLTR" FT misc_feature complement(856362..856967) FT /note="HMMPfam hit to PF00528, Binding-protein-dependent FT transport syst, score 1.2e-24" FT /inference="protein motif:Pfam:PF00528" FT misc_feature complement(join(856890..856958,856761..856829, FT 856389..856457)) FT /note="3 probable transmembrane helices predicted for FT Cj0920c by TMHMM2.0 at aa 47-69, 90-112 and 214-236" FT /inference="protein motif:TMHMM:2.0" FT misc_feature complement(856593..856679) FT /note="PS00402 Binding-protein-dependent transport systems FT inner membrane comp. sign" FT /inference="protein motif:Prosite:PS00402" FT CDS complement(857098..857877) FT /transl_table=11 FT /gene="peb1A" FT /locus_tag="Cj0921c" FT /product="aspartate/glutamate-binding ABC transporter FT protein" FT /note="Original (2000) note: Cj0921c, peb1A, probable FT ABC-type amino-acid transporter periplasmic solute-binding FT protein, len: 259 aa; identical to PEB1_CAMJE, and similar FT to many e.g. GLNH_BACST glutamine-binding protein precursor FT (262 aa), fasta scores; opt: 499 z-score: 568.7 E(): FT 2.2e-24, 38.8% identity in 219 aa overlap. No Hp ortholog. FT Contains probable N-terminal signal sequence,PS01039 FT Bacterial extracellular solute-binding proteins,family 3 FT signature, and Pfam match to entry PF00497 SBP_bac_3, FT Bacterial extracellular solute-binding proteins, family 3" FT /note="Updated (2006) note: Characterised in Campylobacter FT jejuni. Product modified to more specific family member. FT Putative removed from product function. Functional FT classification - Transport/binding proteins - Amino acids FT and amines" FT /note="PMID:16689801" FT /db_xref="GOA:Q0P9X8" FT /db_xref="InterPro:IPR001638" FT /db_xref="InterPro:IPR018313" FT /db_xref="PDB:2V25" FT /db_xref="UniProtKB/Swiss-Prot:Q0P9X8" FT /inference="protein motif:Pfam:PF00497" FT /inference="protein motif:Prosite:PS01039" FT /protein_id="CAL35041.1" FT /translation="MVFRKSLLKLAVFALGACVAFSNANAAEGKLESIKSKGQLIVGVK FT NDVPHYALLDQATGEIKGFEVDVAKLLAKSILGDDKKIKLVAVNAKTRGPLLDNGSVDA FT VIATFTITPERKRIYNFSEPYYQDAIGLLVLKEKKYKSLADMKGANIGVAQAATTKKAI FT GEAAKKIGIDVKFSEFPDYPSIKAALDAKRVDAFSVDKSILLGYVDDKSEILPDSFEPQ FT SYGIVTKKDDPAFAKYVDDFVKEHKNEIDALAKKWGL" FT misc_feature complement(857101..857760) FT /note="HMMPfam hit to PF00497, Bacterial extracellular FT solute-binding prot, score 5.3e-41" FT /inference="protein motif:Pfam:PF00497" FT misc_feature complement(857650..857691) FT /note="PS01039 Bacterial extracellular solute-binding FT proteins, family 3 signature" FT /inference="protein motif:Prosite:PS01039" FT sig_peptide complement(857800..857877) FT /note="Signal peptide predicted for peb1A by SignalP 2.0 FT HMM (Signal peptide probability 1.000) with cleavage site FT probability 0.866 between residues 26 and 27" FT CDS complement(857899..858627) FT /transl_table=11 FT /gene="pebC" FT /locus_tag="Cj0922c" FT /product="ABC-type amino-acid transporter ATP-binding FT protein" FT /note="Original (2000) note: Cj0922c, pebC, probable FT ABC-type amino-acid transporter ATP-binding protein, len: FT 242 aa; 98.8% identical to PEBC_CAMJE, and similar to many FT e.g. GLNQ_BACST glutamine transport ATP-binding protein FT (242 aa), fasta scores; opt: 1013 z-score: 1161.8 E(): FT 0,64.6% identity in 243 aa overlap. No Hp ortholog. FT Contains PS00211 ABC transporters family signature, PS00017 FT ATP/GTP-binding site motif A (P-loop), and Pfam match to FT entry PF00005 ABC_tran, ABC transporters" FT /note="Updated (2006) note: Characterised within FT Campylobacter jejuni. Putative not added to product FT function. Functional classification - Transport/binding FT proteins - Amino acids and amines" FT /note="PMID:16689801" FT /db_xref="GOA:Q0P9X7" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR017871" FT /db_xref="UniProtKB/Swiss-Prot:Q0P9X7" FT /inference="protein motif:Pfam:PF00005" FT /inference="protein motif:Prosite:PS00017" FT /inference="protein motif:Prosite:PS00211" FT /protein_id="CAL35042.1" FT /translation="MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIR FT CMNGLEEVSSGEVVVNNLVLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKL FT QKKSKKEAEETAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPT FT SALDPETIQEVLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSE FT FFSNPKTERARLFLGKILKN" FT misc_feature complement(857992..858549) FT /note="HMMPfam hit to PF00005, ABC transporter, score FT 1.3e-64" FT /inference="protein motif:Pfam:PF00005" FT misc_feature complement(858178..858222) FT /note="PS00211 ABC transporters family signature" FT /inference="protein motif:Prosite:PS00211" FT misc_feature complement(858505..858528) FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)" FT /inference="protein motif:Prosite:PS00017" FT CDS complement(858763..859551) FT /transl_table=11 FT /gene="cheR" FT /locus_tag="Cj0923c" FT /product="putative MCP protein methyltransferase" FT /EC_number="2.1.1.80" FT /note="Original (2000) note: Cj0923c, cheR, probable MCP FT protein methyltransferase, len: 262 aa; identical to FT YPEB_CAMJE, and similar to e.g. CHER_BACSU chemotaxis FT protein methyltransferase (EC 2.1.1.80) (256 aa), fasta FT scores; opt: 357 z-score: 432.6 E(): 8.5e-17, 31.6% FT identity in 231 aa overlap. No Hp match" FT /note="Updated (2006) note: Pfam domains PF01739 CheR FT methyltransferase, SAM binding domain and PF03705 CheR FT methyltransferase, all-alpha domain were identified within FT CDS. Further support given to product function. FT Characterised in more than one genus, however, identity FT scores were marginal. Putative kept within product FT function. Functional classification - Chemotaxis and FT mobility" FT /note="PMID:8244966, PMID:8360165, FT PMID:3510184,PMID:11669626" FT /db_xref="GOA:Q0P9X6" FT /db_xref="InterPro:IPR000780" FT /db_xref="InterPro:IPR022641" FT /db_xref="InterPro:IPR022642" FT /db_xref="UniProtKB/Swiss-Prot:Q0P9X6" FT /inference="protein motif:Pfam:PF03705" FT /inference="protein motif:Pfam:PF01739" FT /protein_id="CAL35043.1" FT /translation="MEKKITPSELELNEFIKIINEMSGIDLTDKKNILALKLNKFLEGT FT NTKNFSEFLGKLKSNRQLKQETLDFVTIGETYFLRELAQLKEIIYYAKSLEKRVNILSA FT PCSSGEEVYSLALLAAQNFIKDMYILGVDINSSVIEKAKLGKYQGRTLQRLSESEKRRF FT FLESEDKFYTINKNELCTCKFELCNVFEEKFSRLGKFDIIASRNMIIYFDHESKLKLME FT RFHRILNDKGRLYVGNADLIPETIYFKKIFSPRGVYYEKV" FT misc_feature complement(858778..859332) FT /note=