CHEBI:15841 - polypeptide

Main ChEBI Ontology Automatic Xrefs Reactions Pathways Models
ChEBI Name polypeptide
ChEBI ID CHEBI:15841
Definition A peptide containing ten or more amino acid residues.
Stars This entity has been manually annotated by the ChEBI Team.
Secondary ChEBI IDs CHEBI:8314, CHEBI:14860
ChEBI Ontology
Outgoing polypeptide (CHEBI:15841) is a macromolecule (CHEBI:33839)
polypeptide (CHEBI:15841) is a peptide (CHEBI:16670)
Incoming β-amyloid (CHEBI:64645) is a polypeptide (CHEBI:15841)
β-endorphin (CHEBI:10415) is a polypeptide (CHEBI:15841)
ω-conotoxin GVIA (CHEBI:90630) is a polypeptide (CHEBI:15841)
(12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone (CHEBI:91669) is a polypeptide (CHEBI:15841)
(3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone (CHEBI:92233) is a polypeptide (CHEBI:15841)
(4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid (CHEBI:94347) is a polypeptide (CHEBI:15841)
30-ethyl-33-(1-hydroxy-2-methylhex-4-enyl)-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone (CHEBI:91802) is a polypeptide (CHEBI:15841)
N-Ac-Asp-N6-lipoyl-KATIGFEVQEE (CHEBI:60738) is a polypeptide (CHEBI:15841)
N-acetyl-Asp-N6-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu (CHEBI:60217) is a polypeptide (CHEBI:15841)
abarelix (CHEBI:337298) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-(4-bromobenzoyl)-KATIGFEVQEE (CHEBI:60225) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-(5-chloropentanoyl)-KATIGFEVQEE (CHEBI:60228) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-(6-bromohexanoyl)-KATIGFEVQEE (CHEBI:60227) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-(chloroacetyl)-KATIGFEVQEE (CHEBI:60229) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-(octanoyl)-KATIGFEVQEE (CHEBI:60230) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE (CHEBI:60231) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-[(2-iodophenyl)carbonyl]-KATIGFEVQEE (CHEBI:60226) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE (CHEBI:60237) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE (CHEBI:60235) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE (CHEBI:60236) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE (CHEBI:60224) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE (CHEBI:60221) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE (CHEBI:60222) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE (CHEBI:60223) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl}-KATIGFEVQEE (CHEBI:60232) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl}-KATIGFEVQEE (CHEBI:60233) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl}-KATIGFEVQEE (CHEBI:60234) is a polypeptide (CHEBI:15841)
Ac-Asp-N6-{3-[2-(trifluoromethyl)phenyl]propanoyl}-KATIGFEVQEE (CHEBI:60238) is a polypeptide (CHEBI:15841)
Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu (CHEBI:60244) is a polypeptide (CHEBI:15841)
afamelanotide (CHEBI:136034) is a polypeptide (CHEBI:15841)
albiglutide (CHEBI:136045) is a polypeptide (CHEBI:15841)
amoxicilloyl polylysine (CHEBI:133951) is a polypeptide (CHEBI:15841)
Arthrofactin (CHEBI:80022) is a polypeptide (CHEBI:15841)
astressin (CHEBI:76649) is a polypeptide (CHEBI:15841)
astressin 2B (CHEBI:90229) is a polypeptide (CHEBI:15841)
bacitracin A (CHEBI:35862) is a polypeptide (CHEBI:15841)
benzylpenicilloyl polylysine (CHEBI:59297) is a polypeptide (CHEBI:15841)
bivalirudin (CHEBI:59173) is a polypeptide (CHEBI:15841)
calcitonin (CHEBI:3306) is a polypeptide (CHEBI:15841)
calcitonin (human synthetic) (CHEBI:135973) is a polypeptide (CHEBI:15841)
calcitonin (pork natural) (CHEBI:135917) is a polypeptide (CHEBI:15841)
Calcium-dependent antibiotic (CHEBI:29548) is a polypeptide (CHEBI:15841)
calpastatin peptide Ac 184-210 (CHEBI:131884) is a polypeptide (CHEBI:15841)
carperitide (CHEBI:135914) is a polypeptide (CHEBI:15841)
CIGB-300 (CHEBI:83696) is a polypeptide (CHEBI:15841)
corticorelin (CHEBI:136037) is a polypeptide (CHEBI:15841)
corticotropin (CHEBI:3892) is a polypeptide (CHEBI:15841)
corticotropin-releasing hormone (CHEBI:65311) is a polypeptide (CHEBI:15841)
cosyntropin (CHEBI:3901) is a polypeptide (CHEBI:15841)
cyanophycin macromolecule (CHEBI:65318) is a polypeptide (CHEBI:15841)
DASKALRSSGMP (CHEBI:90938) is a polypeptide (CHEBI:15841)
defensin (CHEBI:82761) is a polypeptide (CHEBI:15841)
degarelix (CHEBI:135961) is a polypeptide (CHEBI:15841)
dermaseptin s3(1-16)-NH2 (CHEBI:82640) is a polypeptide (CHEBI:15841)
DKATIGFEVQEE (CHEBI:60216) is a polypeptide (CHEBI:15841)
DSGEGDFLAEGGGVR (CHEBI:132999) is a polypeptide (CHEBI:15841)
elcatonin (CHEBI:135916) is a polypeptide (CHEBI:15841)
elf18 (CHEBI:73165) is a polypeptide (CHEBI:15841)
enfuvirtide (CHEBI:608828) is a polypeptide (CHEBI:15841)
ENPAVHFFKNIVTPRTP (CHEBI:86312) is a polypeptide (CHEBI:15841)
ENPVVAFFKNIVTPRTP (CHEBI:86310) is a polypeptide (CHEBI:15841)
ENPVVHFFFNIVTPRTP (CHEBI:86303) is a polypeptide (CHEBI:15841)
ENPVVHFFKNIVTPRTP (CHEBI:86237) is a polypeptide (CHEBI:15841)
ENPVVHFFYNIVTPRTP (CHEBI:86306) is a polypeptide (CHEBI:15841)
exendin-3 (CHEBI:75469) is a polypeptide (CHEBI:15841)
exendin-4 (CHEBI:64073) is a polypeptide (CHEBI:15841)
FPAWFTKLYPRT (CHEBI:90916) is a polypeptide (CHEBI:15841)
ganirelix (CHEBI:135910) is a polypeptide (CHEBI:15841)
gastrin (CHEBI:75436) is a polypeptide (CHEBI:15841)
ghrelin (CHEBI:75431) is a polypeptide (CHEBI:15841)
Gonadorelin hydrochloride (CHEBI:5521) is a polypeptide (CHEBI:15841)
insulin (human) (CHEBI:5931) is a polypeptide (CHEBI:15841)
IPQVWRDWFKLP (CHEBI:90834) is a polypeptide (CHEBI:15841)
JNK inhibitor I (CHEBI:88340) is a polypeptide (CHEBI:15841)
KGKGKGKGKGENPAVHFFKNIVTPRTP (CHEBI:86313) is a polypeptide (CHEBI:15841)
KGKGKGKGKGENPVVAFFKNIVTPRTP (CHEBI:86311) is a polypeptide (CHEBI:15841)
KGKGKGKGKGENPVVHFFFNIVTPRTP (CHEBI:86304) is a polypeptide (CHEBI:15841)
KGKGKGKGKGENPVVHFFKNIVTPRTP (CHEBI:86233) is a polypeptide (CHEBI:15841)
KGKGKGKGKGENPVVHFFYNIVTPRTP (CHEBI:86307) is a polypeptide (CHEBI:15841)
koshikamide A2 (CHEBI:66149) is a polypeptide (CHEBI:15841)
lantibiotic (CHEBI:71644) is a polypeptide (CHEBI:15841)
liraglutide (CHEBI:71193) is a polypeptide (CHEBI:15841)
lixisenatide (CHEBI:85662) is a polypeptide (CHEBI:15841)
LSM-37009 (CHEBI:125504) is a polypeptide (CHEBI:15841)
LSM-37015 (CHEBI:125509) is a polypeptide (CHEBI:15841)
LSM-37045 (CHEBI:125534) is a polypeptide (CHEBI:15841)
LSM-37094 (CHEBI:125564) is a polypeptide (CHEBI:15841)
LSM-37129 (CHEBI:125587) is a polypeptide (CHEBI:15841)
LSM-37138 (CHEBI:125595) is a polypeptide (CHEBI:15841)
LSM-37175 (CHEBI:125621) is a polypeptide (CHEBI:15841)
LSM-37192 (CHEBI:125634) is a polypeptide (CHEBI:15841)
LSM-37213 (CHEBI:125652) is a polypeptide (CHEBI:15841)
mastoparans (CHEBI:78506) is a polypeptide (CHEBI:15841)
melittin (CHEBI:6736) is a polypeptide (CHEBI:15841)
Mirabamide C (CHEBI:68407) is a polypeptide (CHEBI:15841)
Mirabamide G (CHEBI:68405) is a polypeptide (CHEBI:15841)
Mirabamide H (CHEBI:68406) is a polypeptide (CHEBI:15841)
Nafarelin (CHEBI:7445) is a polypeptide (CHEBI:15841)
Nafarelin acetate hydrate (CHEBI:7446) is a polypeptide (CHEBI:15841)
nesiritide (CHEBI:135919) is a polypeptide (CHEBI:15841)
Neurokinin A (CHEBI:80311) is a polypeptide (CHEBI:15841)
Neurokinin B (CHEBI:80312) is a polypeptide (CHEBI:15841)
neurotensin (CHEBI:7542) is a polypeptide (CHEBI:15841)
nociceptin (CHEBI:80266) is a polypeptide (CHEBI:15841)
P-factor (CHEBI:64121) is a polypeptide (CHEBI:15841)
penicilloyl polylysine (CHEBI:78855) is a polypeptide (CHEBI:15841)
PR-39 (CHEBI:131850) is a polypeptide (CHEBI:15841)
pramlintide (CHEBI:135922) is a polypeptide (CHEBI:15841)
protein polypeptide chain (CHEBI:16541) is a polypeptide (CHEBI:15841)
QINTAKWWKTHF (CHEBI:90925) is a polypeptide (CHEBI:15841)
QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 (CHEBI:84736) is a polypeptide (CHEBI:15841)
secretin human (CHEBI:135913) is a polypeptide (CHEBI:15841)
Sermorelin (CHEBI:9118) is a polypeptide (CHEBI:15841)
STAT3 inhibitor peptide (CHEBI:90286) is a polypeptide (CHEBI:15841)
teduglutide (CHEBI:72305) is a polypeptide (CHEBI:15841)
teriparatide (CHEBI:135983) is a polypeptide (CHEBI:15841)
terlipressin (CHEBI:135905) is a polypeptide (CHEBI:15841)
tesamorelin (CHEBI:63626) is a polypeptide (CHEBI:15841)
thymalfasin (CHEBI:135915) is a polypeptide (CHEBI:15841)
Vaby A (CHEBI:67901) is a polypeptide (CHEBI:15841)
Vaby B (CHEBI:67902) is a polypeptide (CHEBI:15841)
Vaby C (CHEBI:67903) is a polypeptide (CHEBI:15841)
Vaby D (CHEBI:67904) is a polypeptide (CHEBI:15841)
Vaby E (CHEBI:67905) is a polypeptide (CHEBI:15841)
Varv E (CHEBI:67906) is a polypeptide (CHEBI:15841)
VSWKTWFPNLAV (CHEBI:90830) is a polypeptide (CHEBI:15841)
WHWLQLKPGQPMY (CHEBI:79382) is a polypeptide (CHEBI:15841)
YIIKGLFWDPAC (CHEBI:79379) is a polypeptide (CHEBI:15841)
YIIKGVFWDPAC (CHEBI:79378) is a polypeptide (CHEBI:15841)
YSPFHKWFPSMH (CHEBI:90831) is a polypeptide (CHEBI:15841)
IUPAC Name
polypeptides
Synonyms Sources
polipéptido ChEBI
Polypeptid ChEBI
Polypeptide KEGG COMPOUND
Database Link Database
C00403 KEGG COMPOUND
View more database links
Last Modified
20 March 2017