Allele Report for 3DL3*0040201


3DL3*0040201
Previous Designations & Local Names: GU2015-b
IPD Acc No: KIR00138
Assigned: 29-APR-2005 Sequence Last Modified: 10-MAR-2006
Source Entries: AJ938061 , AY987938 , EF492040 , GU182353  
Cells Sequence Derived From: Dec13 , GRC-212 , GU2015 , RDP34  
Known Ethnic Origin Of Source: American Indian, Black, Hispanic
Publications
Hou L et al. Tissue Antigens 70:449-54 2007. abstract
Steiner NK et al. Tissue Antigens 67:277-83 2006. abstract
Trundley AE et al. Immunogenetics 57:904-16 2006. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 4 Laboratories: 3
Protein Sequence (410 aa)
MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSHLGFNEFSLSKEDGMPVPELYNRIFRNSF
LMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGI
TEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSR
YLHALIGTSVVIIPFAILLFFLLHRWCANKKNAVVMDQEPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQR
PKTPPTDTSV
Nucleotide Sequence Data (1233 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGGAGGGGCCCTGGCCACATGTGGGTGGTCAGGA
CAAGCCCTTCCTCTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACATGTGACTCTTCAGTGTCGCTCTCATCTTG
GGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGCTCTACAACAGAATATTCCGGAACAGCTTT
CTCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCTGTGGTGATCATGGTCACAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCGGGAGAGACGGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTTCCTTCTGCACAGAGAGGGGATC
ACTGAGGACCCCTTGCGCCTCGTTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACTATTCCATGGGTCCCATGACACC
TGCCCTTGCAGGGACCTACAGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTGTCGGCTCCCAGTGACCCTCTGG
ACATCGTGGTCGTAGGTCTATATGGGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTG
ACCTTGTCCTGCAGCTCCCGGAGCTTGTTTGACATTTACCATCTATCCAGGGAGGCAGAGGCCGGTGAACTTAGGCTCAC
TGCGGTGCTGAGGGTCAATGGAACATTCCAGGCCAACTTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCCACGCGTGGTCAGACCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTAACTCCAGA
TACCTGCACGCTCTGATTGGGACCTCAGTGGTCATCATCCCCTTTGCTATCCTCCTCTTCTTTCTCCTTCATCGCTGGTG
TGCCAACAAAAAGAATGCTGTTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGGGAGGACTCTGATGAAC
AAGACCCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGG
CCCAAGACACCCCCAACAGATACCAGCGTGTAA
Genomic Sequence Data (12390 bps)
GTATGAGAGATTGGATCTGAGACGTGTTTTGAGTTGGTTATAGTGAAGGATGCAAGGTGTCAATTCTAGTTGGAACAATT
TCCAGGAAGCCATGTTCTGCTCTTGACCAAACAGCCACTGGGCCTCATGCAAGGTAGAAATAGCCTGCATACGTCATCCT
CCCATGATGTGGTCAGCATGTAAACTGCATGAGCCCCTCACAACATCCTGTGTGCTGCTGAACTGAGCTGGGGCGCAGCC
GCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAATCGAGG
GAGGGAGCGGTGGGGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATA
TAGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAACTGTAGATATGG
GCCTGAAGTAGAGATATGGGCCTGGAGTAGAGATATGGGCCTGGAACTGTAGATATGGGCCTGGAGTGGAGATATTGGCT
TGGAGTGCAGATATGGACCTGGAATTGAGATACGGGCCTGGAGGTGGAGATATGGGCCTAGAGTGGAGATATGGGCCTGG
AGGTGGAGATATGGGCCTGGAACTGTAGATATGGGCCTGGAGTAGAGATATGGGCCTGGAGTGGAGATGTTGGCTTGGAG
TGCAGATATGGGCCTGGAATGGAGACACGGGCCTGGAGGTGGAGATACAGGCCTGGAGGTGGAGATATGGGCCTGGAGTG
TAGATATGGGCCTGGAGTAGAGATATAGGACAGAGGTGGAGATATAGGCCTGGAGTGGAGATATGGGCCTGGAGTAGAGA
TATAGGACGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTGATGTACAGATGGATCATCCATCATGA
TCTTTCTTTCCAGGGTTCTTCTTGCTGGAGGGGCCCTGGCCACATGTGGGTGAGTCCTTCCCCCAAACCTTAGGTTGTCA
TCTCCCCACATAAGATGATGTTCCTGAAACGGGAGGCAGGCGACACAGGGGGTTGACTGATGGGCTGACCATGGGAAGCC
ATGTGGGAATCTCTCATGAACTAGGAAAAGGAAGCCAGGGGAAGCTTCGCCACAGTTCTGTCCTAGCCCTCCCCGGCCTT
TCTTTCCCTTGGCTGAGTCTGTGGGGACCCAGGGGGAGACTGAAGTGCTCAAAGGAGTGGTGTGCAGGGAGGAAGTGGTG
TCACCGGCAGAGGAAGGGAGAGAAGCAGTGCAAGGAACAACAGGCCTCTGAGGACAAGAGCATAACTCACACCCTCCAGC
GTTTCCATGACGGTAGGGGCTGCAATGTGGCTGCTGTCATTCTACCTAAGAGGTGGGGGAACCACAGTCATGACCCTGAC
ATTCCAGATCTTCTAATAGGGGCTCAGTTGTTTATTATGGTTCATGCATTAGCTGATCATGCCCTCCATCCTGTGTCTAC
CTTGTGTTCTTTTATGTAAGTAATTTTGCAGTGTTAAAATCTAGTAAGAGTCGCTTCTTCAGCACCTGCTCAAAGTTCTC
AGCTGACACTTGCTGTAGGGAGACGCCATGTCTATGCGGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAG
GAGCCTTAGAAACGTGGAAATGGGAGAATCTTCTGAGCACAGGGAGGGAGGGGCGGCTCCACATCCTCCTCTCTAAGGTA
GTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAGCCCTTCCTCTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACA
TGTGACTCTTCAGTGTCGCTCTCATCTTGGGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGC
TCTACAACAGAATATTCCGGAACAGCTTTCTCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGT
TCACACCCACACTCCCCCACTGGGTGGTCGGCACCCAGCAACCCTGTGGTGATCATGGTCACAGGTCAGAGGCTTTCTGT
CTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGCGTCCATCAGGGTCCAATCATCCAGGCCCA
GACTGTATTTGGGGTAAAGGGGGATTCAGTACAGAGAAATAGTTGCTGTGGTGGGAAGAATAATTGTCCCCAGTGATGGC
TACATGGTAATCCATGAACCCTGTGACTATTTATGTCATAGGGCAGGGGACTGAAGGGGAAGATGGAGCTCAGGTTGTTG
ATGAGTTGACCTTGCGATGGGGAGACAGCCTGGACTGTCCTGCTGTGCTCAGAGTAATCACAAGGGTCCTCATGAGAGGA
GGAGGAAGAGGAAAGTGGGGTTAGAGCAACGTCGTGGGAGGGAGACTCCATCAGCCACAGCGGGCTTTGAAGATGGGGGA
AGGCCATGAGCCACAAAGGCAGTTGGCCTCTAAGGGCTGGAGAAGTCAAGGGAACTGATTCTTCCCTGAGTCTCCAGAGG
AAACACAGCCCTGTAGATGCCTTGATTTTAGCCCAGAGAGAACTGGGTCCGATTTCTGTTCTCCAGAAGTGGAAGGGGTC
ATTGTATTCTCTCCTGCCCCATGTTTGTGACAATTTTCTCCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTGAAGC
ACAAGTTAAGAAACCAAACAAGGAGAAGGTTGGCTACACTGATTTTAGCATGGGTGGGATACTGATGCTACCACCAGGCT
CGATCCACATAGGGAGGGGTTGATGCTCCTGGAACCAGCACCAGGGGCCACCCTATGGAAGCTGGGGCCATGGAGAAGGC
ACAGACATGACAGGAGAGGCTCCCAATCCCCATCAGGAACAGGGACACTGATGCCTGCCTTACTGATGAGTTCGTACCTC
CTGCCAGCCTTTCCAATCTGTCCAAAAGAGATTGATTCAGGCTGCTAAGAGCCTGGACATGCAGCCTGTCGTGGTTCCTC
TTCCACCCCCACATAAACACCAGGAAAGAGATTAGTGGGAAACAGATACAACAGCATAAGAGGTGACACTGAGCACAGTG
GGAAGGGAATCAGGGCTACTAGAGACAGAGAGACAGGGAAGAGGGAGGGAGACAGATGGAGGGACCTGCAACAGGGGTTA
TGGGCACAAAAGAACACGGAGACACAGAGAGGAAGGAGAGAGATAGACACCATGGAGGGGAAGCCTCACTTATTTCAGGT
CCCATGAATGGGATGAGAAAGGGAGACGCCTTCTGAACTCACAACCTCTCTTCTTAGGAGTCCACAGAAAACCTTCCCTC
CTGGCCCACCCAGGTCCCCTGGTGAAATCGGGAGAGACGGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTT
CCTTCTGCACAGAGAGGGGATCACTGAGGACCCCTTGCGCCTCGTTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACT
ATTCCATGGGTCCCATGACACCTGCCCTTGCAGGGACCTACAGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTG
TCGGCTCCCAGTGACCCTCTGGACATCGTGGTCGTAGGTGAGAGAATACAGACCTGCCTCTCACCCTTGCTGGGAGATGG
AGTGAATGATCTAGGACTGGAAGCCCCAGGTGGTCATGAGGAAGATGAGTGTGGGGTTCCTATGGAGAGAAAGTGACTTG
GTGAGGTCTGTACCAACAAAGGCAGAGAAACAGGAGACACAAGTACAGACCTCATGTCATAACATAGAAGCCAGACACAG
GGGCCATACAAGGTGTTAGAAAAAGAGATAAAGAGGTAAAGAAGACACAGAGAGACAGATATATCCCAGAGAGAGGTGTC
CTTCTATGCTGACTTTGTTCAGAGACCAGGCACAGGTTAGAAGGTTCCATTCTGTTTTACCTCTACAAAGTGTTCTCTCC
CAGGAGAACCCAAAGAGACACATCTATCTGGCCTGAGTTGGGCCGTGTGGCCCCAGGCTGGTGGCACCTACAGATGCTGT
GTTTATTCTTAAACCTCTGCCTTCCGTGCAGTGGAGCTGTCGTCGTCGCAGGACACCATGGCCCCAGGTGAGGGAGCAGA
ACACCAACCCCTGTATGTTGTGAGTTCCTGGAGTCCCCATACTGGATTCTGAGGCTCATATTCAAATAGCACCACATGTT
ATAGGATTACTGAGAACAAAAGCCCACAGAGAGACACGGAGTGAAATCAGGGAAATCAAAAAGCAAAGACATGAACACAC
ACACAGAATGAGCCAGAAGAAGGGAATTGAGAGACTCACAGACACATAAAGAGATAGAAAAAGAGGGCAGAGAAGTGGAG
CGTATGATGGAAGGAAGCAGAGAAAAGCCCTAAAATCAGAGCCCTGAGGGAGGGGCACAAAGACAGGGAAAGATAAAGAT
GTGGGGATGGATTGCAGAGACTCCAAAAGGGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGATGGAGAGAGACA
GATGATAGATGGATAGATAGATATAGATAGATGAAAGATAAAAGGTAGATGATAGATAATAGAGAGACAGGTGATAGACA
AATAGATGATGAATGACTGATAGATGATATAGATAGACAAGTAGAAAGACAGACAGATGATATATAAATAGATATAGAGA
GATAGAAAGACAGATAAACACATGATGATAGATGGATAGATGCATACATACATACATTGATTGATAGATGATAGATAACA
GAGAGATAGGTCATAGATACACAGATGATGATAGATGATAGATACATACATAGATAAATGATAGATCGATCAATAGATAG
TAGATAGAAATATGCAGAAAGTTATGAGCAAGACAGAAAGTGAGAGACTCAGAATTAAAGAAAGAGGAAGATCAAGTCAA
CCAGTCCAAGGAGGGTCAGAGAGAATAAAATGGTACAAAAAAAGAAAACATAGCTAGGGATGGAGAAGTGAGGTCAGAGA
CCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGATGGGGGTGGAGGGTGAGAGAGAGAAAGAGAGC
ATTAAGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGTGAGGAGAGCTGTGACAACGAAGAACCTCCCTGAGGAAA
CCACCTCTTCTCCTTCCAGGTCTATATGGGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAA
TGTGACCTTGTCCTGCAGCTCCCGGAGCTTGTTTGACATTTACCATCTATCCAGGGAGGCAGAGGCCGGTGAACTTAGGC
TCACTGCGGTGCTGAGGGTCAATGGAACATTCCAGGCCAACTTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGA
TGCTTCGGCTCTTTCCGTGCCCTGCCCCACGCGTGGTCAGACCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTGAGAA
AACACCATGCCTGTCCCATGTCTTGTGATCCTAGAGCCATAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGA
CAGATGCCGAGACAGAACACACAGCATGGGTGTAAGGGCGGGGTCAGGGGGCAGGATGGCAGACAGGGCACCTCCAAACC
CTCCTGTATGGCCTGCAAGGAGGCCCTTGATCAGGGTTCCAGGCACCCAGGCAGATGGAGAAAGAGGTCAGAACAGACCC
AGAGGAGGGAGACTGGGCTCTGCCTGGGGAGATCAGAGGTTCTCTCAGCCCCTCAACCTTACCCACTTCCCAGAAGCCCA
TCCTGGCCTGTCACCCACAGAGAGATGTCATCACCAGCAACGCCTACACCCTTTTCTTTTTGTTTGAAGAAATATTTATT
GAGGTGAAATATACCTATGTAATTTACCACCTTTACCATTTTTAAGTGTGAAGTCTACTGTTCATAAATACATTTATAGG
CTGGGCACGGTGGCTCACTGTTGTAATCCCAACACTTTGAGAGGCCAAGGCAGGTGGATCATTTGAGATCAGGGGCTCAA
GACCACCCTGGCCAACATGGGGAAAATCCATCTGTACTAAAAATACAAAATAATAATAATAATGATAATAATTAGCCGAG
CATGGTGGCACATGCCTGTAGTCCCAGCTACTTGGGAGGGTTGGGCAGGAGTTGCACTTAATTGCAGGAGGCGGAGGTTG
CAGTGAGCTGAGATCATGCCACTGCACTGCAGCCTGGGCAACAGAGAGAGACACTCTCTCAAAATTAATTAATTAATTAA
TTAGTATTCTTTTTTTTTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTAGCCACCATTCTACTCTCTACCTTTGTGAG
ATCCACCTTTTAGCTCCTGCATATGAGTGAGAAATGGAAATACTTGTAATGACCTCCAGTTCCATTCATGTGGCTGTAAA
TGACAGGATGTTACTCTTTCTATGGATGAGTTGTCCCTATTGTGTGTGTGTACCACATTCTCTCCATCCATTCACCCACT
GATGGGCGGGTAGGTTGATCCACATCTTGGCTACTGTGAACACTGCTGGAACAGTCATGGGAGTGCAGATGTCACTTCGA
TACGCTGATGTCCTTTCCTTTGGGTTTACACCCAGTCATGGAATTGCTAGATCCTCTGGAAGTGTCTTTTTACATTTTGT
TTTATGGTTTTTGTTTTTGTTTTTGTTTTTTTTAGACAGTTTCACTCTTGTTGCCCAGGCTGGAGTGCAGTGGTGCCATC
TGGGCTCACTGCAACCTCCACCTCCAGGATTCAAGAGATTCCCCAGCCTCAGCCTCCCAAGTAGCTGGGTTACTGGCTCC
CACCACCACACTCGGCTAATTTTTATATTTTTAGTAGAGACAGAGTTTCGCTATATTGGCCAGGCTGCTCTTCAACTCCT
GACCTCAAGTGACCTACCCACCTCGGCCTCCCAATGTGCTGGGATTACAGGCATGAACCACTGTGCCCGACCTCATTTTA
TTTTTTGAGGAACTTCCATACTCTTCTCCTCTGTAATGGCTGTACTAATTTACATTCGTATCAGCAGTGTACCAGATGCA
ACCCTGGTTGACTCAGCAGAGCAAGAGACGTGCAGTAAGAGAGAATTTAGCTTATTTATGCACACGACACTTCCACTCAC
TCACTCGTTCAGCCAATGCCCCATGCTCTGGCTGTGCAGTGTGGAATCTTTTCCTATTGTTGCCATAACAAATTTCCACA
AGCTTCGTGGATGAAAACATGTTTTTCTTAATTATCTCACAGTGCTGTAACTCAGAAGTATGAACTGCATTTCACTGGGC
TGATATCAAAGGGACAGTAAGGCTGGATTTCTTTTTAAGGTTCCAAGCAAGAATCTGCTCCTTAACGTTTCCCAGCTCCT
AGAGGCTCCCACGTTCCTGGGCCCCTGGTCCCCTTCCTTCTTCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACGTCTC
ACATGGCATCATTCAGACTCTTCTTCTTTACCCATACCTTTTTCTCTGAATCCTGCTCTGCCTTCTTCCTCATCTTTTAA
GGACTTTGGGATTCTATTGGGGTCACCAAGATAATCCATCTCAATCTCCCTAAAATCATCCAGCGTACCCTCTTTTTAAG
TTCAGCTGATTAGCAACCGTAATGCCATCTGCAATCTTCATTCCTCCTTTCCTGTAAAATAACATATTCACAAGCTATGG
AGGCTAAGACAGGGACATTTTGGGGGTGGGGCAGCATTCTCCTGCCTTCCACAAATGGTAAACAGGATGCATTTGGCCTC
TGCTCTTGGGACGCTGATATTGCAGATGGGTAAATGCGAGGGCAGAGAATGAATGCACAAGGGTACCAATAAATGAATGA
TCCATTGGGAAGCATCTGTGCACCAAATCTGGGGTTTTTTGTGTGTGTGTGTTTTTTTTGTTTTCTTTTTTTTTTTTGAG
TAGAGTCTCTCTCTGTTCCACAGGCTGGAGTGCAGTAGCACAATCTCAGCTCATTGCAACCTCTGCCTCCTGGGTTCATG
CAATTCTCCTGCCTCAGCCTACCGAGTAGCTGGGATTACAGCTGTGCGCCACCACACTCGGCTAATTTTTTTGGTATATT
TTTTAGTAGAAATGAGGTTTCACCATGTTGTGCAGGCTGTCTCAAACTCCCAATCTCAAGTGATCCCACCGCCTTAGCGT
CCCTAAGTGCAAAGATTACAGGCGAGAGCTACTGCGCCCAGCCAGGATTTAAAATAAGTAATAGATAATGCTGAGTATAT
AATTTCAGGTGACAGAGAAGGTCTCACTGATCAGATAATATTTGTGACCTTAATGGAAAAAATGGATTCAACCCTTGGAA
GATTGGCGGAAGGATTTTCCACACTGAGCTCTCAGCCGTGAAGGCACAAAGGTGGAAACATTCTTAGTTCAAGGAAGAGG
CTCTGCCTCAAATGCTGGGAATGAGATGGGGAGAATGACAAGACAACTGTAGAGAGATGGAGAGCACACTGGGTACACAG
GAAACTAAGGAGGAACAAGGAGCATGTTTTTGATACTCACAGCCCTTGGATTCAACTCAGAGCTAACTAGGAATCCCTAC
CTGATTAACAGTGACCGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGAGACCGTGGAAAAGGCAATT
CCCGCCCCACTGGTGAAACGTAGGGTTGATTTACACACTAAATGAATGAAAGATGGATATAAGCTATGCTTGTGAGGTAG
AATCATTTGCAGGGAGGGCTTGCTGGGTTTGATTTTTCCTAGTAGTTTAATCCTTGTTTCATTAATTTCTTTCTGAGATG
TGTTTTTTTTCTACATCTAAATCAATACCTGGCAGAGGAGCGATAGACACATGAGGGGTGGTGCAAATGAAGGGACCTAG
TATAATATAATATACAAGACTGTGGATGGGGGCTCACACCTGTAACCCAACACTTTGGGAGGCCAAGGCGGGTAGATCAC
TTAAGGGTAGGAGTTTGAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTGTACTAAAAATACAAAAATTAGCCTGGTG
CATTGGCACCTGCCTGTAATCCCAGCGACTGGGGAGGCTGAAGCAGAAGAATGGCTTCAACCCTGGAGGCAGAGGTTGAA
CTGAGATCGCATCACTGCACTCCAGCCTGACACAGGGGGACTCTGTCTCAAAAAATAAAAATAAAACATACATAATTATA
ATATGACACACAGAAATTACAAAGGCAACTGGATACCAACCATCATTTTTCTATTTCTCTGTATTTAATTCTTTGACCCT
TTATCTTATCCATTAAACAATCAGGTTAAACCTCTTCCTTATTTGGCTTTCTGTGAGCTTGGGATCATATGGAAAATGTG
AAAGCCTCCTGAACCCACCAGCACAGGTCCTGGAATAGAGAACATGCTCTGTTCATGGCATAAAACTTGCCCCTTCACCC
AAATCCCCCAATTCATCTCTACTTCCAATCACCTATGGAGATACAGATAGATCATGGGGAGGTAAACACTAATACTCTTT
GGAGTGAGCTCAGATCTTGGACTCAGAGACCAGTGCCAGCACTAGCCCCTGGTCACATTTCGTACTAACTCACAGAAGGA
CAGGCTGTATTGAAACAATAAACGACGGAGAGGGCGGTCCTTCCCCGTGCTTCTCGGGTGGAATAGCAGCCTAATATATG
TCTCAGCAGATCACAAAAAGTAGCATGTTGTTCCTGGGCTACATCATTATTTCATGGCTGTTTGATTTAAGTCAGTTCTA
CTTCACTTTTTTTATCTTGATTTCATTTTTTCTTTCTTTTCTTGGAGAATGTAATTTTTTTGAGTCAAGAGGGTTGTGGT
GGTAGAAACTGTAAAGCACATTCGCTGTGTATCAATCCCAATCCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGAA
TGTACCTGGGCCTATACCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAACACATTACACAGGC
AGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAA
AAGCTGCTCGAGACATGTGGAGTCACCCCATATGCAGTGTATCTGGGGGAAATCAAAAAGCAGCCCAGCCTGGGTTTTGT
ACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCT
GTTCTGGGATGTTCCTCCTGATCTCAGGACTTTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGG
GTAACTTCTAAAGAAAAGAAATGTGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCT
TGTGACGGCCTCAGGCTGCTCCCGCTCTGGCAGAAGGGAAGGAGGGTCTATCTGTGCAGAGACCACAGAGATCACACGGC
AAGAGAGGGAGCAAGGGGGAGGGGGAGCGATGGAGCTTCCAAGTTCTTTTTAACAACCAGCTCTCCAGGAACTAATAGAG
GGGGAACTTGCTAACCCCATCTCCTTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCC
CAAGAGGCCCAACCTCCCACCCTGGGGGTTACATTTCAATGTGAGGTTTGAAGTGGTCAAACATCTAAACTAAAGCAGTT
GTATCCTCAGCACGTTCTATGGTTACTACAACTGAGAAAGCAGGAGGAAGCTAGGTCTCCCGCCATCTGGGTGCTTGTCC
TAAAGAGACGTTGTATGTGGTTACCTGTCAATCAAGAAATGTGAGACAATTCATATAGAGGAACTGCTATGATTAGCTTC
TTATTGGTGTCTTGTCTTCCTCCAGGTAACTCCAGATACCTGCACGCTCTGATTGGGACCTCAGTGGTCATCATCCCCTT
TGCTATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGTGCCAACAAAAAGAGTAAGTCTCACGAAGCAGAAGCCAGAGAGC
TCAGGGCCATGTGGGGAAGCAGGATGGGAGCACTCAGGTGTGTGTTCCTTACAGGCAGGATGGTCCCTGACCCAAGGCAG
GAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGACTCCCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTC
TGAACCATATCCTCACATCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGACAGAAT
CAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGC
AACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGCATGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTC
CGAGCTGTTTTGACGACTTCCGTCTTCTACAGATGCTGTTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACA
GGGAGGTAGGTGCTCCTCAGCCCAGCCTCATGGCTAGTCTTATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTC
ACTCAGCATTTCCCTCCCTCCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTT
TTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCAACAGATACCAGCGTGTAACACGGAACTTC
CAAATGCTGAGCGCAGATCCAAAGTTGTCTTCTGTCCACCAGCACCACAGTCAGGCCTTGATGGGATCTTCTAGGGAGAC
AATAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCGTGAGTCTGCATCTTAGG
GCATCGCTCTTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGG
AGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTT
ACTTCCTAGTCTACTTGAGGCTGCGATCACACTGAGGAACTCACAATTCCAAACATATAAGAGGCTCCCTCTTAACACGG
CACTTAGATACATGCTATTCCACCTTTCCTCATGTTGTTCCACCTTTCCTCAGAGTATCTTTCAGCCTTCTGTCAGCAGT
AAAACTTATAAATTTTTTTTATAATTTCAATGTAGTTTTCTATTCTTCAAGTAAACATGTCTGCCCTCAT

IPD-KIR