Allele Report for 3DP1*001


3DP1*001
Previous Designations & Local Names: KIR48a
IPD Acc No: KIR00087
Assigned: 28-JUN-2003 Sequence Last Modified: 16-AUG-2010
Source Entries: AF204915 , AF204916 , AF204917 , AJ639845 , GU182349  
Cells Sequence Derived From: G085 , NV  
Known Ethnic Origin Of Source: Caucasoid
Publications
Vilches C et al. J Immunol 164:5797-804 2000. abstract
Gomez-Lozano N et al. Eur J Immunol 35:16-24 2005. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 3
Protein Sequence (316 aa)
MSLMVVSMACVGFFLLQGAWTHEGGQDKPFLSAWPSPVVSEGEHVALQCRSRLGFNEFSLSKEDGMPVPELYNRVFRNTV
FIGPVTPAHAGTYRCRGSHPHFLTGWSAPSNPLVIMVTGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGK
FNDTLRLTGELHDGVSKANFSIGRMTQDLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLCGKPSLSAQPRPMVKAGESV
TLSCSSRSSYDIYHLSREGEAHELRFPAVPKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSDLSDPLLVSVT
Nucleotide Sequence Data (949 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGACACATGAGGGTGGTCAGGA
CAAGCCCTTCCTCTCTGCCTGGCCCAGCCCTGTGGTGTCTGAAGGAGAACATGTGGCTCTTCAGTGTCGCTCTCGTCTTG
GGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGCTCTACAACAGAGTATTCCGAAACACCGTT
TTCATAGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACACCCACACTTCCTCACTGGGTGGTC
AGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAG
TTTAATGACACTTTGCGCCTCACTGGAGAGCTCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCGCATGACGCA
AGACCTTGCAGGGACCTACAGATGCTACGGTTCTGTTCCTCATTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGG
ACATCGTGATTACAGGTCTATGTGGGAAACCTTCTCTCTCAGCCCAGCCGCGCCCCATGGTTAAGGCAGGAGAGAGCGTG
ACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATCTACCATCTATCAAGGGAGGGGGAGGCTCATGAACTTAGGTTCCC
TGCAGTGCCCAAGGTCAATGGAACCTTCCAGGCCAACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTGACTCTCCCTACGAGTGGTCAGACCTTAGTGACCCACTGCTTGTTTCTGTCACAG
Genomic Sequence Data (5713 bps)
GTTCGGGAGGTTGGATCTGAGACGTGTTGTGAGTTGGTCATAGTGAAGGACGTGAGGTGCCAATTCTAGTGAGAACAATT
TCCAGGAAGCCGTGTTCCGCTCTTGAGCAAGCATCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCT
CCCATGATGTAGTCAACATGTAAGCTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CGGCTGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAAGGAAT
AGAGGGAGGGAGCGCGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAGT
GGAGATCTGGGCCTGGAGTGGATATATGGGCCTGGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGTCTGGAGTGG
AGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATAGGAACCTGGAGGGGAGA
TATGAGCCTGGAGTGAAGATATTGGCCTGGGATGGAGATATGGGCCTGGAGTGGAGACATGGGCCTGGAGGTGGAGATAT
GGGCCTGGAGGTGGAGACATGGGCCTAGAGGTGGATATCTGGGCCTGGAGTGGACATATGGGCCTAGGATGGAGATATGG
GCCTGGGTGTGGAGATATGGGCTTGGGGTGGAGATATGGGCCTGGATTGGAGATATGGGTCTAGGGTGGAAATATTGGCC
TGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCTTGGGGTGGGGATAGGGGCCTGGGGTGCGGATATGGGCCTGCA
GGCTGGGTCTCTACACAGCCGACAGCCCTGTTCTTGGGTGCAGGCTGGCACTGAGGGTGAGTTTCCCTTCAGCCCAGCAA
GGGCCTGGCTACCAAGACTCACAGCCCAGTGGGGGCAGCAAGGGAGTCCTGGTTTGCCTGCAGATGGATGGTCCATCATG
ATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGACACATGAGGGTGAGTCCTTCTCCAAACCTTCGGGTGTCA
TCTCCCCACATAAGAGGATTTTCCTGAAACAGGAGGGAAGCCCGGTGGGGGATTTTCTTATAAACAAGGATGAGGAGACC
CTGGGGTGCTCAGCCCACAGTTCCGACCTTGCCCTCCCCAGCCTTCCTTTCCCTTGGCTGAGTCAGGTTCTGTGGGAACC
CGGGAGGGTAGACTGGGGTCCTCCAAGCTGGGCTGTGCGGCTGGGATGTGGTGTCACTGGCAGAGGAAGGGAGCAAAGCA
GTGCTAGGAACAGCAGGCCTCTGAGGACAAAGGTGTAACTCACACCCTCCAGCGTTTCCATGACGGTAGGGGCTGCAGTG
TGGCTGCTGTCATTCTACCTCAGAGGTGGGGGAACCCCAGCCAGGGCCCTGACCTTCCAAATCCTCTGTTGGGGGCTCAG
TTGTGTATTGTGGTTCACACATTGGCTGATATTCCATTCACAAAGAACATGCCCTCGACTCCATGTCTATTTGTGTTGTT
TTATGTGAGTAATCTTGCAGGATTAAAATCTAGTAGGAGTCCCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTT
TTGTTGTAGAGAGACGCCAAGTCTATGCGGGGTGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAG
AAAGTGGAAATGGGAGAATCTTCTGACACGTGGAGGGAGGGGCGGCTCCACATCCTCCTCTCTAAGGTGGCGCCTCCTTC
TCCCCCAGGTGGTCAGGACAAGCCCTTCCTCTCTGCCTGGCCCAGCCCTGTGGTGTCTGAAGGAGAACATGTGGCTCTTC
AGTGTCGCTCTCGTCTTGGGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGCTCTACAACAGA
GTATTCCGAAACACCGTTTTCATAGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACACCCACA
CTTCCTCACTGGGTGGTCAGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGTCAGAGGGCTCCTGTCTGGGATTCTC
CTTGTCCCACCTCCTGAGTCCCAGAGCTTCTGGTGGGAGTGTCCACCAGCGTCCCATCATCCAGACCCTAACTGTATTTG
GGGTAAAAGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGAAAGAATAATTGTCCCCAATGATGACTGCATTCTAAT
CCCTGCAGTCTGTGACTATTTATGTTATAGGGGAAGGCACTGAAGGGGAAGATGGAGCTCAGGTTGTTGAGTTGACCTTG
AGATGGGGAGACAGCCTGGACTGTCCTGCTGGGCTCAGTGTAATCACAAGGGTGCACATGAGAGGAGAAGGAAGAGGGGA
GTGGCGATTAGAGCAGTGCAATGGAAGTCTCCATCAGCTTTGAAGGTGGAGGAAGGCCATGAGCCATGAATGCAGGTGGC
CTATAGAGGCTGGAAAAGTCAAGGAACTGATTCTCCTGGGTCTCCAGAGGGAACGCAGCCCTGCAGATGCCTTGATTTTA
GCCCTCAAAAAACAGGGTCCGATTTCTGTCTCCAGAAACGGAAGGGGTCAGTGTGCTCTCTCCTGCTGCCATGCTTCTGA
TAATTTTCCACAGCACCAACAGGAAACCAACACTGGAACCCAGGTCAAGGACAAGATAAGAAAGGACACAAGGATAGCCG
GGCGTGGTGGCAGGTGCATGTAATCCTAGCAACTCAGGAGGCTGAGGGCAGGAGAATCACTTGAACCCAGGAGACAGAGG
TTGCAGTGAGCCTAGACCACACCACTTCACTCCAGCCTGGGTGAAGGAGTGAGACTCTGACTCCAAAATTAATTAATTAA
TTAAAGAAACCAAACAAAGAGAAGGTTGGCTACACCGAGATCAGCAAGGGTGGGATGATGATGCCACCACCAGGCTCCAT
CCACATAGGGAGGGGTTGATACTCCTCAAACCAGCACCAGAAGCCAGCCTATGGAAGCTGGCACCATGGAGAAGGCACAG
GCATGGCAAGAGTGGCTCCCAGTCCCCACCAGGAACAGGGTGTGTGGACACTGGTGCCTGCCTTACTGATCAGTTCATAC
CTTCTGCCAAGGATTCCAATTCGTCCAAAAGAGATTGAACCAGTCTGCTAAGAGCCTGGACGTGCAGCCTATCCTGGTTC
CTCTTCCACCCCCACATAGAAGCAGGAAAGACATTAGTTCGAAATAGATACAACAGCCCAAGAGATGAGGCTGAGCCCAG
CGGCAAGGGAATCAGGAGCTACTAGAGACAGAGGGACAGAGAAGAGGGAGGGAGACAGATGGAAGGACCTGTACCAGGAG
TTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGGAGAGAGATAAGACACCAGCGAGGGGAAGCCTCACTCATT
CTAGGTGCCATGGATGGGATGATAAAGAGAGATGCCTTCTAAAGTCACAACCTCTCTTCCTAGGAGTCCACAGAAAACCT
TCCCTCCTGGCCCACCCAGGTCCCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGA
GCACTTCCTTCTGCACAGAGAGGGGAAGTTTAATGACACTTTGCGCCTCACTGGAGAGCTCCATGATGGGGTCTCCAAGG
CCAACTTCTCCATCGGTCGCATGACGCAAGACCTTGCAGGGACCTACAGATGCTACGGTTCTGTTCCTCATTCCCCCTAT
CAGTTGTCAGCTCCCAGTGACCCTCTGGACATCGTGATTACAGGTGAGAGTGTCTGGACATTATTCTCATTGTCACTGGG
ACACAGAGTGAATGATCCACGACTTGGAGGCCCAGGTGGTTATAAGGAAGATGAGCTTGGTATTCTTATGGAGAGAGACT
AACTTGGTGAGGTCTGTACCAACAGAGACAGAGAAACAGGAGACACAAGTACAGACCAGGTGTCATAACAGAGGACAGAC
ACAGGGGCCATACAGGGAGTTAGAAAAGACAGAAAGAGTTAAAGGAGACACAGACAGACATGTGCCAGAGAGAGGTGTCC
TTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACTTCCACAAAGTGTTCTCTACC
AGAAGAACCCAAGGACACCCATATTTCTGGCCTGAGTTGGGCCCTGTGGCCTCAGGCCTTCTGGCACCTACAGATGCCGT
GTTTATTCTGACACCTCTGCCTTCCATGCAATGGAGAGTAATCGTCCCAGGATATCATGGCCCCAGAACATCAACCCCTG
TATACTGTGTGAACTTGCGGTCCCCAGACTGGATTCTGAGGCTCACATTCCAAATAACCCCACATATGAGAGGATCACTG
AGAGACACAGAGAGAAATCAGGGACACCAAAAAGCAAAGACATAAACACACAGAGAATGAGCCAGAGGAAGGAGATTGAG
AGACTCACAGACACATAAAGAGGGAGAAAAGAGGGCAGAGAAGTGGAGAGAACAATGGAAGGGAACAGAGAAAAGCACTA
AAATTAGAGTCCTGAGGGAGAGGCACAAGGACATAGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCCAAAGAGAA
CTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGATAGATATAGATAGATGATAAATAGGTAGATGATAGATA
ATAGGTTATAGATACATAGATGATGATCGATTCATTCATTGATTAATCGATGATACATAGAGATGATGAAGATGAAGATA
GATAGATAATACATAGAGATAGAGAGGCAGACAAAGAGAAATCATAGAGAGAGAGAGACGATACATAGATATAGATAATA
GATGATTTTTGGATAGACAATTGATAGATAAATAGATTATATATAGATATAGATGACAGGTAGAGAATTTGTAGATAGGC
ACCAGATAGATAAATAGATATATCGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGGACACAAAGTGAGAAA
CTCAGAATTTAAAAAAAGTAACATCAAGTCAACTAGTCCAAGGAGAGTCAGAGAGAATAAAACAATCCAAAAAGGGAAAA
CATATCTAGAGGTGAGAAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGTGGAAAGAGGAAATAGACATAAAGAGAGA
TGGTGTGGAGGGTGAGACAGAGAGAGAGAGCATTAGGCCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGGGAGGGGA
GTTGTGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATGTGGGAAACCTTCTCTCTCAGCCC
AGCCGCGCCCCATGGTTAAGGCAGGAGAGAGCGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATCTACCATCTA
TCAAGGGAGGGGGAGGCTCATGAACTTAGGTTCCCTGCAGTGCCCAAGGTCAATGGAACCTTCCAGGCCAACTTTCCTCT
GGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCCTACGAGTGGTCAGACCTTAGTG
ACCCACTGCTTGTTTCTGTCACAGGTGAGGAAA

IPD-KIR