CHEBI:80330 - peptide YY

Main ChEBI Ontology Automatic Xrefs Reactions Pathways Models
ChEBI Name peptide YY
ChEBI ID CHEBI:80330
Definition A 36-membered human gut polypeptide consisting of Tyr, Pro, Ile, Lys, Pro, Glu, Ala, Pro, Gly, Glu, Asp, Ala, Ser, Pro, Glu, Glu, Leu, Asn, Arg, Tyr, Tyr, Ala, Ser, Leu, Arg, His, Tyr, Leu, Asn, Leu, Val, Thr, Arg, Gln, Arg and Tyr-NH2 residues joined in sequence.
Stars This entity has been manually annotated by the ChEBI Team.
Wikipedia License
Waiting for wikipedia content
Read full article at Wikipedia
Roles Classification
Chemical Role(s): Bronsted base
A molecular entity capable of accepting a hydron from a donor (Bronsted acid).
(via organic amino compound )
Biological Role(s): neuropeptide Y2 receptor agonist
An agonist that binds to and activates neuropeptide Y2 receptors.
human metabolite
Any mammalian metabolite produced during a metabolic reaction in humans (Homo sapiens).
hormone
Originally referring to an endogenous compound that is formed in specialized organ or group of cells and carried to another organ or group of cells, in the same organism, upon which it has a specific regulatory function, the term is now commonly used to include non-endogenous, semi-synthetic and fully synthetic analogues of such compounds.
(via peptide hormone )
Application(s): appetite depressant
Agent that is used to decrease appetite.
View more via ChEBI Ontology
ChEBI Ontology
Outgoing peptide YY (CHEBI:80330) has role appetite depressant (CHEBI:50507)
peptide YY (CHEBI:80330) has role human metabolite (CHEBI:77746)
peptide YY (CHEBI:80330) has role neuropeptide Y2 receptor agonist (CHEBI:138168)
peptide YY (CHEBI:80330) is a peptide hormone (CHEBI:25905)
peptide YY (CHEBI:80330) is a peptidyl amide (CHEBI:15722)
peptide YY (CHEBI:80330) is a polypeptide (CHEBI:15841)
Synonyms Sources
peptide tyrosine tyrosine ChEBI
PYY (3-36) ChEBI
PYY 3-36 ChEBI
PYY3-36 ChEBI
Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 ChEBI
YPIKPEAPGEDASPEELNYYASLRHYLNLVTRQRY-NH2 ChEBI
Manual Xrefs Databases
C16118 KEGG COMPOUND
Peptide_YY Wikipedia
View more database links
Registry Numbers Types Sources
1366182-03-7 CAS Registry Number ChemIDplus
9754261 Reaxys Registry Number Reaxys
Citations Waiting for Citations Types Sources
25098834 PubMed citation Europe PMC
25372381 PubMed citation Europe PMC
25527432 PubMed citation Europe PMC
25658456 PubMed citation Europe PMC
25870965 PubMed citation Europe PMC
26006332 PubMed citation Europe PMC
26330345 PubMed citation Europe PMC
26676513 PubMed citation Europe PMC
26774588 PubMed citation Europe PMC
27027248 PubMed citation Europe PMC
27207785 PubMed citation Europe PMC
27264721 PubMed citation Europe PMC
27434221 PubMed citation Europe PMC
27465830 PubMed citation Europe PMC
27670407 PubMed citation Europe PMC
28003328 PubMed citation Europe PMC
28040488 PubMed citation Europe PMC
28106168 PubMed citation Europe PMC
28485050 PubMed citation Europe PMC
28626523 PubMed citation Europe PMC
28666375 PubMed citation Europe PMC
28684122 PubMed citation Europe PMC
28684238 PubMed citation Europe PMC
28735851 PubMed citation Europe PMC
Last Modified
11 August 2017