Allele Report for 3DL3*0030102


3DL3*0030102
Previous Designations & Local Names: None
IPD Acc No: KIR00303
Assigned: 12-DEC-2007 Sequence Last Modified: 18-JAN-2008
Source Entries: AY320039  
Cells Sequence Derived From: WT47  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (410 aa)
MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSF
LMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGI
TEDPLRLIGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSR
YLHALIGTSVVIIPFAILLFFLLHRWCANKKNAVVMDQEPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQR
PKTPPTDTSV
Nucleotide Sequence Data (1233 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGGAGGGGCCCTGGCCACATGTGGGTGGTCAGGA
CAAGCCCTTCCTCTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACATGTGACTCTTCAGTGTCGCTCTCGTCTTG
GGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGCTCTACAACAGAATATTCCGGAACAGCTTT
CTCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCTGTGGTGATCATGGTCACAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCGGGAGAGACGGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTTCCTTCTGCACAGAGAGGGGATC
ACTGAGGACCCCTTGCGCCTCATTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACTATTCCATGGGTCCCATGACACC
TGCCCTTGCAGGGACCTACAGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTGTCGGCTCCCAGTGACCCTCTGG
ACATCGTGGTCGTAGGTCTATATGGGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTG
ACCTTGTCCTGCAGCTCCCGGAGCTTGTTTGACATTTACCATCTATCCAGGGAGGCAGAGGCCGGTGAACTTAGGCTCAC
TGCGGTGCTGAGGGTCAATGGAACATTCCAGGCCAACTTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCCACGCGTGGTCAGACCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTAACTCCAGA
TACCTGCACGCTCTGATTGGGACCTCAGTGGTCATCATCCCCTTTGCTATCCTCCTCTTCTTTCTCCTTCATCGCTGGTG
TGCCAACAAAAAGAATGCTGTTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGGGAGGACTCTGATGAAC
AAGACCCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGG
CCCAAGACACCCCCAACAGATACCAGCGTGTAA
Genomic Sequence Data (12267 bps)
AAAACAACAAAAATACATCAAAAGTCTTTAATGTAAGCCAAGCATTCAGTCATCTCCTGTATGAGAGATTGGATCTGAGA
CGTGTTTTGAGTTGGTTATAGTGAAGGATGCAAGGTGTCAATTCTAGTTGGAACAATTTCCAGGAAGCCATGTTCTGCTC
TTGACCAAACAGCCACTGGGCCTCATGCAAGGTAGAAATAGCCTGCATACGTCATCCTCCCATGATGTGGTCAGCATGTA
AACTGCATGAGCCCCTCACAACATCCTGTGTGCTGCTGAACTGAGCTGGGGCGCAGCCGCCTGTCTGCACCGGCAGCACC
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAATCGAGGGAGGGAGCGGTGGGGTGGAGAT
CTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATAGGCCTGGAGTGGAGATATGG
GCCTGGGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAACTGTAGATATGGGCCTGAAGTAGAGATATGGGCC
TGGAGTAGAGATATGGGCCTGGAACTGTAGATATGGGCCTGGAGTGGAGATATTGGCTTGGAGTGCAGATATGGACCTGG
AATTGAGATACGGGCCTGGAGGTGGAGATATGGGCCTAGAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAA
CTGTAGATATGGGCCTGGAGTAGAGATATGGGCCTGGAGTGGAGATGTTGGCTTGGAGTGCAGATATGGGCCTGGAATGG
AGACACGGGCCTGGAGGTGGAGATACAGGCCTGGAGGTGGAGATATGGGCCTGGAGTGTAGATATGGGCCTGGAGTAGAG
ATATAGGACAGAGGTGGAGATATAGGCCTGGAGTGGAGATATGGGCCTGGAGTAGAGATATAGGACGGAAGTGGAGATAT
GGGCCTGGAGTGGAGATATGGGCCTGGAGGTGATGTACAGATGGATCATCCATCATGATCTTTCTTTCCAGGGTTCTTCT
TGCTGGAGGGGCCCTGGCCACATGTGGGTGAGTCCTTCCCCCAAACCTTAGGTTGTCATCTCCCCACATAAGATGATGTT
CCTGAAACGGGAGGCAGGCGACACAGGGGGTTGACTGATGGGCTGACCATGGGAAGCCATGTGGGAATCTCTCATGAACT
AGGAAAAGGAAGCCAGGGGAAGCTTCGCCACAGTTCTGTCCTAGCCCTCCCCGGCCTTTCTTTCCCTTGGCTGAGTCTGT
GGGGACCCAGGGGGAGACTGAAGTGCTCAAAGGAGTGGTGTGCAGGGAGGAAGTGGTGTCACCGGCAGAGGAAGGGAGAG
AAGCAGTGCAAGGAACAACAGGCCTCTGAGGACAAGAGCATAACTCACACCCTCCAGCGTTTCCATGACGGTAGGGGCTG
CAATGTGGCTGCTGTCATTCTACCTAAGAGGTGGGGGAACCACAGTCATGACCCTGACATTCCAGATCTTCTAATAGGGG
CTCAGTTGTTTATTATGGTTCATGCATTAGCTGATCATGCCCTCCATCCTGTGTCTACCTTGTGTTCTTTTATGTAAGTA
ATTTTGCAGTGTTAAAATCTAGTAAGAGTCGCTTCTTCAGCACCTGCTCAAAGTTCTCAGCTGACACTTGCTGTAGGGAG
ACGCCATGTCTATGCGGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAGAAACGTGGAAATG
GGAGAATCTTCTGAGCACAGGGAGGGAGGGGCGGCTCCACATCCTCCTCTCTAAGGTAGTGCCTCCTTCTCCCCCAGGTG
GTCAGGACAAGCCCTTCCTCTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACATGTGACTCTTCAGTGTCGCTCT
CGTCTTGGGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGCTCTACAACAGAATATTCCGGAA
CAGCTTTCTCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGTTCACACCCACACTCCCCCACTG
GGTGGTCGGCACCCAGCAACCCTGTGGTGATCATGGTCACAGGTCAGAGGCTTTCTGTCTGGGCTTCTCACTGTCCCACC
TCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCATCAGGGTCCAATCATCCAGGCCCAGACTGTATTTGGGGTAAAGGGG
GATTCAGTACAGAGAAATAGTTGCTGTGGTGGGAAGAATAATTGTCCCCAGTGATGGCTACATGGTAATCCATGAACCCT
GTGACTATTTATGTCATAGGGCAGGGGACTGAAGGGGAAGATGGAGCTCAGGTTGTTGATGGGTTGACCTTGCGATGGGG
AGACAGCCTGGACTGTCCTGCTGTGCTCAGAGTAATCACAAGGGTCCTCATGAGAGGAGGAGGAAGAGGAAAGTGGGGTT
AGAGCAACGTCGTGGGAGGGAGACTCCATCAGCCACAGCGGGCTTTGAAGATGGGGGAAGGCCATGAGCCACAAAGGCAG
GTGGCCTCTAAGGGCTGGAGAAGTCAAGGGAACTGATTCTTCCCTGAGTCTCCAGAGGAAACACAGCCCTGCAGATGCCT
TGATTTTAGCCCAGAGAGAACTGGGTCCGATTTCTGTTCTCCAGAAGTGGAAGGGGTCATTGTATTCTCTCCTGCCCCAT
GTTTGTGACAATTTTCTCCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTGAAGCACAAGTTAAGAAACCAAACAAG
GAGAAGGTTGGCTACACTGATTTTAGCATGGGTGGGATACTGATGCTACCACCAGGCTCGATCCACATAGGGAGGGGTTG
ATGCTCCTGGAACCAGCACCAGGGGCCACCCTATGGAAGCTGGGGCCATGGAGAAGGCACAGACATGACAGGAGAGGCTC
CCAATCCCCATCAGGAACAGGGACACTGATGCCTGCCTTACTGATGAGTTCGTACCTCCTGCCAGCCTTTCCAATCTGTC
CAAAAGAGATTGATTCAGGCTGCTAAGAGCCTGGACATGCAGCCTGTCGTGGTTCCTCTTCCACCCCCACATAAACACCA
GGAAAGAGATTAGTGGGAAACAGATACAACAGCATAAGAGGTGACACTGAGCACAGTGGGAAGGGAATCAGGGCTACTAG
AGACAGAGAGACAGGGAAGAGGGAGGGAGACAGATGGAGGGACCTGCAACAGGGGTTATGGGCACAAAAGAACACGGAGA
CACAGAGAGGAAGGAGAGAGATAGACACCATGGAGGGGAAGCCTCACTTATTTCAGGTCCCATGAATGGGATGAGAAAGG
GAGACGCCTTCTGAACTCACAACCTCTCTTCTTAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCGGGAGAGACGGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTTCCTTCTGCACAGAGAGGGGATC
ACTGAGGACCCCTTGCGCCTCATTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACTATTCCATGGGTCCCATGACACC
TGCCCTTGCAGGGACCTACAGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTGTCGGCTCCCAGTGACCCTCTGG
ACATCGTGGTCGTAGGTGAGAGAATACAGACCTGCCTCTCACCCTTGCTGGGAGATGGAGTGAATGATCTAGGACTGGAA
GCCCCAGGTGGTCATGAGGAAGATGAGTGTGGGGTTCCTATGGAGAGAAAGTGACTTGGTGAGGTCTGTACCAACAAAGG
CAGAGAAACAGGAGACACAAGTACAGACCTCATGTCATAACATAGAAGCCAGACACAGGGGCCATACAAGGTGTTAGAAA
AAGAGATAAAGAGGTAAAGAAGACACAGAGAGACAGATATATCCCAGAGAGAGGTGTCCTTCTATGCTGACTTTGTTCAG
AGACCAGGCACAGGTTAGAAGGTTCCATTCTGTTTTACCTCTACAAAGTGTTCTCTCCCAGGAGAACCCAAAGAGACACA
TCTATCTGGCCTGAGTTGGGCCGTGTGGCCCCAGGCTGGTGGCACCTACAGATGCTGTGTTTATTCTTAAACCTCTGCCT
TCCGTGCAGTGGAGCTGTCGTCGTCGCAGGACACCATGGCCCCAGGTGAGGGAGCAGAACACCAACCCCTGTATGTTGTG
AGTTCCTGGAGTCCCCATACTGGATTCTGAGGCTCATATTCAAATAGCACCACATGTTATAGGATTACTGAGAACAAAAG
CCCACAGAGAGACACGGAGTGAAATCAGGGAAATCAAAAAGCAAAGACATGAACACACACACAGAATGAGCCAGAAGAAG
GGAATTGAGAGACTCACAGACACATAAAGAGATAGAAAAAGAGGGCAGAGAAGTGGAGCGTATGATGGAAGGAAGCAGAG
AAAAGCCCTAAAATCAGAGCCCTGAGGGAGGGGCACAAAGACAGGGAAAGATAAAGATGTGGGGATGGATTGCAGAGACT
CCAAAAGGGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGATGGAGAGAGACAGATGATAGATGGATAGATAGAT
ATAGATAGATGAAAGATAAAAGGTAGATGATAGATAATAGAGAGACAGGTGATAGACAAATAGATGATGAATGACTGATA
GATGATATAGATAGACAAGTAGAAAGACAGACAGATGATATATAAATAGATATAGAGAGATAGAAAGATAAACACATGAT
GATAGATGGATAGATGCATACATACATACATTGATTGATAGATGATAGATAACAGAGAGATAGGTCATAGATACACAGAT
GATGATAGATGATAGATACATACATAGATAAATGATAGATCGATCAATAGATAGTAGATAGAAATATGCAGAAAGTTATG
AGCAAGACAGAAAGTGAGAGACTCAGAATTAAAGAAAGAGGAAGATCAAGTCAACCAGTCCAAGGAGGGTCAGAGAGAAT
AAAATGGTACAAAAAAAGAAAACATAGCTAGGGATGGAGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGTGGAAGG
AGGAAATAGACATGAAGAGAGATGGGGGTGGAGGGTGAGAGAGAGAAAGAGAGCATTAAGTCATAGAGCAGGGGAGTGAG
TTCTCAGCTCAGGTGTGAGGAGAGCTGTGACAACGAAGAACCTCCCTGAGGAAACCACCTCTTCTCCTTCCAGGTCTATA
TGGGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGA
GCTTGTTTGACATTTACCATCTATCCAGGGAGGCAGAGGCCGGTGAACTTAGGCTCACTGCGGTGCTGAGGGTCAATGGA
ACATTCCAGGCCAACTTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGATGCTTCGGCTCTTTCCGTGCCCTGCC
CCACGCGTGGTCAGACCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTGAGAAAACACCATGCCTGTCCCATGTCTTGT
GATCCTAGAGCCATAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCCGAGACAGAACACACAGCA
TGGGTGTAAGGGCGGGGTCAGGGGGCAGGATGGCAGACAGGGCACCTCCAAACCCTCCTGTATGGCCTGCAAGGAGGCCC
TTGATCAGGGTTCCAGGCACCCAGGCAGATGGAGAAAGAGGTCAGAACAGACCCAGAGGAGGGAGACTGGGCTCTGCCTG
GGGAGATCAGAGGTTCTCTCAGCCCCTCAACCTTACCCACTTCCCAGAAGCCCATCCTGGCCTGTCACCCACAGAGAGAT
GTCATCACCAGCAACGCCTACACCCTTTTCTTTTTGTTTGAAGAAATATTTATTGAGGTGAAATATACCTATGTAATTTA
CCACCTTTACCATTTTTAAGTGTGAAGTCTACTGTTCATAAATACATTTATAGGCTGGGCACGGTGGCTCACTGTTGTAA
TCCCAACACTTTGAGAGGCCAAGGCAGGTGGATCATTTGAGATCAGGGGCTCAAGACCACCCTGGCCAACATGGGGAAAA
TCCATCTGTACTAAAAATACAAAATAATAATAATAATGATAATAATTAGCCGAGCATGGTGGCACATGCCTGTAGTCCCA
GCTACTTGGGAGGGTTGGGCAGGAGTTGCACTTAATTGCAGGAGGCGGAGGTTGCAGTGAGCTGAGATCATGCCACTGCA
CTGCAGCCTGGGCAACAGAGAGAGACACTCTCTCAAAATTAATTAATTAATTAATTAGTATTCTTTTTTTTTTACCCTCC
ACCCTTCCCTTCCTGGCCTCTGGTAGCCACCATTCTACTCTCTACCTTTGTGAGATCCACCTTTTAGCTCCTGCATATGA
GTGAGAAATGGAAATACTTGTAATGACCTCCAGTTCCATTCATGTGGCTGTAAATGACAGGATGTTACTCTTTCTATGGA
TGAGTTGTCCCTATTGTGTGTGTGTACCACATTCTCTCCATCCATTCACCCACTGATGGGCAGGTAGGTTGATCCACATC
TTGGCTACTGTGAACACTGCTGGAACAGTCATGGGAGTGCAGATGTCACTTCGATACGCTGATGTCCTTTCCTTTGGGTT
TACACCCAGTCATGGAATTGCTAGATCCTCTGGAAGTGTCTTTTTACATTTTGTTTTATGGTTTTTGTTTTTGTTTTTGT
TTTTTTTAGACAGTTTCACTCTTGTTGCCCAGGCTGGAGTGCAGTGGTGCCATCTGGGCTCACTGCAACCTCCACCTCCA
GGATTCAAGAGATTCCCCAGCCTCAGCCTCCCAAGTAGCTGGGTTACTGGCTCCCACCACCACACTCGGCTAATTTTTAT
ATTTTTAGTAGAGACAGAGTTTCGCTATATTGGCCAGGCTGCTCTTCAACTCCTGACCTCAAGTGACCTACCCACCTCGG
CCTCCCAATGTGCTGGGATTACAGGCATGAACCACTGTGCCCGACCTCATTTTATTTTTTGAGGAACTTCCATACTCTTC
TCCTCTGTAATGGCTGTACTAATTTGCATTCGTATCAGCAGTGTACCAGATGCAACCCTGGTTGACTCAGCAGAGCAAGA
GACGTGCAGTAAGAGAGAATTTAGCTTATTTATGCACACGACACTTCCACTCACTCACTCGTTCAGCCAATGCCCCATGC
TCTGGCTGTGCAGTGTGGAATCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGCTTCGTGGATGAAAACATGTTTTT
CTTAATTATCTCACAGTGCTGTAACTCAGAAGTATGAACTGCATTTCACTGGGCTGATATCAAAGGGACAGTAAGGCTGG
ATTTCTTTTTAAGGTTCCAAGCAAGAATCTGCTCCTTAACGTTTCCCAGCTCCTAGAGGCTCCCACGTTCCTGGGCCCCT
GGTCCCCTTCCTCCTTCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACGTCTCACATGGCATCATTCAGACTCTTCTTC
TTTACCCATACCTTTTTCTCTGAATCCTGCTCTGCCTTCTTCCTCATCTTTTAAGGACTTTGGGATTCTATTGGGGTCAC
CAAGATAATCCATCTCAATCTCCCTAAAATCATCCAGCGTACCCTCTTTTTAAGTTCAGCTGATTAGCAACCGTAATGCC
ATCTGCAATCTTCATTCCTCCTTTCCTGTAAAATAACATATTCACAAGCTATGGAGGCTAAGACAGGGACATTTTGGGGG
TGGGGCAGCATTCTCCTGCCTTCCACAAATGGTAAACAGGATGCATTTGGCCTCTGCTCTTGGGACGCTGATATTGCAGA
TGGGTAAATGCGAGGGCAGAGAATGAATGCACAAGGGTACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCACCAA
ATCTGGGGTTTTTTGTGTGTGTGTGTGTTTTTTGTTTTCTTTTTTTTTTTTGAGTAGAGTCTCTCTCTGTTCCACAGGCT
GGAGTGCAGTAGCACAATCTCAGCTCATTGCAACCTCTGCCTCCTGGGTTCATGCAATTCTCCTGCCTCAGCCTACCGAG
TAGCTGGGATTACAGCTGTGCGCCACCACACTCGGCTAATTTTTTTGGTATATTTTTTAGTAGAAATGAGGTTTCACCAT
GTTGTGCAGGCTGTCTCAAACTCCCAATCTCAAGTGATCCCACCGCCTTAGCGTCCCTAAGTGCAAAGATTACAGGCGAG
AGCTACTGCGCCCAGCCAGGATTTAAAATAAGTAATAGATAATGCTGAGTATATAATTTCAGGTGACAGAGAAGGTCTCA
CTGATCAGATAATATTTGTGACCTTAATGGAAAAAATGGATTCAACCCTTGGAAGATTGGCGGAAGGATTTTCCACACTG
AGCTCTCAGCCGTGAAGGCACAAAGGTGGAAACATTCTTAGTTCAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGAGA
TGGGGAGAATGACAAGACAACTGTAGAGAGATGGAGAGCACACTGGGTACACAGGAAACTAAGGAGGAACAAGGAGCATG
TTTTTGATACTCACAGCCCTTGGATTCAACTCAGAGCTAACTAGGAATCCCTACCTGATTAACAGTGACCGACATGAAAA
TAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTCCCGCCCCACTGGTGAAACGTAGGGT
TGATTTACACACTAAATGAATGAAAGATGGATATAAGCTATGCTTGTGAGGTAGAATCATTTGCAGGGAGGGCTTGCTGG
GTTTGATTTTTCCTAGTAGTTTAATCCTTGTTTCATTAATTTCTTTCTGAGATGTGTTTTTTTTCTACATCTAAATCAAT
ACCTGGCAGAGGAGCGATAGACACATGAGGGGTGGTGCAAATGAAGGGACCTAGTATAATATAATATACAAGACTGTGGA
TGGGGGCTCACACCTGTAACCCAACACTTTGGGAGGCCAAGGCGGGTAGATCACTTAAGGGTAGGAGTTTGAGACCAGCC
TGGCCAACATGGTGAAACCCCGTCTGTACTAAAAATACAAAAATTAGCCTGGTGCATTGGCACCTGCCTGTAATCCCAGC
GACTGGGGAGGCTGAAGCAGAAGAATGGCTTCAACCCTGGAGGCAGAGGTTGAACTGAGATCGCATCACTGCACTCCAGC
CTGACACAGGGGGACTCTGTCTCAAAAAATAAAAATAAAACATACATAATTATGACACACAGAAATTACAAAGGCAACTG
GATACCAACCATCATTTTTCTATTTCTCTGTGTTTAATTCTTTGACCCTTTATCTTATCCATTAAACAATCAGGTTAAAC
CTCTTCCTTATTTGGCTTTCTGTGAGCTTGGGATCATATGGAAAATGTGAAAGCCTCCTGAACCCACCAGCACAGGTCCT
GGAATAGAGAACGTGCTCTGTTCATGGCATAAAACTTGCCCCTTCACCCAAATCCCCCAATTCATCTCTACTTCCAATCA
CCTATGGAGATACAGATAGATCATGGGGAGGTAAACACTAATACTCTTTGGAGTGAGCTCAGATCTTGGACTCAGAGACC
AGTGCCAGCACTAGCCCCTGGTCACATTTCGTACTAACTCACAGAAGGACAGGCTGTATTGAAACAATAAACGACGGAGA
GGGCGGTCCTTCCCCGTGCTTCTCGGGTGGAATAGCAGCCTAATATATGTCTCAGCAGATCACAAAAAGTAGCATGTTGT
TCCTGGGCTACATCATTATTTCATGGCTGTTTGATTTAAGTCAGTTCTACTTCACTTTTTTTATCTTGATTTCATTTTTT
CTTTCTTTTCTTGGAGAATGTAATTTTTTTGAGTCAAGAGGGTTGTGGTGGTAGAAACTGTAAAGCACATTCGCTGTGTA
TCAATCCCAATCCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGAATGTACCTGGGCCTATACCAATTCCTATCACT
CACCGTCACTCCAGGGAGACAGAACACACAGAGAACACATTACACAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTG
ACAACAGAAGCCTACATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGAGACATGTGGAGTCACCCCAT
ATGCAGTGTATCTGGGGGAAATCAAAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAA
GCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGGGATGTTCCTCCTGATCTCAGGACT
TTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAAAGAAATGTGTTTGCC
TCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCTTGTGACGGCCTCAGGCTGCTCCCGCTCTGGC
AGAAGGGAAGGAGGGTCTATCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGGGAGCGAT
GGAGCTTCCAAGTTCTTTTTAACAACCAGCTCTCCAGGAACTAATAGAGGGGGAACTTGCTAACCCCATCTCCTTGGGAC
AGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCCCAAGAGGCCCAACCTCCCACCCTGGGGGTTA
CATTTCAATGTGAGGTTTGAAGTGGTCAAACATCTAAACTAAAGCAGTTGTATCCTCAGCACGTTCTATGGTTACTACAA
CTGAGAAAGCAGGAGGAAGCTAGGTCTCCCGCCATCTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGTCAA
TCAAGAAATGTGAGACAATTCATATAGAGGAACTGCTATGATTAGCTTCTTATTGGTGTCTTGTCTTCCTCCAGGTAACT
CCAGATACCTGCACGCTCTGATTGGGACCTCAGTGGTCATCATCCCCTTTGCTATCCTCCTCTTCTTTCTCCTTCATCGC
TGGTGTGCCAACAAAAAGAGTAAGTCTCACGAAGCAGAAGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGC
ACTCAGGTGTGTGTTCCTTACAGGCAGGATGGTCCCTGACCCAAGGCAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAG
CACCAGACTCCCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACCATATCCTCACATCCCCTGCAGCCAC
TCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAACTCAGAGCTATTCATGG
GATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCC
CCCTGCATGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTGTTTTGACGACTTCCGTCTTCTACA
GATGCTGTTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGGGAGGTAGGTGCTCCTCAGCCCAGCCTCAT
GGCTAGTCTTATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCCCTCCAGGACTCTGA
TGAACAAGACCCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTC
AGAGGCCCAAGACACCCCCAACAGATACCAGCGTGTAACACGGAACTTCCAAATGCTGAGCGCAGATCCAAAGTTGTCTT
CTGTCCACCAGCACCACAGTCAGGCCTTGATGGGATCTTCTAGGGAGACAATAGCCCTGTCTCAAAACCGGGTTGCCAGC
TCCCATGTACCAGCAGCTGGAATCTGAAGGCGTGAGTCTGCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAA
CATGCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACA
ATTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACTTGAGGCTGCGATCACA
CTGAGGAACTCACAATTCCAAACATAT

IPD-KIR