Allele Report for 3DL3*00802


3DL3*00802
Previous Designations & Local Names: 9077-b
IPD Acc No: KIR00143
Assigned: 29-APR-2005 Sequence Last Modified: 10-MAR-2006
Source Entries: AH015396 , AJ938062 , AY987952 , AY987953 , AY987954 , AY987955 , AY987956 , AY987957 , AY987958 , AY987959 , GU182358  
Cells Sequence Derived From: PBL4 , T7526 , T7527  
Known Ethnic Origin Of Source: Oriental
Publications
Steiner NK et al. Tissue Antigens 67:277-83 2006. abstract
Trundley AE et al. Immunogenetics 57:904-16 2006. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
Protein Sequence (410 aa)
MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSHLGFNEFSLSKEDGMPVPELYNRIFRNSF
LMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGI
TEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSR
HLHVLIGTSVVIIPFAILLFFLLHRWCANKKNAVVMDQEPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQR
PKTPPTDTSV
Nucleotide Sequence Data (1233 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGGAGGGGCCCTGGCCACATGTGGGTGGTCAGGA
CAAGCCCTTCCTCTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACATGTGACTCTTCAGTGTCGCTCTCATCTTG
GGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGCTCTACAACAGAATATTCCGGAACAGCTTT
CTCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCTGTGGTGATCATGGTCACAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCGGGAGAGACGGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTTCCTTCTGCACAGAGAGGGGATC
ACTGAGGACCCCTTGCGCCTCGTTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACTATTCCATGGGTCCCATGACACC
TGCCCTTGCAGGGACCTACAGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTGTCGGCTCCCAGTGACCCTCTGG
ACATCGTGGTCGTAGGTCTATATGGGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTG
ACCTTGTCCTGCAGCTCCCGGAGCTTGTTTGACATTTACCATCTATCCAGGGAGGCAGAGGCCGGTGAACTTAGGCTCAC
TGCGGTGCTGAGGGTCAATGGAACATTCCAGGCCAACTTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCCACGCGTGGTCAGACCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTAACTCCAGA
CACCTGCATGTTCTGATTGGGACCTCAGTGGTCATCATCCCCTTTGCTATCCTCCTCTTCTTTCTCCTTCATCGCTGGTG
TGCCAACAAAAAGAATGCTGTTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGGGAGGACTCTGATGAAC
AAGACCCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGG
CCCAAGACACCCCCAACAGATACCAGCGTGTAA
Genomic Sequence Data (12366 bps)
GTATGAGAGATTGGATCTGAGACGTGTTTTGAGTTGGTTATAGTGAAGGATGCAAGGTGTCAATTCTAGTTGGAACAATT
TCCAGGAAGCCATGTTCTGCTCTTGACCAAACAGCCACTGGGCCTCATGCAAGGTAGAAATAGCCTGCATACGTCATCCT
CCCATGATGTGGTCAGCATGTAAACTGCATGAGCCCCTCACAACATCCTGTGTGCTGCTGAACTGAGCTGGGGCGCAGCC
GCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAATCGAGG
GAGGGAGCGGTGGGGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATA
TAGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAACTGTAGATATGG
GCCTGAAGTAGAGATATGGGCCTGGAGTAGAGATATGGGCCTGGAACTGTAGATATGGGCCTGGAGTGGAGATATTGGCT
TGGAGTGCAGATATGGACCTGGAATTGAGATACGGGCCTGGAGGTGGAGATATGGGCCTAGAGTGGAGATATGGGCCTGG
AGGTGGAGATATGGGCCTGGAACTGTAGATATGGGCCTGGAGTAGAGATATGGGCCTGGAGTGGAGATGTTGGCTTGGAG
TGCAGATATGGGCCTGGAATGGAGACACGGGCCTGGAGGTGGAGATACAGGCCTGGAGGTGGAGATATGGGCCTGGAGTG
TAGATATGGGCCTGGAGTAGAGATATAGGACAGAGGTGGAGATATAGGCCTGGAGTGGAGATATGGGCCTGGAGTAGAGA
TATAGGACGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTGATGTACAGATGGATCATCCATCATGA
TCTTTCTTTCCAGGGTTCTTCTTGCTGGAGGGGCCCTGGCCACATGTGGGTGAGTCCTTCCCCCAAACCTTAGGTTGTCA
TCTCCCCACATAAGATGATGTTCCTGAAACGGGAGGCAGGCGACACAGGGGGTTGACTGATGGGCTGACCATGGGAAGCC
ATGTGGGAATCTCTCATGAACTAGGAAAAGGAAGCCAGGGGAAGCTTCGCCACAGTTCTGTCCTAGCCCTCCCCGGCCTT
TCTTTCCCTTGGCTGAGTCTGTGGGGACCCAGGGGGAGACTGAAGTGCTCAAAGGAGTGGTGTGCAGGGAGGAAGTGGTG
TCACCGGCAGAGGAAGGGAGAGAAGCAGTGCAAGGAACAACAGGCCTCTGAGGACAAGAGCATAACTCACACCCTCCAGC
GTTTCCATGACGGTAGGGGCTGCAATGTGGCTGCTGTCATTCTACCTAAGAGGTGGGGGAACCACAGTCATGACCCTGAC
ATTCCAGATCTTCTAATAGGGGCTCAGTTGTTTATTATGGTTCATGCATTAGCTGATCATGCCCTCCATCCTGTGTCTAC
CTTGTGTTCTTTTATGTAAGTAATTTTGCAGTGTTAAAATCTAGTAAGAGTCGCTTCTTCAGCACCTGCTCAAAGTTCTC
AGCTGACACTTGCTGTAGGGAGACGCCATGTCTATGCGGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAG
GAGCCTTAGAAACGTGGAAATGGGAGAATCTTCTGAGCACAGGGAGGGAGGGGCGGCTCCACATCCTCCTCTCTAAGGTA
GTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAGCCCTTCCTCTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACA
TGTGACTCTTCAGTGTCGCTCTCATCTTGGGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGC
TCTACAACAGAATATTCCGGAACAGCTTTCTCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGT
TCACACCCACACTCCCCCACTGGGTGGTCGGCACCCAGCAACCCTGTGGTGATCATGGTCACAGGTCAGAGGCTTTCTGT
CTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGCGTCCATCAGGGTCCAATCATCCAGGCCCA
GACTGTATTTGGGGTAAAGGGGGATTCAGTACAGAGAAATAGTTGCTGTGGTGGGAAGAATAATTGTCCCCAGTGATGGC
TACATGGTAATCCATGAACCCTGTGACTATTTATGTCATAGGGCAGGGGACTGAAGGGGAAGATGGAGCTCAGGTTGTTG
ATGAGTTGACCTTGCGATGGGGAGACAGCCTGGACTGTCCTGCTGTGCTCAGAGTAATCACAAGGGTCCTCATGAGAGGA
GGAGGAAGAGGAAAGTGGGGTTAGAGCAACGTCGTGGGAGGGAGACTCCATCAGCCACAGCGGGCTTTGAAGATGGGGGA
AGGCCATGAGCCACAAAGGCAGTTGGCCTCTAAGGGCTGGAGAAGTCAAGGGAACTGATTCTTCCCTGAGTCTCCAGAGG
AAACACAGCCCTGTAGATGCCTTGATTTTAGCCCAGAGAGAACTGGGTCCGATTTCTGTTCTCCAGAAGTGGAAGGGGTC
ATTGTATTCTCTCCTGCCCCATGTTTGTGACAATTTTCTCCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTGAAGC
ACAAGTTAAGAAACCAAACAAGGAGAAGGTTGGCTACACTGATTTTAGCATGGGTGGGATACTGATGCTACCACCAGGCT
CGATCCACATAGGGAGGGGTTGATGCTCCTGGAACCAGCACCAGGGGCCACCCTATGGAAGCTGGGGCCATGGAGAAGGC
ACAGACATGACAGGAGAGGCTCCCAATCCCCATCAGGAACAGGGACACTGATGCCTGCCTTACTGATGAGTTCGTACCTC
CTGCCAGCCTTTCCAATCTGTCCAAAAGAGATTGATTCAGGCTGCTAAGAGCCTGGACATGCAGCCTGTCGTGGTTCCTC
TTCCACCCCCACATAAACACCAGGAAAGAGATTAGTGGGAAACAGATACAACAGCATAAGAGGTGACACTGAGCACAGTG
GGAAGGGAATCAGGGCTACTAGAGACAGAGAGACAGGGAAGAGGGAGGGAGACAGATGGAGGGACCTGCAACAGGGGTTA
TGGGCACAAAAGAACACGGAGACACAGAGAGGAAGGAGAGAGATAGACACCATGGAGGGGAAGCCTCACTTATTTCAGGT
CCCATGAATGGGATGAGAAAGGGAGACGCCTTCTGAACTCACAACCTCTCTTCTTAGGAGTCCACAGAAAACCTTCCCTC
CTGGCCCACCCAGGTCCCCTGGTGAAATCGGGAGAGACGGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTT
CCTTCTGCACAGAGAGGGGATCACTGAGGACCCCTTGCGCCTCGTTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACT
ATTCCATGGGTCCCATGACACCTGCCCTTGCAGGGACCTACAGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTG
TCGGCTCCCAGTGACCCTCTGGACATCGTGGTCGTAGGTGAGAGAATACAGACCTGCCTCTCACCCTTGCTGGGAGATGG
AGTGAATGATCTAGGACTGGAAGCCCCAGGTGGTCATGAGGAAGATGAGTGTGGGGTTCCTATGGAGAGAAAGTGACTTG
GTGAGGTCTGTACCAACAAAGGCAGAGAAACAGGAGACACAAGTACAGACCTCATGTCATAACATAGAAGCCAGACACAG
GGGCCATACAAGGTGTTAGAAAAAGAGATAAAGAGGTAAAGAAGACACAGAGAGACAGATATATCCCAGAGAGAGGTGTC
CTTCTATGCTGACTTTGTTCAGAGACCAGGCACAGGTTAGAAGGTTCCATTCTGTTTTACCTCTACAAAGTGTTCTCTCC
CAGGAGAACCCAAAGAGACACATCTATCTGGCCTGAGTTGGGCCGTGTGGCCCCAGGCTGGTGGCACCTACAGATGCTGT
GTTTATTCTTAAACCTCTGCCTTCCGTGCAGTGGAGCTGTCGTCGTCGCAGGACACCATGGCCCCAGGTGAGGGAGCAGA
ACACCAACCCCTGTATGTTGTGAGTTCCTGGAGTCCCCATACTGGATTCTGAGGCTCATATTCAAATAGCACCACATGTT
ATAGGATTACTGAGAACAAAAGCCCACAGAGAGACACGGAGTGAAATCAGGGAAATCAAAAAGCAAAGACATGAACACAC
ACACAGAATGAGCCAGAAGAAGGGAATTGAGAGACTCACAGACACATAAAGAGATAGAAAAAGAGGGCAGAGAAGTGGAG
CGTATGATGGAAGGAAGCAGAGAAAAGCCCTAAAATCAGAGCCCTGAGGGAGGGGCACAAAGACAGGGAAAGATAAAGAT
GTGGGGATGGATTGCAGAGACTCCAAAAGGGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGATGGAGAGAGACA
GATGATAGATGGATAGATAGATATAGATAGATGAAAGATAAAAGGTAGATGATAGATAATAGAGAGACAGGTGATAGACA
AATAGATGATGAATGACTGATAGATGATATAGATAGACAAGTAGAAAGACAGACAGATGATATATAAATAGATATAGAGA
GATAGAAAGACAGATAAACACATGATGATAGATGGATAGATGCATACATACATACATTGATTGATAGATGATAGATAACA
GAGAGATAGGTCATAGATACACAGATGATGATAGATGATAGATACATACATAGATAAATGATAGATCGATCAATAGATAG
TAGATAGAAATATGCAGAAAGTTATGAGCAAGACAGAAAGTGAGAGACTCAGAATTAAAGAAAGAGGAAGATCAAGTCAA
CCAGTCCAAGGAGGGTCAGAGAGAATAAAATGGTACAAAAAAAGAAAACATAGCTAGGGATGGAGAAGTGAGGTCAGAGA
CCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGATGGGGGTGGAGGGTGAGAGAGAGAAAGAGAGC
ATTAAGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGTGAGGAGAGCTGTGACAACGAAGAACCTCCCTGAGGAAA
CCACCTCTTCTCCTTCCAGGTCTATATGGGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAA
TGTGACCTTGTCCTGCAGCTCCCGGAGCTTGTTTGACATTTACCATCTATCCAGGGAGGCAGAGGCCGGTGAACTTAGGC
TCACTGCGGTGCTGAGGGTCAATGGAACATTCCAGGCCAACTTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGA
TGCTTCGGCTCTTTCCGTGCCCTGCCCCACGCGTGGTCAGACCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTGAGAA
AACACCATGCCTGTCCCATGTCTTGTGATCCTAGAGCCATAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGA
CAGATGCCGAGACAGAACACACAGCATGGGTGTAAGGGCGGGGTCAGGGGGCAGGATGGCAGACAGGGCACCTCCAAACC
CTCCTGTATGGCCTGCAAGGAGGCCCTTGATCAGGGTTCCAGGCACCCAGGCAGATGGAGAAAGAGGTCAGAACAGACCC
AGAGGAGGGAGACTGGGCTCTGCCTGGGGAGATCAGAGGTTCTCTCAGCCCCTCAACCTTACCCACTTCCCAGAAGCCCA
TCCTGGCCTGTCACCCACAGAGAGATGTCATCACCAGCAACGCCTACACCCTTTTCTTTTTGTTTGAAGAAATATTTATT
GAGGTGAAATATACCTATGTAATTTACCACCTTTACCATTTTTAAGTGTGAAGTCTACTGTTCATAAATACATTTATAGG
CTGGGCACGGTGGCTCACTGTTGTAATCCCAACACTTTGAGAGGCCAAGGCAGGTGGATCATTTGAGATCAGGGGCTCAA
GACCACCCTGGCCAACATGGGGAAAATCCATCTGTACTAAAAATACAAAATAATAATAATAATGATAATAATTAGCCGAG
CATGGTGGCACATGCCTGTAGTCCCAGCTACTTGGGAGGGTTGGGCAGGAGTTGCACTTAATTGCAGGAGGCGGAGGTTG
CAGTGAGCTGAGATCATGCCACTGCACTGCAGCCTGGGCAACAGAGAGAGACACTCTCTCAAAATTAATTAATTAATTAA
TTAGTATTCTTTTTTTTTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTAGCCACCATTCTACTCTCTACCTTTGTGAG
ATCCACCTTTTAGCTCCTGCATATGAGTGAGAAATGGAAATACTTGTAATGACCTCCAGTTCCATTCATGTGGCTGTAAA
TGACAGGATGTTACTCTTTCTATGGATGAGTTGTCCCTATTGTGTGTGTGTACCACATTCTCTCCATCCATTCACCCACT
GATGGGCGGGTAGGTTGATCCACATCTTGGCTACTGTGAACACTGCTGGAACAGTCATGGGAGTGCAGATGTCACTTCGA
TACGCTGATGTCCTTTCCTTTGGGTTTACACCCAGTCATGGAATTGCTAGATCCTCTGGAAGTGTCTTTTTACATTTTGT
TTTATGGTTTTTGTTTTTGTTTTTGTTTTTTTTAGACAGTTTCACTCTTGTTGCCCAGGCTGGAGTGCAGTGGTGCCATC
TGGGCTCACTGCAACCTCCACCTCCAGGATTCAAGAGATTCCCCAGCCTCAGCCTCCCAAGTAGCTGGGTTACTGGCTCC
CACCACCACACTCGGCTAATTTTTATATTTTTAGTAGAGACAGAGTTTCGCTATATTGGCCAGGCTGCTCTTCAACTCCT
GACCTCAAGTGACCTACCCACCTCGGCCTCCCAATGTGCTGGGATTACAGGCATGAACCACTGTGCCCGACCTCATTTTA
TTTTTTGAGGAACTTCCATACTCTTCTCCTCTGTAATGGCTGTACTAATTTACATTCGTATCAGCAGTGTACCAGATGCA
ACCCTGGTTGACTCAGCAGAGCAAGAGACGTGCAGTAAGAGAGAATTTAGCTTATTTATGCACACGACACTTCCACTCAC
TCACTCGTTCAGCCAATGCCCCATGCTCTGGCTGTGCAGTGTGGAATCTTTTCCTATTGTTGCCATAACAAATTTCCACA
AGCTTCGTGGATGAAAACATGTTTTTCTTAATTATCTCACAGTGCTGTAACTCAGAAGTATGAACTGCATTTCACTGGGC
TGATATCAAAGGGACAGTAAGGCTGGATTTCTTTTTAAGGTTCCAAGCAAGAATCTGCTCCTTAACGTTTCCCAGCTCCT
AGAGGCTCCCACGTTCCTGGGCCCCTGGTCCCCTTCCTTCTTCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACGTCTC
ACATGGCATCATTCAGACTCTTCTTCTTTACCCATACCTTTTTCTCTGAATCCTGCTCTGCCTTCTTCCTCATCTTTTAA
GGACTTTGGGATTCTATTGGGGTCACCAAGATAATCCATCTCAATCTCCCTAAAATCATCCAGCGTACCCTCTTTTTAAG
TTCAGCTGATTAGCAACCGTAATGCCATCTGCAATCTTCATTCCTCCTTTCCTGTAAAATAACATATTCACAAGCTATGG
AGGCTAAGACAGGGACATTTTGGGGGTGGGGCAGCATTCTCCTGCCTTCCACAAATGGTAAACAGGATGCATTTGGCCTC
TGCTCTTGGGACGCTGATATTGCAGATGGGTAAATGCGAGGGCAGAGAATGAATGCACAAGGGTACCAATAAATGAATGA
TCCATTGGGAAGCATCTGTGCACCAAATCTGGGGTTTTTTGTGTGTGTGTGTTTTTTTTGTTTTCTTTTTTTTTTTTGAG
TAGAGTCTCTCTCTGTTCCACAGGCTGGAGTGCAGTAGCACAATCTCAGCTCATTGCAACCTCTGCCTCCTGGGTTCATG
CAATTCTCCTGCCTCAGCCTACCGAGTAGCTGGGATTACAGCTGTGCGCCACCACACTCGGCTAATTTTTTTGGTATATT
TTTTAGTAGAAATGAGGTTTCACCATGTTGTGCAGGCTGTCTCAAACTCCCAATCTCAAGTGATCCCACCGCCTTAGCGT
CCCTAAGTGCAAAGATTACAGGCGAGAGCTACTGCGCCCAGCCAGGATTTAAAATAAGTAATAGATAATGCTGAGTATAT
AATTTCAGGTGACAGAGAAGGTCTCACTGATCAGATAATATTTGTGACCTTAATGGAAAAAATGGATTCAACCCTTGGAA
GATTGGCGGAAGGATTTTCCACACTGAGCTCTCAGCCGTGAAGGCACAAAGGTGGAAACATTCTTAGTTCAAGGAAGAGG
CTCTGCCTCAAATGCTGGGAATGAGATGGGGAGAATGACAAGACAACTGTAGAGAGATGGAGAGCACACTGGGTACACAG
GAAACTAAGGAGGAACAAGGAGCATGTTTTTGATACTCACAGCCCTTGGATTCAACTCAGAGCTAACTAGGAATCCCTAC
CTGATTAACAGTGACCGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGAGACCGTGGAAAAGGCAATT
CCCGCCCCACTGGTGAAACGTAGGGTTGATTTACACACTAAATGAATGAAAGATGGATATAAGCTATGCTTGTGAGGTAG
AATCATTTGCAGGGAGGGCTTGCTGGGTTTGATTTTTCCTAGTAGTTTAATCCTTGTTTCATTAATTTCTTTCTGAGATG
TGTTTTTTTTCTACATCTAAATCAATACCTGGCAGAGGAGCGATAGACACATGAGGGGTGGTGCAAATGAAGGGACCTAG
TATAATATAATATACAAGACTGTGGATGGGGGCTCACACCTGTAACCCAACACTTTGGGAGGCCAAGGCGGGTAGATCAC
TTAAGGGTAGGAGTTTGAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTGTACTAAAAATACAAAAATTAGCCTGGTG
CATTGGCACCTGCCTGTAATCCCAGCGACTGGGGAGGCTGAAGCAGAAGAATGGCTTCAACCCTGGAGGCAGAGGTTGAA
CTGAGATCGCATCACTGCACTCCAGCCTGACACAGGGGGACTCTGTCTCAAAAAATAAAAATAAAACATACATAATTATA
ATATGACACACAGAAATTACAAAGGCAACTGGATACCAACCATCATTTTTCTATTTCTCTGTATTTAATTCTTTGACCCT
TTATCTTATCCATTAAACAATCAGGTTAAACCTCTTCCTTATTTGGCTTTCTGTGAGCTTGGGATCATATGGAAAATGTG
AAAGCCTCCTGAACCCACCAGCACAGGTCCTGGAATAGAGAACGTGCTCTGTTCATGGCATAAAACTTGCCACTTCACCC
AAATCCCCCAATTCATCTCTACTTCCAATCACCTATGGAGATACAGATAGATCATGGGGAGGTAAACACTAATACTCTTT
GGAGTGAGCTCAGATCTTGGACTCAGAGACCAGTGCCAGCACTAGCCCCTGGTCACATTTCGTACTAACTCACAGAAGGA
CAGGCTGTATTGAAACAATAAACGACGGAGAGGGCGGTCCTTCCCCGTGCTTCTCGGGTGGAATAGCAGCCTAATATATG
TCTCAGCAGATCACAAAAAGTAGCATGTTGTTCCTGGGCTACATCATTATTTCATGGCTGTTTGATTTAAGTCAGTTCTA
CTTCACTTTTTTTATCTTGATTTCATTTTTTCTTTCTTTTCTTGGAGAATGTAATTTTTTTTGAGTCAAGAGGGTTGTGG
TGGTAGAAACTGTAAAGCACATTCGCTGTGTATCAATCCCAATCCAGTCTTCCCAGAGAAGATTCTAAACACCTCCTGGA
ATGCACCTGGGCCTATACCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAACACATTACACAGG
CAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAACCTACATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGA
AAAGCTGCTCGAGACATGTGGAGTCACCCCATATGCAGTGTATCTGGGGGAAATCAAAAAGCAGCCCAGCCTGGGTTTTG
TACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGC
TGTTCTGGGATGTTCCTCCTGATCTCAGGACGTTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTG
GGTAACTTCTAAAGAAAAGAAATGTGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTC
TTGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACACGG
CAAGAGAGGGACCAAGGGGGAGGGGGAGCGATGGAGCTTCCAAGCTCTTTTAACAACCAGTTCTCCAGGAACTAATAGAG
GGGGAACTTGCTAACCCCGTCTCCTTGGAACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACAACTCC
CAAGAGGCCCAACCTCCCACCCTGGGGGTTACATTTCAATGTGAGGTTTGAAGGGGTCAAACATCTAAACTAAAGCAGTT
GTATCCTCAGCACGTTCTATGGTTACTACAACTGAGAAAGCAGGAGGAAGCTAGGTCTCCCGCCATCTGGGTGCTTGTCC
TAAAGAGACGTTGTATGTGGTTACCTGTCAATCAAGAAATGTGAGACAATTCATATAGAGGAACTGCTATGATTAGCTTC
TTATTGGTGTCTTGTCTTCCTCCAGGTAACTCCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCATCATCCCCTT
TGCTATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGTGCCAACAAAAAGAGTAAGTCTCACGAAGCAGAAGCCAGAGAGC
TCAGGGCCATGTGGGGAAGCAGGATGGGAGCACTCAGGTGTGTGTTCCTCACAGGCAGGATGGTCCCTGGCCCAAGGCAG
GAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGACTCCCTGCCTCTGCCTTCAGCTCACAGACCATTGCCTGATTC
TGAACCGTATCCTCACATCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGACACAGAAT
CAATAGGATGGGAACTCAGAGCTATACATGGGATGGATCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGC
AACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGTATGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTC
CGAGCTGTTTTGACGACTTCCGTCTTCTACAGATGCTGTTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACA
GGGAGGTAGGTGCTCCTCCGCCCAGCCTCGTGGCTAGTCTTATTCCCAAAGAGTCCTGGAAAATGTGAGCACCCTCCCTC
ACTCAGCATTTCCCTCCCTCCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTT
TTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCAACAGATACCAGCGTGTAACACGGAACTTC
CAAATGCTGAGCGCAGATCCAAAGTTGTCTTCTGTCCACTAGCACCACAGTCAGGCCTTGATGGGATCTTCTAGGGAGAC
AATAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGGACTCTGAAGGCGTGAGTCTGCATCTTAGG
GCATCGCTCTTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGG
AGAGAAAACACACTTGCTTAGCCCACAATTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTT
CCTAGTCTACTTGAGGCTGCGATCACACTGAGGAACTCACAATTCCAAACATATAAGAGGCTCCCTCTTAACACGGCACT
TAGATACGTGCTATTCCACCTTTCCTCAGAGTATCTTTCAGCCTTCTGTCAGCAGTAAAACTTATAAATTTTTTTTATAA
TTTCAATGTAGTTTTCTCTTCTTCAAGTAAACATGTCTGCCCTCAT

IPD-KIR