spacer
Related Links
IMGT/HLA Database - Provides specialist databases for sequences of the human major histocompatibility complex (HLA).
more
spacer

IPD - MHC Database

Allele Report for Aona-DQA1*27:01


Aona-DQA1*27:01
Latin Name: Aotus nancymaae Common Name: Nancy Ma's Night Monkey
Previous Designations & Local Names: None
IPD Acc No: MHC00001 Assigned: 27-MAY-2005
Source Entries: AF201293  
Publications
Diaz D et al. Immunogenetics 51:528-37 2000. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Protein Sequence (75 aa)
DHVAAYGINLYQSYGLSGQYTHEFDGDEEFYVDLGRKETVWRLPVFSKFAGFDPQGALTNIAAGKHNLDILIKRS
Nucleotide Sequence Data (226 bps)
CTGACCATGTTGCCGCTTACGGTATAAACTTGTACCAGTCTTATGGTCTCTCTGGCCAGTACACCCACGAATTTGATGGA
GATGAGGAGTTCTACGTGGACCTGGGAAGAAAGGAGACTGTCTGGCGATTGCCTGTGTTCAGCAAATTTGCAGGTTTTGA
CCCTCAGGGTGCACTGACAAACATCGCTGCGGGAAAACACAACTTGGACATCCTGATTAAACGCTC
Genomic Sequence Data (0 bps)
Not Currently Available

Further Information

For more information about the database or for all IPD queries please contact IPD Support.

spacer
spacer