Allele Report for 3DL3*0090103


3DL3*0090103
Previous Designations & Local Names: FH06_A_hap
IPD Acc No: KIR00484
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182340  
Cells Sequence Derived From: FH06  
Known Ethnic Origin Of Source: Hispanic
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (410 aa)
MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSF
LMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGI
TEDPLRLIGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSR
HLHVLIGTSVVIIPFAILLFFLLHRWCANKKNAVVMDQEPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQR
PKTPPTDTSV
Nucleotide Sequence Data (1233 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGGAGGGGCCCTGGCCACATGTGGGTGGTCAGGA
CAAGCCCTTCCTCTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACATGTGACTCTTCAGTGTCGCTCTCGTCTTG
GGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGCTCTACAACAGAATATTCCGGAACAGCTTT
CTCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCTGTGGTGATCATGGTCACAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCGGGAGAGACGGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTTCCTTCTGCACAGAGAGGGGATC
ACTGAGGACCCCTTGCGCCTCATTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACTATTCCATGGGTCCCATGACACC
TGCCCTTGCAGGGACCTACAGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTGTCGGCTCCCAGTGACCCTCTGG
ACATCGTGGTCGTAGGTCTATATGGGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTG
ACCTTGTCCTGCAGCTCCCGGAGCTTGTTTGACATTTACCATCTATCCAGGGAGGCAGAGGCCGGTGAACTTAGGCTCAC
TGCGGTGCTGAGGGTCAATGGAACATTCCAGGCCAACTTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCCACGCGTGGTCAGACCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTAACTCCAGA
CACCTGCACGTTCTGATTGGGACCTCAGTGGTCATCATCCCCTTTGCTATCCTCCTCTTCTTTCTCCTTCATCGCTGGTG
TGCCAACAAAAAGAATGCTGTTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGGGAGGACTCTGATGAAC
AAGACCCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGG
CCCAAGACACCCCCAACAGATACCAGCGTGTAA
Genomic Sequence Data (12357 bps)
GTATGAGAGATTGGATCTGAGACGTGTTTTGAGTTGGTTATAGTGAAGGATGCAAGGTGTCAATTCTAGTTGGAACAATT
TCCAGGAAGCCATGTTCTGCTCTTGACCAAACAGCCACTGGGCCTCATGCAAGGTAGAAATAGCCTGCATACGTCATCCT
CCCATGATGTGGTCAGCATGTAAACTGCATGAGCCCCTCACAACATCCTGTGTGCTGCTGAACTGAGCTGGGGCGCAGCC
GCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAATCGAGG
GAGGGAGCGGTGGGGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATA
TAGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAACTGTAGATATGG
GCCTGAAGTAGAGATATGGGCCTGGAGTAGAGATATGGGCCTGGAACTGTAGATATGGGCCTGGAGTGGAGATATTGGCT
TGGAGTGCAGATATGGACCTGGAATTGAGATACGGGCCTGGAGGTGGAGATATGGGCCTAGAGTGGAGATATGGGCCTGG
AGGTGGAGATATGGGCCTGGAACTGTAGATATGGGCCTGGAGTAGAGATATGGGCCTGGAGTGGAGATGTTGGCTTGGAG
TGCAGATATGGGCCTGGAATGGAGACACGGGCCTGGAGGTGGAGATACAGGCCTGGAGGTGGAGATATGGGCCTGGAGTG
TAGATATGGGCCTGGAGTAGAGATATAGGACAGAGGTGGAGATATAGGCCTGGAGTGGAGATATGGGCCTGGAGTAGAGA
TATAGGACGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTGATGTACAGATGGATCATCCATCATGA
TCTTTCTTTCCAGGGTTCTTCTTGCTGGAGGGGCCCTGGCCACATGTGGGTGAGTCCTTCCCCCAAACCTTAGGTTGTCA
TCTCCCCACATAAGATGATGTTCCTGAAACGGGAGGCAGGCGACACAGGGGGTTGACTGATGGGCTGACCATGGGAAGCC
ATGTGGGAATCTCTCATGAACTAGGAAAAGGAAGCCAGGGGAAGCTTCGCCACAGTTCTGTCCTAGCCCTCCCCGGCCTT
TCTTTCCCTTGGCTGAGTCTGTGGGGACCCAGGGGGAGACTGAAGTGCTCAAAGGAGTGGTGTGCAGGGAGGAAGTGGTG
TCACCGGCAGAGGAAGGGAGAGAAGCAGTGCAAGGAACAACAGGCCTCTGAGGACAAGAGCATAACTCACACCCTCCAGC
GTTTCCATGACGGTAGGGGCTGCAATGTGGCTGCTGTCATTCTACCTAAGAGGTGGGGGAACCACAGTCATGACCCTGAC
ATTCCAGATCTTCTAATAGGGGCTCAGTTGTTTATTATGGTTCATGCATTAGCTGATCATGCCCTCCATCCTGTGTCTAC
CTTGTGTTCTTTTATGTAAGTAATTTTGCAGTGTTAAAATCTAGTAAGAGTCGCTTCTTCAGCACCTGCTCAAAGTTCTC
AGCTGACACTTGCTGTAGGGAGACGCCATGTCTATGCGGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAG
GAGCCTTAGAAACGTGGAAATGGGAGAATCTTCTGAGCACAGGGAGGGAGGGGCGGCTCCACATCCTCCTCTCTAAGGTA
GTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAGCCCTTCCTCTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACA
TGTGACTCTTCAGTGTCGCTCTCGTCTTGGGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGC
TCTACAACAGAATATTCCGGAACAGCTTTCTCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGT
TCACACCCACACTCCCCCACTGGGTGGTCGGCACCCAGCAACCCTGTGGTGATCATGGTCACAGGTCAGAGGCTTTCTGT
CTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCATCAGGGTCCAATCATCCAGGCCCA
GACTGTATTTGGGGTAAAGGGGGATTCAGTACAGAGAAATAGTTGCTGTGGTGGGAAGAATAATTGTCCCCAGTGATGGC
TACATGGTAATCCATGAACCCTGTGACTATTTATGTCATAGGGCAGGGGACTGAAGGGGAAGATGGAGCTCAGGTTGTTG
ATGGGTTGACCTTGCGATGGGGAGACAGCCTGGACTGTCCTGCTGTGCTCAGAGTAATCACAAGGGTCCTCATGAGAGGA
GGAGGAAGAGGAAAGTGGGGTTAGAGCAACGTCGTGGGAGGGAGACTCCATCAGCCACAGCGGGCTTTGAAGATGGGGGA
AGGCCATGAGCCACAAAGGCAGTTGGCCTCTAAGGGCTGGAGAAGTCAAGGGAACTGATTCTTCCCTGAGTCTCCAGAGG
AAACACAGCCCTGTAGATGCCTTGATTTTAGCCCAGAGAGAACTGGGTCCGATTTCTGTTCTCCAGAAGTGGAAGGGGTC
ATTGTATTCTCTCCTGCCCCATGTTTGTGACAATTTTCTCCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTGAAGC
ACAAGTTAAGAAACCAAACAAGGAGAAGGTTGGCTACACTGATTTTAGCATGGGTGGGATACTGATGCTACCACCAGGCT
CGATCCACATAGGGAGGGGTTGATGCTCCTGGAACCAGCACCAGGGGCCACCCTATGGAAGCTGGGGCCATGGAGAAGGC
ACAGACATGACAGGAGAGGCTCCCAATCCCCATCAGGAACAGGGACACTGATGCCTGCCTTACTGATGAGTTCGTACCTC
CTGCCAGCCTTTCCAATCTGTCCAAAAGAGATTGATTCAGGCTGCTAAGAGCCTGGACATGCAGCCTGTCGTGGTTCCTC
TTCCACCCCCACATAAACACCAGGAAAGAGATTAGTGGGAAACAGATACAACAGCATAAGAGGTGACACTGAGCACAGTG
GGAAGGGAATCAGGGCTACTAGAGACAGAGAGACAGGGAAGAGGGAGGGAGACAGATGGAGGGACCTGCAACAGGGGTTA
TGGGCACAAAAGAACACGGAGACACAGAGAGGAAGGAGAGAGATAGACACCATGGAGGGGAAGCCTCACTTATTTCAGGT
CCCATGAATGGGATGAGAAAGGGAGACGCCTTCTGAACTCACAACCTCTCTTCTTAGGAGTCCACAGAAAACCTTCCCTC
CTGGCCCACCCAGGTCCCCTGGTGAAATCGGGAGAGACGGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTT
CCTTCTGCACAGAGAGGGGATCACTGAGGACCCCTTGCGCCTCATTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACT
ATTCCATGGGTCCCATGACACCTGCCCTTGCAGGGACCTACAGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTG
TCGGCTCCCAGTGACCCTCTGGACATCGTGGTCGTAGGTGAGAGAATACAGACCTGCCTCTCACCCTTGCTGGGAGATGG
AGTGAATGATCTAGGACTGGAAGCCCCAGGTGGTCATGAGGAAGATGAGTGTGGGGTTCCTATGGAGAGAAAGTGACTTG
GTGAGGTCTGTACCAACAAAGGCAGAGAAACAGGAGACACAAGTACAGACCTCATGTCATAACATAGAAGCCAGACACAG
GGGCCATACAAGGTGTTAGAAAAAGAGATAAAGAGGTAAAGAAGACACAGAGAGACAGATATATCCCAGAGAGAGGTGTC
CTTCTATGCTGACTTTGTTCAGAGACCAGGCACAGGTTAGAAGGTTCCATTCTGTTTTACCTCTACAAAGTGTTCTCTCC
CAGGAGAACCCAAAGAGACACATCTATCTGGCCTGAGTTGGGCCGTGTGGCCCCAGGCTGGTGGCACCTACAGATGCTGT
GTTTATTCTTAAACCTCTGCCTTCCGTGCAGTGGAGCTGTCGTCGTCGCAGGACACCATGGCCCCAGGTGAGGGAGCAGA
ACACCAACCCCTGTATGTTGTGAGTTCCTGGAGTCCCCATACTGGATTCTGAGGCTCATATTCAAATAGCACCACATGTT
ATAGGATTACTGAGAACAAAAGCCCACAGAGAGACACGGAGTGAAATCAGGGAAATCAAAAAGCAAAGACATGAACACAC
ACACAGAATGAGCCAGAAGAAGGGAATTGAGAGACTCACAGACACATAAAGAGATAGAAAAAGAGGGCAGAGAAGTGGAG
CGTATGATGGAAGGAAGCAGAGAAAAGCCCTAAAATCAGAGCCCTGAGGGAGGGGCACAAAGACAGGGAAAGATAAAGAT
GTGGGGATGGATTGCAGAGACTCCAAAAGGGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGATGGAGAGAGACA
GATGATAGATGGATAGATAGATATAGATAGATGAAAGATAAAAGGTAGATGATAGATAATAGAGAGACAGGTGATAGACA
AATAGATGATGAATGACTGATAGATGATATAGATAGACAAGTAGAAAGACAGACAGATGATATATAAATAGATATAGAGA
GATAGAAAGATAAACACATGATGATAGATGGATAGATGCATACATACATACATTGATTGATAGATGATAGATAACAGAGA
GATAGGTCATAGATACACAGATGATGATAGATGATAGATACATACATAGATAAATGATAGATCGATCAATAGATAGTAGA
TAGAAATATGCAGAAAGTTATGAGCAAGACAGAAAGTGAGAGACTCAGAATTAAAGAAAGAGGAAGATCAAGTCAACCAG
TCCAAGGAGGGTCAGAGAGAATAAAATGGTACAAAAAAAGAAAACATAGCTAGGGATGGAGAAGTGAGGTCAGAGACCTA
GAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGATGGGGGTGGAGGGTGAGAGAGAGAAAGAGAGCATTA
AGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGTGAGGAGAGCTGTGACAACGAAGAACCTCCCTGAGGAAACCAC
CTCTTCTCCTTCCAGGTCTATATGGGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTG
ACCTTGTCCTGCAGCTCCCGGAGCTTGTTTGACATTTACCATCTATCCAGGGAGGCAGAGGCCGGTGAACTTAGGCTCAC
TGCGGTGCTGAGGGTCAATGGAACATTCCAGGCCAACTTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCCACGCGTGGTCAGACCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTGAGAAAACA
CCATGCCTGTCCCATGTCTTGTGATCCTAGAGCCATAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGA
TGCCGAGACAGAACACACAGCATGGGTGTAAGGGCGGGGTCAGGGGGCAGGATGGCAGACAGGGCACCTCCAAACCCTCC
TGTATGGCCTGCAAGGAGGCCCTTGATCAGGGTTCCAGGCACCCAGGCAGATGGAGAAAGAGGTCAGAACAGACCCAGAG
GAGGGAGACTGGGCTCTGCCTGGGGAGATCAGAGGTTCTCTCAGCCCCTCAACCTTACCCACTTCCCAGAAGCCCATCCT
GGCCTGTCACCCACAGAGAGATGTCATCACCAGCAACGCCTACACCCTTTTCTTTTTGTTTGAAGAAATATTTATTGAGG
TGAAATATACCTATGTAATTTACCACCTTTACCATTTTTAAGTGTGAAGTCTACTGTTCATAAATACATTTATAGGCTGG
GCACGGTGGCTCACTGTTGTAATCCCAACACTTTGAGAGGCCAAGGCAGGTGGATCATTTGAGATCAGGGGCTCAAGACC
ACCCTGGCCAACATGGGGAAAATCCATCTGTACTAAAAATACAAAATAATAATAATAATGATAATAATTAGCCGAGCATG
GTGGCACATGCCTGTAGTCCCAGCTACTTGGGAGGGTTGGGCAGGAGTTGCACTTAATTGCAGGAGGCGGAGGTTGCAGT
GAGCTGAGATCATGCCACTGCACTGCAGCCTGGGCAACAGAGAGAGACACTCTCTCAAAATTAATTAATTAATTAATTAG
TATTCTTTTTTTTTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTAGCCACCATTCTACTCTCTACCTTTGTGAGATCC
ACCTTTTAGCTCCTGCATATGAGTGAGAAATGGAAATACTTGTAATGACCTCCAGTTCCATTCATGTGGCTGTAAATGAC
AGGATGTTACTCTTTCTATGGATGAGTTGTCCCTATTGTGTGTGTGTACCACATTCTCTCCATCCATTCACCCACTGATG
GGCAGGTAGGTTGATCCACATCTTGGCTACTGTGAACACTGCTGGAACAGTCATGGGAGTGCAGATGTCACTTCGATACG
CTGATGTCCTTTCCTTTGGGTTTACACCCAGTCATGGAATTGCTAGATCCTCTGGAAGTGTCTTTTTACATTTTGTTTTA
TGGTTTTTGTTTTTGTTTTTGTTTTTTTTAGACAGTTTCACTCTTGTTGCCCAGGCTGGAGTGCAGTGGTGCCATCTGGG
CTCACTGCAACCTCCACCTCCAGGATTCAAGAGATTCCCCAGCCTCAGCCTCCCAAGTAGCTGGGTTACTGGCTCCCACC
ACCACACTCGGCTAATTTTTATATTTTTAGTAGAGACAGAGTTTCGCTATATTGGCCAGGCTGCTCTTCAACTCCTGACC
TCAAGTGACCTACCCACCTCGGCCTCCCAATGTGCTGGGATTACAGGCATGAACCACTGTGCCCGACCTCATTTTATTTT
TTGAGGAACTTCCATACTCTTCTCCTCTGTAATGGCTGTACTAATTTGCATTCGTATCAGCAGTGTACCAGATGCAACCC
TGGTTGACTCAGCAGAGCAAGAGACGTGCAGTAAGAGAGAATTTAGCTTATTTATGCACACGACACTTCCACTCACTCAC
TCGTTCAGCCAATGCCCCATGCTCTGGCTGTGCAGTGTGGAATCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGCT
TCGTGGATGAAAACATGTTTTTCTTAATTATCTCACAGTGCTGTAACTCAGAAGTATGAACTGCATTTCACTGGGCTGAT
ATCAAAGGGACAGTAAGGCTGGATTTCTTTTTAAGGTTCCAAGCAAGAATCTGCTCCTTAACGTTTCCCAGCTCCTAGAG
GCTCCCACGTTCCTGGGCCCCTGGTCCCCTTCCTCCTTCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACGTCTCACAT
GGCATCATTCAGACTCTTCTTCTTTACCCATACCTTTTTCTCTGAATCCTGCTCTGCCTTCTTCCTCATCTTTTAAGGAC
TTTGGGATTCTATTGGGGTCACCAAGATAATCCATCTCAATCTCCCTAAAATCATCCAGCGTACCCTCTTTTTAAGTTCA
GCTGATTAGCAACCGTAATGCCATCTGCAATCTTCATTCCTCCTTTCCTGTAAAATAACATATTCACAAGCTATGGAGGC
TAAGACAGGGACATTTTGGGGGTGGGGCAGCATTCTCCTGCCTTCCACAAATGGTAAACAGGATGCATTTGGCCTCTGCT
CTTGGGACGCTGATATTGCAGATGGGTAAATGCGAGGGCAGAGAATGAATGCACAAGGGTACCAATAAATGAATGATCCA
TTGGGAAGCATCTGTGCACCAAATCTGGGGTTTTTTGTGTGTGTGTGTGTTTTTTGTTTTCTTTTTTTTTTTTGAGTAGA
GTCTCTCTCTGTTCCACAGGCTGGAGTGCAGTAGCACAATCTCAGCTCATTGCAACCTCTGCCTCCTGGGTTCATGCAAT
TCTCCTGCCTCAGCCTACCGAGTAGCTGGGATTACAGCTGTGCGCCACCACACTCGGCTAATTTTTTTGGTATATTTTTT
AGTAGAAATGAGGTTTCACCATGTTGTGCAGGCTGTCTCAAACTCCCAATCTCAAGTGATCCCACCGCCTTAGCGTCCCT
AAGTGCAAAGATTACAGGCGAGAGCTACTGCGCCCAGCCAGGATTTAAAATAAGTAATAGATAATGCTGAGTATATAATT
TCAGGTGACAGAGAAGGTCTCACTGATCAGATAATATTTGTGACCTTAATGGAAAAAATGGATTCAACCCTTGGAAGATT
GGCGGAAGGATTTTCCACACTGAGCTCTCAGCCGTGAAGGCACAAAGGTGGAAACATTCTTAGTTCAAGGAAGAGGCTCT
GCCTCAAATGCTGGGAATGAGATGGGGAGAATGACAAGACAACTGTAGAGAGATGGAGAGCACACTGGGTACACAGGAAA
CTAAGGAGGAACAAGGAGCATGTTTTTGATACTCACAGCCCTTGGATTCAACTCAGAGCTAACTAGGAATCCCTACCTGA
TTAACAGTGACCGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTCCCG
CCCCACTGGTGAAACGTAGGGTTGATTTACACACTAAATGAATGAAAGATGGATATAAGCTATGCTTGTGAGGTAGAATC
ATTTGCAGGGAGGGCTTGCTGGGTTTGATTTTTCCTAGTAGTTTAATCCTTGTTTCATTAATTTCTTTCTGAGATGTGTT
TTTTTTCTACATCTAAATCAATACCTGGCAGAGGAGCGATAGACACATGAGGGGTGGTGCAAATGAAGGGACCTAGTATA
ATATAATATACAAGACTGTGGATGGGGGCTCACACCTGTAACCCAACACTTTGGGAGGCCAAGGCGGGTAGATCACTTAA
GGGTAGGAGTTTGAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTGTACTAAAAATACAAAAATTAGCCTGGTGCATT
GGCACCTGCCTGTAATCCCAGCGACTGGGGAGGCTGAAGCAGAAGAATGGCTTCAACCCTGGAGGCAGAGGTTGAACTGA
GATCGCATCACTGCACTCCAGCCTGACACAGGGGGACTCTGTCTCAAAAAATAAAAATAAAACATACATAATTATGACAC
ACAGAAATTACAAAGGCAACTGGATACCAACCATCATTTTTCTATTTCTCTGTGTTTAATTCTTTGACCCTTTATCTTAT
CCATTAAACAATCAGGTTAAACCTCTTCCTTATTTGGCTTTCTGTGAGCTTGGGATCATATGGAAAATGTGAAAGCCTCC
TGAACCCACCAGCACAGGTCCTGGAATAGAGAACGTGCTCTGTTCATGGCATAAAACTTGCCCCTTCACCCAAATCCCCC
AATTCATCTCTACTTCCAATCACCTATGGAGATACAGATAGATCATGGGGAGGTAAACACTAATACTCTTTGGAGTGAGC
TCAGATCTTGGACTCAGAGACCAGTGCCAGCACTAGCCCCTGGTCACATTTCGTACTAACTCACAGAAGGACAGGCTGTA
TTGAAACAATAAACGACGGAGAGGGCGGTCCTTCCCCGTGCTTCTCGGGTGGAATAGCAGCCTAATATATGTCTCAGCAG
ATCACAAAAAGTAGCATGTTGTTCCTGGGCTACATCATTATTTCATGGCTGTTTGATTTAAGTCAGTTCTACTTCACTTT
TTTTATCTTGATTTCATTTTTTCTTTCTTTTCTTGGAGAATGTAATTTTTTTTGAGTCAAGAGGGTTGTGGTGGTAGAAA
CTGTAAAGCACATTCGCTGTGTATCAATCCCAATCCAGTCTTCCCAGAGAAGATTCTAAACACCTCCTGGAATGCACCTG
GGCCTATACCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAACACATTACACAGGCAGGTTCAT
TACTAACAGATAAGCAGCGAGTGACAACAGAAACCTACATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCT
CGAGACATGTGGAGTCACCCCATATGCAGTGTATCTGGGGGAAATCAAAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGA
GCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGGG
ATGTTCCTCCTGATCTCAGGACGTTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTC
TAAAGAAAAGAAATGTGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCTTGTGACGG
CCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGG
GACCAAGGGGGAGGGGGAGCGATGGAGCTTCCAAGCTCTTTTAACAACCAGTTCTCCAGGAACTAATAGAGGGGGAACTT
GCTAACCCCGTCTCCTTGGAACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACAACTCCCAAGAGGCC
CAACCTCCCACCCTGGGGGTTACATTTCAATGTGAGGTTTGAAGGGGTCAAACATCTAAACTAAAGCAGTTGTATCCTCA
GCACGTTCTATGGTTACTACAACTGAGAAAGCAGGAGGAAGCTAGGTCTCCCGCCATCTGGGTGCTTGTCCTAAAGAGAC
GTTGTATGTGGTTACCTGTCAATCAAGAAATGTGAGACAATTCATATAGAGGAACTGCTATGATTAGCTTCTTATTGGTG
TCTTGTCTTCCTCCAGGTAACTCCAGACACCTGCACGTTCTGATTGGGACCTCAGTGGTCATCATCCCCTTTGCTATCCT
CCTCTTCTTTCTCCTTCATCGCTGGTGTGCCAACAAAAAGAGTAAGTCTCACGAAGCAGAAGCCAGAGAGCTCAGGGCCA
TGTGGGGAAGCAGGATGGGAGCACTCAGGTGTGTGTTCCTCACAGGCAGGATGGTCCCTGGCCCAAGGCAGGAGCCACAG
AGGCAGGACTTTCTAGAGAGAGCACCAGACTCCCTGCCTCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACCGTA
TCCTCACATCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGACACAGAATCAATAGGAT
GGGAACTCAGAGCTATACATGGGATGGATCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGG
ACCTCAGGCACCTATGGCCTCCCCCTGTATGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTGTT
TTGACGACTTCCGTCTTCTACAGATGCTGTTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGGGAGGTAG
GTGCTCCTCCGCCCAGCCTCGTGGCTAGTCTTATTCCCAAAGAGTCCTGGAAAATGTGAGCACCCTCCCTCACTCAGCAT
TTCCCTCCCTCCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTTTTCACACAG
AGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCAACAGATACCAGCGTGTAACACGGAACTTCCAAATGCTG
AGCGCAGATCCAAAGTTGTCTTCTGTCCACTAGCACCACAGTCAGGCCTTGATGGGATCTTCTAGGGAGACAATAGCCCT
GTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGGACTCTGAAGGCGTGAGTCTGCATCTTAGGGCATCGCTC
TTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAAAC
ACACTTGCTTAGCCCACAATTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTA
CTTGAGGCTGCGATCACACTGAGGAACTCACAATTCCAAACATATAAGAGGCTCCCTCTTAACACGGCACTTAGATACGT
GCTATTCCACCTTTCCTCAGAGTATCTTTCAGCCTTCTGTCAGCAGTAAAACTTATAAATTTTTTTTATAATTTCAATGT
AGTTTTCTCTTCTTCAAGTAAACATGTCTGCCCTCAT

IPD-KIR