Allele Report for 3DL3*0140203


3DL3*0140203
Previous Designations & Local Names: 3DL3_FH13_BA2_hap
IPD Acc No: KIR00626
Assigned: 31-MAR-2010 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182345  
Cells Sequence Derived From: FH13  
Known Ethnic Origin Of Source: Black
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (410 aa)
MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSF
LMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGI
TEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSR
YLHALIGTSVVIIPFAILLFFLLHRWCANKKNAVVMDQEPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQR
PKTPPTDTSV
Nucleotide Sequence Data (1233 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGGAGGGGCCCTGGCCACATGTGGGTGGTCAGGA
CAAGCCCTTCCTCTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACATGTGACTCTTCAGTGTCGCTCTCGTCTTG
GGTTTAATGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGCTCTACAACAGAATATTCCGGAACAGCTTT
CTCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCTGTGGTGATCATGGTCACAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCAGGAGAGACGGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTTCCTTCTGCACAGAGAGGGGATC
ACTGAGGACCCCTTGCGCCTCGTTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACTATTCCATGGGTCCCATGACACC
TGCCCTTGCAGGGACCTACAGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTGTCGGCTCCCAGTGACCCTCTGG
ACATCGTGGTCGTAGGTCTATATGGGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTG
ACCTTGTCCTGCAGCTCCCGGAGCTTGTTTGACATTTACCATCTATCCAGGGAGGCGGAGGCCGGTGAACTTAGGCTCAC
TGCAGTGCTGAGGGTCAATGGAACATTCCAGGCCAACTTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCCATGCGTGGTCAGACCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTAACTCCAGA
TACCTGCACGCTCTGATTGGGACCTCAGTGGTCATCATCCCCTTTGCTATCCTCCTCTTCTTTCTCCTTCATCGCTGGTG
TGCCAACAAAAAGAATGCTGTTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGGGAGGACTCTGATGAAC
AAGACCCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGG
CCCAAGACACCCCCAACAGATACCAGCGTGTAA
Genomic Sequence Data (12429 bps)
GTATGAGAGATTGGATCTGAGACGTGTTTTGAGTTGGTTATAGTGAAGGATGCAAGGTGTCAATTCTAGTTGGAACAATT
TCCAGGAAGCCATGTTCCGCTCTTGACCAAACAGCCACTGGGCCTCATGCAAGGTAGAAATAGCCTGCATACGTCATCCT
CCCATGATGTGGTCAGCATGTAAACTGCATGAGCCCCTCACAACATCCTGTGTGCTGCTGAACTGAGCTGGGGCGCAGCC
GCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAATCGAGG
GAGGGAGCGCTGGGGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATA
TAGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAACTGTAGATATGG
GCCTGAAGTAGAGATATGGGCCTGGAGTAGAGATATGGGCCTGGAACTGTAGATATGGGCCTGGAGTGGAGATATTGGCT
TGGAGTGCAGATATGGACCTGGAATTGAGATACGGGCCTGGAGGTGGAGATATGGGCCTAGAGTGGAGATATGGGCCTGG
AGGTGGAGATATGGGCCTGGAACTGTAGATATGGGCCTGGAGTAGAGATACGGGCCTGGAGTGGAGATGTTGGCTTGGAG
TGCAGATATGGGCCTGGAATGGAGACACGGGCCTGGAGGTGGAGATACAGGCCTGGAGGTGGAGATATGGGCCTGGAGTG
TAGATATGGGCCTGGAGTAGAGATATAGGACGGAGGTGGAGATATAGGCCTGGAGTGGAGATATGGGCCTGGAGTAGAGA
TATAGGACGGAGGTGGAGATATAGGCCTGGAGTGGAGATATGGGCCTAGAGGTGGAGATATGGGCCTGGAGTGGAGATAT
GGGCCTGGAGGTGATGTACAGATGGATCATCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGGAGGGGCCCTGGCC
ACATGTGGGTGAGTCCTTCCCCCAAACCTTAGGTTGTCATCTCCCCACATAAGATGATGCTCCTGAAACGGGAGGCAGGC
GACACAGGGGGTTGACTGATGGGCTGACCATGGGAAGCCATGTGGGAATCTCTCATGAACTAGGAAAAGGAAGCCAGGGG
AAGCTTCGCCACAGTTCTGTCCTAGCCCTCCCCGGCCTTTCTTTCCCTTGGCTGAGTCTGTGGGGACCCAGGGGGAGACT
GAAGTGCTCAAAGGAGTGGTGTGCAGGGAGGAAGTGGTGTCACCGGCAGAGGAAGGGAGAGAAGCAGTGCAAGGAACAAC
AGGCCTCTGAGGACAAGAGCATAACTCACACCCTCCAGCGTTTCCATGACGGTAGGGGCTGCAATGTGGCTGCTGTCATT
CTACCTAAGAGGTGGGGGAACCACAGTCATGACCCTGACATTCCAGATCTTCTAATAGGGGCTCAGTTGTTTATTATGGT
TCATGCATTAGCTGATCATGCCCTCCATCCTGTGTCTACCTTGTGTTCTTTTATGTAAGTAATTTTGCAGTGTTAAAATC
TAGTAAGAGTCGCTTCTTCAGCACCTGCTCAAAGTTCTCAGCTGACACTTGCTGTAGGGAGACGCCATGTCTATGCGGGA
TGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAGAAACGTGGAAATGGGAGAATCTTCTGAGCACA
GGGAGGGAGGGGCGGCTCCACATCCTCCTCTCTAAGGTGGTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAGCCCTTCCT
CTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACATGTGACTCTTCAGTGTCGCTCTCGTCTTGGGTTTAATGAAT
TCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGCTCTACAACAGAATATTCCGGAACAGCTTTCTCATGGGCCCT
GTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGTTCACACCCACACTCCCCCACTGGGTGGTCGGCACCCAGCAA
CCCTGTGGTGATCATGGTCACAGGTCAGAGGCTTTCTGTCTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTC
TGGTGGGGGCGTCCATCAGGGTCCAATCATCCAGGCCCCGACTGTATTTGGGGTAAAGGGGGATTCAGTACAGAGAAATA
GTTGCTGTGGTGGGAAGAATAATTGTCCCCAGTGATGGCTACATGGTAATCCATGAACCCTGTGACTATTTATGTTATAG
GGCAGGGGACTGAAGAGGAAGATGGAGCTCAGGTTGTTGATGAGTTGACCTTGCGATGGGGAGACAGCCTGGACTGTCCT
GCTGTGCTCAGAGTAATCACAAGGGTCCTCATGAGAGGAGGAGGAAGAGGAAAGTGGGGTTAGAGCAACGTCGTGGGAGG
GAGACTCCATCAGCCACAGCGGGCTTTGAAGATGGGGGAAGGCCATGAGCCACAAAGGCAGGTGGCCTCTAAGGGCTGGA
GAAGTCAAGGGAACTGATTCTTCCCTGAGTCTCCAGAGGAAACACAGCCCTGCAGATGCCTTGATTTTAGCCCAGAGAGA
ACTGGGTCCGATTTCTGTTCTCCAGAAGTGGAAGGGGTCATTGTATTCTCTCCTGCCCCATGTTTGTGACAATTTTCTCC
AGCAGCAACAGGAAACCAACACAGGAACCCAGGTGAAGCACAGGTTAAGAAACCAAACAAGGAGAAGGTTGGCTACACTG
ATTTTAGCATGGGTGGGATACTGATGCTACCACCAGGCTCGATCCACATAGGGAGGGGTTGATGCTCCTGGAACCAGCAC
CAGGGGCCACCCTATGGAAGCTGGGGCCATGGAGAAGGCACAGACATGAAAGGAGAGGCTCCCAATCCCCATCAGGAACA
GGGACACTGATGCCTGCCTTACTGATGAGTTCGTACCTCCTGCCGGCCTTTCCAATCTGTCCAAAAGAGATTGATTCAGG
CTGCTAAGAGCCTGGACATGCAGCCTGTCATGGTTCCTCTTCCACCCCCACATAAACACCAGGAAAGAGATTAGTGGGAA
ACAGATACAACAGCCTAAGAGGTGACACTGAGCACAGTGGGAAGGGAATCAGGGCTACTAGAGACAGAGAGACAGGGAAG
AGGGAGGGAGACAGATGGAGGGACCTGCAACAGGGGTTATGGGCACAAAAGAACACGGAGACACAGACAGGAAGGAGAGA
GATAGACACCATGGAGGGGAAGCCTCACTTATTTCAGGTCCCATGAATGGGATGAGAAAGGGAGACGCCTTCTGAACTCA
CAACCTCTCTTCTTAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGGTGAAATCAGGAGAGACGGT
CATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTTCCTTCTGCACAGAGAGGGGATCACTGAGGACCCCTTGCGCC
TCGTTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACTATTCCATGGGTCCCATGACACCTGCCCTTGCAGGGACCTAC
AGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTGTCGGCTCCCAGTGACCCTCTGGACATCGTGGTCGTAGGTGA
GAGAATACAGACCTGCCTCTCACCCTTGCTGGGAGATGGAGTGAATGATCTAGGACTGGAAGCCCCAGGTGGTCATGAGG
AAGATGAGTGTGGGGTTCCTATGGAGAGAAAGTGACTTGGTGAGGTCTGTACCAACAAAGGCAGAGAAACAGGAGACACA
AGTACAGACCTCATGTCATAACATAGAAGCCAGACACAGGGGCCATACAAGGTGTTAGAAAAAGAGATAAAGAGGTAAAG
AAGACACAGAGAGACAGACATATCCCAGAGAGAGGTGTCCTTCTATGCTGACTTTGTTCAGAGACCAGGCACAGGTTAGA
AGGTTCCATTCTGTTTTACCTCTACAAAGTGTTCTCTCCCAGGAGAACCCAAAGAGACACATCTATCTGGCCTGAGTTGG
GCCATGTGGCCCCAGGCTGGTGGCACCTACAGATGTTGTGTTTATTCTTAAACCTCTGCCTTCCGTGCAGTGGAGCTGTC
ATCGTCCCAGGACACCATGGCCCCAGGTGAGGGAGCAGAACACCAACCCCTGTATGCTGTGAGTTCCTGGAGTCCCCATA
CTGGATTCTGAGGCTCATATTCAAATAGCACCACATGTTATAGGATTACTGAGAACAAAAGCCCACAGAGAGACACGGAG
TGAAATCAGGGAAATCAAAAAGCAAAGACATGAACACACACACAGAATGAGCCAGAAGAAGGGAATTGAGAGACTCACAG
ACACATAAAGAGATAGAAAAAGAGGGCAGAGAAGTGGAGCGTATGATGGAAGGAAGCAGAGAAAAGCCCTAAAATCAGAG
CCCTGAGGGAGGGGCACAAAGACAGGGAAAGATAAAGATGTGAGGATGGATTGCAGAGACTCCAAAAGGGAACTAGAGAG
ACTGAGAGGCAGAGAAAGACAAGGAGATGGAGAGAGACAGATGATAGATGGACAGATAGATATAGATAGATGAAAGATAA
AAGGTAGATGATAGATAATAGAGAGACAGGTGATAGACAAATAGATGATGAATGACTGATAGATGATATAGATAGACAAG
TAGAAAGACAGACAGATGATATATAAATAGATATAGAGAGATAGAAAGACAGATAAACACATGATGATAGATGGATAGAT
GCATACATACATACATTGATTGATAGATGATAGATAACAGAGAGATAGGTCATAGATACACAGATGATGATAGATGATAG
ATACATACATAGATAAATGATAGATCGATCAATAGATAATAGATAGAAATATGCAGAAAGTTATGAGCAAGACAGAAAGT
GAGAGACTCAGAATTAAAGAAAGAGGAAGATCAAGTCAACCAGTCCAAGGAGGGTCAGAGAGAATAAAATGGTACAAAAA
AAGAAAACATAGCTAGGGATGGAGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGA
AGAGAGATGGGGGTGGAGGGTGAGAGAGAGAAAGAGAGCATTAAGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTG
TGAGGAGAGCTGTGACAAGGAAGAACCTCCCTGAGGAAACCACCTCTTCTTCTTCCAGGTCTATATGGGAAACCTTCTCT
CTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTTGTTTGACATTT
ACCATCTATCCAGGGAGGCGGAGGCCGGTGAACTTAGGCTCACTGCAGTGCTGAGGGTCAATGGAACATTCCAGGCCAAC
TTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGATGCTTCGGCTCTTTCCGTGCCCTGCCCCATGCGTGGTCAGA
CCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTGAGAAAACACCATGCCTGTCCCATGTCTTGTGATCCTAGAGCCATA
GCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCCGAGACAGAACACACAGCATGGGTGTAAGGGCGG
GGTCAGGGCGCAGGATGGCAGACAGGGCACCTCCAAACCCTCCTGTATGGCCTGCAAGGATGCCCTTGATCAGGGTTCCA
GGCACCCAGGCAGATGGAGAAAGAGGTCAGAACAGACCCAGAGGAGGGAGACTGGGCTCTGCCTGGGGAGATCAGAGGTT
CTCTCAGCCCCTCAACCTTACCCACTTCCCAGAAGCCCATCCTGGCCTGTCACCCACAGAGAGATGTCATCACCAGCAAC
GCCTACACCCTTTTCTTTTTGTTTGAAGAAATATTTATTGAGGTGAAATATACCTATGTAATTTACCACCTTTACCATTT
TTAAGTGTGAAGTCTACTGTTCATAAATACATTTATAGGCTGGGCACGGTGGCTCACGGTTGTAATCCCAACACTTTGAG
AGGCCAAGGCAGGTGGATCATTTGAGATCAGGGGCTCAAGACCACCCTGGCCAACATGGGGAAAATCCATCTGTACTAAA
AATACAAAATAATAATTATAATGATAATAATTAGCCGAGCATGGTGGCACATGCCTGTAGTCCCAGCTACTTGGTAGGGT
TGGGCAGGAGTTGCACTTAATTGCAGGAGGCGGAGGTTGCAGTGAGCTGAGATCATGCCACTGCACTGCAGCCTGGGCAA
CAGAGAGAGACACTCTCTCAAAATTAATTAATTAATTAATTAGTATTCTTTTTTTTTTACCCTCCACCCTTCCCTTCCTG
GCCTCTGGTAGCCACCATTCTACTCTCTACCTTTGTGAGATCCACCTTTTAGCTCCTGCATATGAGTGAGAAATGGAAAT
ACTTGTAATGACCTCCAGTTCCATTCATGTGGCTGTAAATGACAGGATGTTACTCTTTCTATGGATGAGTTGTCCCTATT
GTGTGTGTGTACCACATTCTCTCCATCCATTCACCCACTGATGGGCAGGTAGGTTGATCCACATCTTGGCTACTGTGAAC
ACTGCTGGAACAGTCATGGGAGTGCAGATGTCACTTCGATACGCTGATGTCCTTTCCTTTGGGTTTACACCCAGTCATGG
AATTGCTAGATCCTCTGGAAGTGTCTTTTTACATTTTGTTTTATGGTTTTTGTTTTTGTTTTTGTTTTTTTTAGACTGTT
TCACTCTTGTTGCCCAGGCTGGAGTGCAGTGGCGCCATCTGGGCTCACTGCAACCTCCACCTCCAGGATTCAAGAGATTC
CCCAGCCTCAGCCTCCCAAGTAGCTGGGTTACTGGCTCCCACCACCACACTCGGCTAATTTTTATATTTTTAGTAGAGAC
AGAGTTTCGCTATATTGGCCAGGCTGCTCTTCAACTCCTGACCTCAAGTGACCTACCCACCTCGGCCTCCCAATGTGCTG
GGATTACAGGCATGAACCACTGTGCCCGACCTCATTTTATTTTTTGAGGAACTTCCATACTCTTCTCCTCTGTAATGGCT
GTACTAATTTACATTCGTATCAGCAGTGTACCAGATGCAACCCTGGTTGACTCAGCAGAGCAAGAGACGTGCAGTAAGAG
AGAATTTAGCTTATTTATGCACACGACACTTCCACTCACTCACTCGTTCAGCCAATGCCCCATGCTCAGGCTGTGCAGTG
TGGAATCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGCTTCGTGGATGAAAACATGTTTTTCTTAATTATCTCACA
GTGCTGTAACTCAGAAGTATGAACTGCATTTCACTGGGCTGATATCAAAGGGACAGTAAGGCTGGATTTCTTTTTAAGGT
TCCAAGCAAGAATCTGCTCCTTAACGTTTCCCAGCTCCTAGAGGCTCCCACGTTCCTGGGCCCCTGGTCCCCTTCCTCCT
TCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACGTCTCACATGGCATCATTCAGACTCTTCTTCTTTACCCACACCTTT
TTCTCTGAATCCTGCTCTGCCTTCTTCCTCATCTTTTAAGGACTTTGGGATTCTATTGGGGTCACCAAGATAATCCATCT
CAATCTCCCTAAAATCATCCAGCGTACCCTCTTTTTAAGTTCAGCTGATTAGCAACCGTAATGCCATCTGCAATCTTCAT
TCCTCCTTTCCTGTAAAATAACATATTCACAAGCTATGGAGGCTAAGACAGGGACATTTTGGGGGTGGGGCAGCATTCTC
CTGCCTTCCACAAATGGTAAACAGGATGCATTTGGCCTCTGCTCTTGGGACGCTGATATTGCAGATGGGTAAATGCGAGG
GCAGAGAATGAATGCACAAGGGTACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCACCAAATCTGGGGTTTTTTG
TGTGTGTGTGTGTTTTTTGTTTTCTTTTTTTTTTTGAGTAGAGTCTCTCTCTGTTCCACAGGCTGGAGTGCAGTAGCACA
ATCTCAGCTCATTGCAACCTCTGCCTCCTGGGTTCATGCAATTCTCCTGCCTCAGCCTACCGAGTAGCTGGGATTACAGC
TGTGCGCCACCACACTCGGCTAATTTTTTTGGTATATTTTTTTAGTAGAAATGAGGTTTCACCATGTTGTGCAGGCTGTC
TCAAACTCCCAATCTCAAGTGATCCCACCGCCTTAGCGTCCCTAAGTGCAAAGATTACAGGCGAGAGCTACTGCGCCCAG
CCAGGATTTAAAATAAGTAATAGATAATGCTGAGTATATAATTTCAGGTGACAGAGAAGGTCTCACTGATCAGATAATAT
TTGTGACCTTAATGGAAAAAATGGATTCAACCCTTGGAAGATTGGCGGAAGGATTTTCCACACTGAGCTCTCAGCCGTGA
AGGCACAAAGGTGGAAACATTCTTAGTTCAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGAAGTGGGGAGAATGACAA
GACAACTGTAGAGAGATGGAGAGCACACTGGGTACACAGGAAACTAAGGAGGAACAAGGAGCGTGTGTTTGATACTCACA
GCCATTGGATTCAACTCAGAGCTAACTAGGAATCCCTACCTGATTAATAGTGACCGACATGAAAATAAGGGAGGCCCAGG
TGCGTAACTGGAATCTAGGAGACGGTGGAAAAGGCAATTCCCGCCCCACTGGTGAAACGTAGGGTTGATTTACACACTAA
ATGAATGAAAGATGGATATAAGCTATGCTTGTGAGGTAGAATCATTTGCAGGGAGGGCTTGCTGGGTTTGATTTTTCCTA
GTAGTTTAATCCTTGTTTCATTAATTTCTTTCTGAGATGTGTTTTTTTTCTACATCTAAATCCATACCTGGCAGAGGAGC
GATAGACACATGAGGGGTGGTGCAAATGAAGGGACCTAGTATAATATAATATACAAGACTGTGGATGGGGGCTCACACCT
GTAACCCAACACTTTGGGAGGCCAAGGCGGGTAGATCACTTAAGGGTAGGAGTTTGAGACCAGCCTGGCCAACATGGTGA
AACCCCGTCTGTACTAAAAATACAAAAATTAGCCTGGTGCATTGGCACCTGCCTGTAATCCCAGCGACTGGGGAGGCTGA
AGCAGAAGAATGGCTTCAACCCTGGAGGCAGAGGTTGAACTGAGATCGCATCACTGCACTCCAGCCTGACACAGGGGGAC
TCTGTCTCAAAAAATAAAAATAAAACATACATAATTATAATATGACACACAGAAATTACAAAGGCAACTGGATACCAACC
ATCATTTTTCTATTTCTCTGTGTTTAATTCTTTGACCCTTTATCTTATCCATTAAACAATCAGGTTAAACCTCTTCCTTA
TTTGGCTTTCTGTGAGCTTGGGATCATATGGAAAATGTGAAAGCCTCCTGAACCCACCAGCACAGGTCCTGGAATAGAGA
ACGTGCTCTGTTCATGGCATAAAACTTGCCCCTTCACCCAAATCCCCCAATTCATCTCTACTTCCAATCACCTATGGAGA
TACAGATAGATCATGGGGAGGTAAACACTAATACTCTTTGGAGTGAGCTCAGATCTTGGACTCAGAGACCAGTGCCAGCA
CTAGCCCCTGGTCACATTTCGTACTAACTCACAGAAGGACAGGCTGTATTGAAACAATAAACGACGGAGAGGGCGGTCCT
TCCCCGTGCTTCTCGGGTGGAATAGCAGCCTAATATATGTCTCAGCAGATCACAAAAAGTAGCATGTTGTTCCTGGGCTA
CATCATTATTTCATGGCTGTTTGATTTAAGTCAGTTCTACTTCACTTTTTTTATCTTGATTTCATTTTTTCTTTCTTTTC
TTGGAGAATGTAATTTTTTTGAGTCAAGAGGGTTGTGGTGGTAGAAACTGTAAAGCACATTCGCTGTGTATCAATCCCAA
TCCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGAATGTACCTGGGCCTATACCAATTCCTATCACTCACCGTCACT
CCAGGGAGACAGAACACACAGAGAACACATTACACAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAG
CCTACATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGAGACATGTGGAGTCACCCCATATGCAGTGTA
TCTGGGGGAAATCAAAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATG
ACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGGGATGTTCCTCCTGATCTCAGGACTTTGCTGTCTT
AGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAAAGAAATGTGTTTGCCTCACAGTTCT
GCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCTTGTGACGGCCTCAGGCTGCTCCCGCTCTGGCAGAAGGGAAG
GAGGGTCTATCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGGGAGCGATGGAGCTTCCA
AGTTCTTTTTAACAACCAGCTCTCCAGGAACTAATAGAGGGGGAACTTGCTAACCCCATCTCCTTGGGACAGCATTGATC
TGTTCATGATGGATCCACCTCCATGACCCAAACACCTCCCAAGAGGCCCAACCTCCCACCCTGGGGGTTACATTTCAATG
TGAGGTTTGAAGTGGTCAAACATCTAAACTAAAGCAGTTGTATCCTCAGCACGTTCTATGGTTACTACAACTGAGAAAGC
AGGAGGAAGCTAGGTCTCCCGCCATCTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGTCAATCAAGAAATG
TGAGACAATTCATATAGAGGAACTGCTATGATTAGCTTCTTATTGGTGTCTTGTCTTCCTCCAGGTAACTCCAGATACCT
GCACGCTCTGATTGGGACCTCAGTGGTCATCATCCCCTTTGCTATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGTGCCA
ACAAAAAGAGTAAGTCTCACGAAGCAGAAGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACTCAGGTGT
GTGTTCCTTACAGGCAGGATGGTCCCTGACCCAAGGCAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGACTC
CCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACCATATCCTCACATCCCCTGCAGCCACTCACATCCAG
GAGAAGGTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCT
TGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGCATGT
TGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTGTTTTGACGACTTCCGTCTTCTACAGATGCTGTTG
TAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGGGAGGTAGGTGCTCCTCAGCCCAGCCTCATGGCTAGTCTT
ATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCCCTCCAGGACTCTGATGAACAAGAC
CCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAA
GACACCCCCAACAGATACCAGCGTGTAACACGGAACTTCCAAATGCTGAGCGCAGATCCAAAGTTGTCTTCTGTCCACCA
GCACCACAGTCAGGCCTTGATGGGATCTTCTAGGGAGACAATAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTAC
CAGCAGCTGGAATCTGAAGGCGTGAGTCTGCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAACATGCCTCTC
TCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCCATT
TCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACTTGAGGCTGCGATCACACTGAGGAACT
CACAATTCCAAACATATAAGAGGCTCCCTCTTAACACGGCACTTAGATACATGCTATTCCACCTTTCCTCATGTTGTTCC
ACCTTTCCTCAGAGTATCTTTCAGCCTTCTGTCAGCAGTAAAACTTATAAATTTTTTTTATAATTTCAATGTAGTTTTCT
ATTCTTCAAGTAAACATGTCTGCCCTCAT

IPD-KIR