Allele Report for 3DS1*0130101


3DS1*0130101
Previous Designations & Local Names: 3DS1v, NKAT10, KIRG1, 3DS1*004
IPD Acc No: KIR00085
Assigned: 28-JUN-2003 Sequence Last Modified: 24-JAN-2005
Source Entries: AF022044 , AL133414 , AY320039 , AY760032 , AY760055 , EU156175 , GU182347  
Cells Sequence Derived From: FH15 , NV , RDP1 , RPCI-1 , TT-10837 , TWC033 , WT47  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Norman PJ et al. Nature Genetics 39:1092-9 2007. abstract
Valiante NM et al. Immunity 7:739-51 1997. abstract
Wilson MJ et al. Proc Natl Acad Sci U S A 97:4778-83 2000. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 7 Laboratories: 4
Protein Sequence (383 aa)
MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGF
NMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEWI
SKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPS
SSWPSPTEPSSKSGNLRHLHILIGTSVVKIPFTILLFFLLHRWCSNKKKCCCNGPRACREQKX
Nucleotide Sequence Data (1165 bps)
ATGTTGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTGTTCTTGGTCCAGAGGGCCGGTCCACACATGGGTGGTCAGGA
CAAGCCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGCGGAGGACACGTGACTCTTCGGTGTCACTATCGTCATA
GGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACGTTCCCATCTTCCATGGCAGAATATTCCAGGAGGGCTTC
AACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCCATGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGAGTGGATC
TCTAAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTTCCATGATGCG
TGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCCCCTATCAGTTGTCAGCTCCCAGTGATCCCCTGG
ACATCGTGGTCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTG
ACCTTGTCCTGTAGCTCCCGGAGCTCCTATGACATGTACCATCTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCC
TGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTCACTCTCCCTACGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTAACCTCAGACACCTGCACATTCTGATTGGGACCTCAGT
GGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCAACAAAAAAAAATGCTGCTGTAATG
GACCAAGAGCCTGCAGGGAACAGAAGTGAACAGCGAGGATTCTGA
Genomic Sequence Data (14932 bps)
GTTCAGGAGGTTGGATCTGAGACGTGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGCTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CAGCCGCCTGTCTGCACCGGCAGCACCATGTTGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
CGAGGGAGGGAGTGCGGGGATGGAGATCTGGACCTGGAGGTAAAGATATGGGCCTAGAGGTGGAGTTATGGGCCTGGAGG
TGGAGTTATGGGCCTGAAGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATAGGGGCCTGGGGTGGA
GATATGTGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATATGTGCCTGGGGTGGAGATA
TGGGCCTGGAGGGGAGATATGGGCCTGGAGGGGAGATGTGGGCCTAGAGGTGGAGTGATGGGCCTAGAAGTGGAGCGATG
GGCCTGGAGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGATATGGGC
CTGGAGTGGAGATATGGGCCTAGAGGTGGAGTTATGGGCCCGGAGGTGGAGTTAAGGGCATGAAGTGGAGATCTGGGCCT
GGAGTGGAGATATGATCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATACGGGCCTGGAGCAGACATACAAGCCTGGAA
AGGAGATATGGGCCTGGAGAGGAGATAGAAGCCTGGAGTGGAAATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGA
TATATGAGCCTGGAGTTGAGATAGGAGCCTGGAGTGGAGATATGGGCCTGGAGTGGACTTATCAGCCTGGAGAGGAGATA
TGGGTCTGGAGTGGAGATACGGACCTGGAGTGGAGATCTGGGCCTGTTGTGTAGATCTAGGCCTGGAGGTAGAGATCTGG
GCCTGGAGGCTGAGTCTCTGCACAGCCGAGATCCTTGTTCCTGGGGGCAGGTAGGCAGCGAGGGTGAGTTTACCTTCAGC
CCAGCAAGGGCCTGGCTGCCAAGACGCACAACCCAGTGGGGGCAGCAGGGTGCCCTGGTTTGCCTGCAGATGGATGGTCC
ATCATGATCTTTCTTTCTAGGGTTGTTCTTGGTCCAGAGGGCCGGTCCACACATGGGTGAGTCCTTCCCCAAACCTTAGG
GTGTCATCTCCCCACATAAGAGGATTTTCCTGAAATGGGAGGGAAGTCCTGTCGGGGAGTCTCTCATACACTAGGAAGAG
GGGACCCTCGGATGCTCGGCCCACATTTCTGACCTTGCCCTCCCCGGCCTTTCTTTCCCTTTCCTGAGTCAAGCTCTGTG
AAGACTGGGGTGAGACTAGGGTGCTCCAAGATGGGTGTGCAGGGAGGAAGTGGTGTCAGCAGCAGAGAAAGAGAGGGAAG
CAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTGTAACTCACACCCTCCAGCGTTTCCGTGATGGTAGGGGCTGCA
GTGTGGCTGCGGTCTTTCTACCAGAAAAGGTGAGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGC
TCAGTTCATCAATTGGCTGATATTCCATTCACATAGGACTTGCCCTCCATGCCGTGTCTACTTTGTATTGTTTTATATGA
GTAATTTTGCAGTATTAAAATCTAGTAAGAGTTGCTTCTCCAGCACTTGCTCAAAGTTCTCAGCTGACACTTGTTGTAGG
GAGACGCCATGTCTATGCAGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAGAAAGTGGAAA
TGGGGAGAATCTTCTGGGCACTGGGAGTGAGGGGCGGCTCCACATCCTCCTCTCTAAGGCAGTGCCTCCTTCTCCCCCAG
GTGGTCAGGACAAGCCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGCGGAGGACACGTGACTCTTCGGTGTCAC
TATCGTCATAGGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACGTTCCCATCTTCCATGGCAGAATATTCCA
GGAGGGCTTCAACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCCCCCA
CTGGGTGGTCGGCACCCAGCAACCCCATGGTGATCATGGTCACAGGTCAGAGGCTTTCCGTCTGGGCTTCTCACTGTCCC
ACCTCCTGAATCCCAGAGCTTCTGGTGGGGCTGTCCGTCAGGGTCCCATCACCCAGGCCCTGGCTGTATTTGGGGTCAAG
GGAGATTGAATACAGGGCAAATGGGTGCTGTGGTGGGAAGAATAACTGTCCCCAATGATGGCTACATTGTAATCCCTGGA
GCCTGTGACTATTTATGTTATAGGGCAGGGGACTGAAGGGGAAGGTGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGAT
GGGGAGACAGCCTGGACTGTCCCACTGGGCTCAGTGTAATCACAAGGGTCCGCGTGAGAGGTGGAGGAAGAGGGGAGTGG
GGATTAGAGCAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGCGGGCTTTGAAAGTGGAGGAAGACCACTAGTCACAGA
ATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAGGAGAACTGATTCGCTGATTCTCCAGAGGGAACGCAGCCCTGTAGACG
CCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCTCCAGAAGTGGAAGGGGTCAGTGTGTTCTCTCCTGCTGC
CATGTTTGTGGTAATTTTCTGCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTCAAGGACAAGTTAGGAACCCAGGT
CAAGGACAAGTTAGGAAACCAAACAAGGACAGCCAGGTGTGGTGGTGGGCGCGAGTAATCCAACGACTGGGGAGGCTGAG
GCAAGAGAATCACTTGAACTGGGGAGGCAGAGGTTTCAGTGAGCCAAGACAACACCACTACACTCCAGCCTGGGTGAAAA
AGTGACTGTCTCAAAAATAAATTAATTAATCAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACCCTGAGATCA
GCAAGGGCAGGATGCTGATGTTACCACCAGGCTCCATCCACATAGGAAGGGGTTGATGCTCCTGGAACCAGCACCAGGGG
CCACCCTATGGAAGCTGGGGCCATGGAGAAGGCACAGACATGGCAGGAGAGGCTCCCAATCCCCATCAGGAACAGGGTGT
GTGGTCACTGATGTCTGTCTTACTGATGAGTTGATACCACCTGCCAGAGACTCCAATTTGTTCAAAAGAGATTGATTCAG
GCTGCTAAGAGCCTGGACATGCAGCCTGTCCTCTTCCACCCCCATATAAACAGCAGGAAAGAGATTAGTGGGAAACAGAT
ACAACAGCCCAAGAGATGAGGCTGTCTTCACAGTGGCAAGGGAGTCAGGGGCTACTGGAGACAGAGGGACAGAGAAGAGG
GAGGAAGACAGATGGAGGCACCTGCACCAGGGGATATGGGCACAGAAAAGACACGGAGATGCAGAGAGGGAGGAGAGAGA
CAGACACGGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATGATAAAGAGAGATGCCTTCTAAACTCACAA
CTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGGTGAAATCAGGAGAGAGAGTCAT
CCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGAGTGGATCTCTAAGGACCCCTCACGCCTCG
TTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTTCCATGATGCGTGCCCTTGCAGGGACCTACAGA
TGCTACGGTTCTGTTACTCACACCCCCTATCAGTTGTCAGCTCCCAGTGATCCCCTGGACATCGTGGTCACAGGTGAGAG
TGTCTAGACATTGTTCTCATTGTCACTGGGACACAGAGTGAATGATCCAGGACTTGGAACCCCCAGGTGGTCATGAGGAA
GATAAGTGTGGGATTCTTATGGAAAGAGAGTGACTTGGTGAGGTCTGTACCAACAGAGACAGAGAAACAGGAGACATAAG
TACAGAACAGGTGTCATAACAGGGGACAGACACAGGGGCCATACAGGGAGGTAGAAAAGAGAGAAAGAGGTAAAGGAGAC
ACTCAGACAGACAGACATGTCCCAGAGAGAGGTGTCCTTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGT
TTCATTTCTGTTTTACCTCCACAAAGTGTTTCTACCAGAAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCC
TGTGGCCTCAGGCCTTGTGCCACCTACAGATGCCGTGTTTATTCTGACACCTCTGCCTTCCATGCAATGGAGAGTAATCA
TCCCAGGATATCATGGCCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGGGGTCCCCAGACTGGATTCTGAGGCTC
ATATTCCAAATAATCCCACATATGATAGGATCGCTGAGAGACACAGAGAAAAATCAGGGACACCAAAAAGCAAAGACATA
AACACACACAAAATGAGCCAGAAGAAGGAGATTAAGAGATTCACAGACACATAAAAAGAAAGAAAAGAGGGCAGAGTGGA
GAGAATGATGGAAAGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGGAGGGACACAAAGACAGAGAAAGATAAAGA
TGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGACGGAGAGAGAGA
GATGATAGATGGATAGATAGACGTAGATAGATGATAAATAGGTAGATGATAGATAATGGATTGGTTATAGATACATAGAT
GATGACTGATAGATGATACATAGAGATGATGATGATGACGATGATGATGATAGACACATAGATATATACATAGATGATAC
ATAAATAGAGACAGAGAGGCAGACAGAGAGGTAATAGAGAGAGAGATAGATGATACATATATAGATAATAGATGATTGAT
GGATAGATAGACAGATAGACAATTGATAGAGAGATAGATAAGTGATACATAAATATAGATGATAGATAATTTGTAGATAG
ACACAAAATAGATAAATAGATAGATCGATAGATAATAGATAGAAATGTGCAGAAAGTTATGAACAAGACAGAAAGTGAGA
GACTCAAAATTAAAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGGGTCAGAGAGAATAAAACAATCCAAAAAGGGA
AAACATACCTCAGGGTGGGGAAGTGAGGTCATAGACCTAGAGAGACAGAAAAGGTAGAAGGAGGAAACAGATATGAAGAG
AGATGGGGTGGAGAGTGAGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGTGAGG
GGAGCTGTGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAG
CCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTGACCTTGTCCTGTAGCTCCCGGAGCTCCTATGACATGTACCAT
CTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCCTGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCCC
TCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTCACTCTCCCTACGAGTGGTCAGACCCGA
GTGACCCACTGCTTGTTTCTGTCACAGGTGAGAAAAGCCCATATCTCTCTCATGTCCTATGATCCTAAATCCTTAGCTAA
GGAGCTTCCTGCTGATGATGGAGAAAAGCATGGACAGATGCAGAGAGAAGACACAGCAGGTGTGAGGGCGGAGTCAGGGC
GCAGGATGGCAGACAGGGCACCTCCAAACCCTCCTTCATGGCCTGCATGGAGGCCTCCGATCAGGGCTCCAGGCACCCAG
GCAGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTTAGTTTGGGGAGATCAGAGGTTCCCTCAGC
CCCTCAATCTTACCCATTTCCCAGAAGCCCATCATGGCCTCTCACCCACACAGAGAGATATCATCACCAGCAACCCCTAC
ACCCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCACCTTTACCATTTTTAAAA
GTAAAATCTAGTGGTCATAAATACCTTTATATGCTGGGCGTGGTGGTTCACAGTTGTAATCTCGGCGCTTTGAGAGGCCA
AGGAAGGTGGATCATTTAAGATCAGGAACTCGAGATCACCCTGGCCAACATGTGGGAAATTCATCTTTACTAAACAGACA
AGAAAAATTAGCCGAGCATGCTGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCACTTAAAGC
CAGGAGGCCGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGTTTCTAAA
TAAATAAATACATCTATATTCTTTTTTTTGTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTGTCCACCATTGTATTCT
CCACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGGTGAGAAATGGGAATCTTTGTAATGACCTCCAGTTCCATCC
ATGTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACTGTGTGTGTGTACCACAGTTCTCTATC
CATTCACCCACTGATAGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATATGAGTGCA
GATATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTATGAAAGTTCTC
TTTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCTAAGTGGTGAGATCTTGGCTCAT
TGCAACCTGTGCCTCCTAGGTTCAAATGATTGTCCTGACTCAGCCTCCCTAGTAGCTGTGATTACAGGTGCATGCCACCA
TGCCTGGCTAATTTTTGTATTTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGACCTC
AAGTGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAATTACAGGCATAAGCCACTATGCCCAGCCTCCTTTTAGTTTTT
TAAAGAATTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCTTTCT
CTACCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGATAAAAGCCATTTTACTTTACTTTATTTTATTTATTTATTTA
TGTTGAGATGGAGTTTCACTCATAGTCGCCCAGGCTGGAGTGCAAGGGTGTGATCTCAGCTCACTGCAACCTCCGCCTCC
CGCGTTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCGTGTGCCACCACGCCTAGCTAATTTTT
GTATGTTTAGTAGAGAGGGAGTTTCTCCATGATGGTCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGCTTC
CTGAAGTGCCGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGATTG
TAATTTACATTTCTCTGATGATGAGTGATGCCGAGTACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTGTGG
AGAAATGTCTCCTCATGTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCCAGT
TATTAATCCCGTCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTGGGTTGTCTCTTCACTTTCTTGGTTTATC
TTTTGTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAGGTT
TTAAACAAAATGTCTTTCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAGACT
CATGTTTTTAATCCATTTTCATTTGATTTTTGTTTATGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAGATA
TCCAGTTTTCCCCACACCATTTATTGAAAAGACTGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATT
AAATGGGCTGGGTATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGGTGGATCACCTGAAGCCAGG
AGTTCAAGACCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGACCAGT
GCCTGTAATACCACTACTCGGGTGTTTGAGGCAAGAGAATTGCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGAT
TGCACCTCTGCACTCCAGCCTGCATGACAGAGCAAGATTCCATCACACACACACAAAAAAAAGCCATTGGGTGTAAATGC
ATGGATCATATCCGTGTTCTCCATTCTGTTCCATTTTTTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTAC
TACAGCTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGTG
GGCATCGCACACAAAAATTATGGAGAAGAGGATCCCAAGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCATG
AACCAACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCTGTCCCATGTTCTAGGAA
ACCCTTCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTTT
GGAAACCTGGGGAGGTGGAAGCCTTGGATGCAAGCGTTGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCCA
CCATCTCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTAACCTTTA
ATGTCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAGTGTTT
TTTCTGCCTGCATTCCTAACTGGAGGATAAATTCCTGGGGACTTGAGAGAGGGAAGGGAAGGGAACATCTCATGAGGGTG
GGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGCAA
GAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCA
GGCTGTGCAGTTGGAATCCTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAATAAAGCGGCTTTT
TAATTATCTTACAGTGCTGTAGCTCAAAGTATGAAGTGCATCTCACTGGGCTAAAAACAAGGTGACAGCAAGGCTGCCTT
CCCTCTGAGGGTTCCAGGCAAGAATCTGCTTCTCACTTGTCCCAGCTTCTAAAGGCTCCCAGTTCCTTGGCTCCTGGTCC
CCTTCCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCT
CTTTCTCTGAATGCTGCTCTCCCTTCTTCCTTATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATC
CATCATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGACTAGCAACCGTAATTCCATCTGCAATC
TTCATTCCTCCTTTCCATGTAAAATAACATATTCACAAGCTATGGAGGCCAGGACAGGGACATTTTGGGGTGGGACAGCA
TTCTCCTGCCTTCCACGAACGGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAATG
GGAGGGCAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTTGT
TTGTTCGTTCATTTATTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCACT
GCAACCTGCGTCTCCTGGATCCAAGTGATTCTCCTGCCTCACCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCAT
GCCCGGCTAACTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCATGTTGGCCAAGCTTGTCTGAAACTCCCAACC
TCAAGTGATCCGACCATCTCAGCAACCCAAAGTACTGGGATTACAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAAAT
CAATAATAGATAATGCTGAGTGTATAATTTTGGGTGACAGAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGAAA
AACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACAGCTGTCAGCTGTGAAGGCACAAAGGTGAAAACA
ATCTGATGTTGAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGAAGTGGGGAGAATGACAAGACGACTGTAGAGAGACG
GAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCG
GGGTAACCAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAAGGAGGCCCAGGTGCGTAACTGGAATCTAGGA
GACTGTGGAAAAGGCAATTGCCACCCCACTGGTGAAATGTGGTGCTGATTTAGACCCTAAGTGGATGAAGCAGATGGATA
TAAGCTATGCTTGGGAGGTAGAATCATTTGCAGGGAGGGCTTGCTGGGTTTGAGTTTCCTAGTTGTTTAATCCTTGCTAA
ATTAATTTCTTTCTGAGATTTATTCCTCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGT
GGAAATGAAGGGACCTATTATAGCATAGTATACAAGTCTGTGAACGGTGGCTCACTCCTGTAACCCAGCACTGCAGGAGG
CTAAGGCCAGTGGATTCCAAGAAATCAGGAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCCTATCTCTACATGGTGA
AACCCTATCTCTCCTAAAAATACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTGATCCCAGCTCCTGCTCTGGAGGA
TGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATCGCATCACTGCACTCCAGCCTGGGTG
ACACAAGGAGACTCCGTCTCAAAAAATAAAAATAAGAAATGCATAAATATAATAAAACACACACGAACGACAAAGGCACC
TGAATTCCCATCATCATTTTTCTATTTCTCTATAATTACTTCTTTGATTCTTTATCTTATCCATTAGACAATCAGCCTAA
AACCTCTTCCGTATTTGGCTTTCTGTGAGCATGAGATCATATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACAAAT
CCTGGAATAGAGAAAGTGCTCTGGTCATCACAAAAAAAACTTGCCCCCTCACCCAAATCCCCCACCTCACCCCTACTTCC
AATCACCTGTGCAGATACAGATAGACCATGGGGAGGTAAATGCTAATACTCCTTGGAGTGAGTCCAGATCTTGGAATCAG
AGATCAGTGCCAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGATAGT
CGAGGGGGTGGTCCTTCCCCCAGCCTGTCAGGTAGAACAGCAGCCTAACATGTGTCTCCCGAGATCACAAAGAATAGCAC
ATTTCACACGGGCTTCAACACTATTTTCTGGCTGTTTGACATAAGAGAATTCTACTTCGCATTTTTGATCTTGATTTCAC
TTTTGTTTCCTTTTCTTGGAGAATGCAAGTTGTTTAACTCAAGAATGCCGTGGATGTAGAAATCCTAAAGCACATTCGCT
GTGTATCAATCCCAGTCCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATTCCTA
TCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAACACATTACACAGGCAGGTTCATTACTAACAGATAAGCAGC
GAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTTCCCCAAGGCTCAGAAAAGCTGCTCGAGACATGTGGAGTCAC
CCCATTTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAACCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAG
CTAAAGCACTGCATCACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGGGACTTTCCTCCTGATCTCA
GGACGTTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAACAAAAGATTTTGGT
TTGCCTTACAGTTCCGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCTTGTGACTGCCTCAGGCTGCTCCCACT
CTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGAGAGGGGGA
GTGATGGAGCTTCCAAGCTCTTATGAACAACCAGCTCTCCAGGAACTAATAGAGGGAGAACTTGCTAACCCCGTCTCCTT
AAAACAGCATTGATCTGTTCATGATGTATCCACCCCCATGACTCAAACACCTCCCAAGAGGCCCACCCTCCCACACTGGG
GGGTAAATTTCAATCTGAGGTTTGAAGGGGTCAAACATCTCAACTAAAGTAGTGGTATCCTCAGCACGTTCTATGGTTAC
TATGAGAGCTATAACTGAGAAAGCAGGAGGAAGCTGGGTCTCCCGCCATCTGGGTGCTTGTCCTAAAGAGACGCTGTATG
TGGTTACCTGTGAATCAAGAAATGCAAGACAATTCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCT
TCTTCCAGGTAACCTCAGACACCTGCACATTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCT
TTCTCCTTCATCGCTGGTGCTCCAACAAAAAAAAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGG
AAGCAGGATGGGAGCACACGGGTGTGTGTTCCTCACCAGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGG
ACTTTCTAGAGAGAGCACCAGATTCCCTTCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACTGTATCCTCAC
GTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGATAGAATCAATGGAATGGGACCT
CAGAGCTATTCATGGGATGGGTCCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAG
GCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGA
CTTCCGTCTTCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAAGTGAACAGCGAGGTAGGTGCTCCTC
GGCCCAGCCTCGTGGCTAGTGTTATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTC
TCCAGGATTCTGATGAACAAGACCATCAGGAGGTGTCATACGCATAATTGGAACACTGTGTTTTCACACAGAGAAAAATC
ACTCGCCCTTCTCAGAGGCCCAAGACACCCCCAACAGATACCAGCATGTACATAGAACTTCCAAATGCTGAGCCCAGATC
CAAAGTTGTCTTCTGTCCACGAGCACCACAGTCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAAC
TGGGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCATCAGTCTTCATCTTAGGGCATCGCTCTTCCTCACAC
CACAAATCTGAATGTGCCTCTCACTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAAAAAACACACTCCTTT
GCTTAGCCCACAGTTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACTTGAG
GCTGCAATCACACTGAGGAACTCACAATTCCACACATACAAGAGGCTCCGTCTTAACGCAGCACTTAGACACGTGCTGTT
CCACCTTCCCTCATGCTGTTCCACCTCCCCTCAGACTAGCTTTCAGCCTTCTGTCAGCAGTAAAACTTATATACTTTTTA
AAATAACTTCAATGTAGTTTTCCATCCTTCAAATAAACATGTCTGCCCCCAT

IPD-KIR