Allele Report for 3DL3*0030101


3DL3*0030101
Previous Designations & Local Names: KIRCI
IPD Acc No: KIR00080
Assigned: 28-JUN-2003 Sequence Last Modified: 17-JUL-2003
Source Entries: AJ938053 , AL133414 , AY987937 , EF492041  
Cells Sequence Derived From: GU1183 , GU2015 , PBL1 , RDP36 , RPCI-1  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Hou L et al. Tissue Antigens 70:449-54 2007. abstract
Steiner NK et al. Tissue Antigens 67:277-83 2006. abstract
Trundley AE et al. Immunogenetics 57:904-16 2006. abstract
Wilson MJ et al. Proc Natl Acad Sci U S A 97:4778-83 2000. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 5 Laboratories: 3
Protein Sequence (410 aa)
MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSF
LMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGI
TEDPLRLIGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSR
YLHALIGTSVVIIPFAILLFFLLHRWCANKKNAVVMDQEPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQR
PKTPPTDTSV
Nucleotide Sequence Data (1233 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGGAGGGGCCCTGGCCACATGTGGGTGGTCAGGA
CAAGCCCTTCCTCTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACATGTGACTCTTCAGTGTCGCTCTCGTCTTG
GGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGCTCTACAACAGAATATTCCGGAACAGCTTT
CTCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCTGTGGTGATCATGGTCACAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCGGGAGAGACGGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTTCCTTCTGCACAGAGAGGGGATC
ACTGAGGACCCCTTGCGCCTCATTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACTATTCCATGGGTCCCATGACACC
TGCCCTTGCAGGGACCTACAGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTGTCGGCTCCCAGTGACCCTCTGG
ACATCGTGGTCGTAGGTCTATATGGGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTG
ACCTTGTCCTGCAGCTCCCGGAGCTTGTTTGACATTTACCATCTATCCAGGGAGGCAGAGGCCGGTGAACTTAGGCTCAC
TGCGGTGCTGAGGGTCAATGGAACATTCCAGGCCAACTTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCCACGCGTGGTCAGACCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTAACTCCAGA
TACCTGCACGCTCTGATTGGGACCTCAGTGGTCATCATCCCCTTTGCTATCCTCCTCTTCTTTCTCCTTCATCGCTGGTG
TGCCAACAAAAAGAATGCTGTTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGGGAGGACTCTGATGAAC
AAGACCCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGG
CCCAAGACACCCCCAACAGATACCAGCGTGTAA
Genomic Sequence Data (12084 bps)
GTATGAGAGATTGGATCTGAGACGTGTTTTGAGTTGGTTATAGTGAAGGATGCAAGGTGTCAATTCTAGTTGGAACAATT
TCCAGGAAGCCATGTTCTGCTCTTGACCAAACAGCCACTGGGCCTCATGCAAGGTAGAAATAGCCTGCATACGTCATCCT
CCCATGATGTGGTCAGCATGTAAACTGCATGAGCCCCTCACAACATCCTGTGTGCTGCTGAACTGAGCTGGGGCGCAGCC
GCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAATCGAGG
GAGGGAGCGGTGGGGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATA
TAGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAACTGTAGATATGG
GCCTGAAGTAGAGATATGGGCCTGGAGTAGAGATATGGGCCTGGAACTGTAGATATGGGCCTGGAGTGGAGATATTGGCT
TGGAGTGCAGATATGGACCTGGAATTGAGATACGGGCCTGGAGGTGGAGATATGGGCCTAGAGTGGAGATATGGGCCTGG
AGGTGGAGATATGGGCCTGGAACTGTAGATATGGGCCTGGAGTAGAGATATGGGCCTGGAGTGGAGATGTTGGCTTGGAG
TGCAGATATGGGCCTGGAATGGAGACACGGGCCTGGAGGTGGAGATACAGGCCTGGAGGTGGAGATATGGGCCTGGAGTG
TAGATATGGGCCTGGAGTAGAGATATAGGACAGAGGTGGAGATATAGGCCTGGAGTGGAGATATGGGCCTGGAGTAGAGA
TATAGGACGGAAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTGATGTACAGATGGATCATCCATCATGA
TCTTTCTTTCCAGGGTTCTTCTTGCTGGAGGGGCCCTGGCCACATGTGGGTGAGTCCTTCCCCCAAACCTTAGGTTGTCA
TCTCCCCACATAAGATGATGTTCCTGAAACGGGAGGCAGGCGACACAGGGGGTTGACTGATGGGCTGACCATGGGAAGCC
ATGTGGGAATCTCTCATGAACTAGGAAAAGGAAGCCAGGGGAAGCTTCGCCACAGTTCTGTCCTAGCCCTCCCCGGCCTT
TCTTTCCCTTGGCTGAGTCTGTGGGGACCCAGGGGGAGACTGAAGTGCTCAAAGGAGTGGTGTGCAGGGAGGAAGTGGTG
TCACCGGCAGAGGAAGGGAGAGAAGCAGTGCAAGGAACAACAGGCCTCTGAGGACAAGAGCATAACTCACACCCTCCAGC
GTTTCCATGACGGTAGGGGCTGCAATGTGGCTGCTGTCATTCTACCTAAGAGGTGGGGGAACCACAGTCATGACCCTGAC
ATTCCAGATCTTCTAATAGGGGCTCAGTTGTTTATTATGGTTCATGCATTAGCTGATCATGCCCTCCATCCTGTGTCTAC
CTTGTGTTCTTTTATGTAAGTAATTTTGCAGTGTTAAAATCTAGTAAGAGTCGCTTCTTCAGCACCTGCTCAAAGTTCTC
AGCTGACACTTGCTGTAGGGAGACGCCATGTCTATGCGGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAG
GAGCCTTAGAAACGTGGAAATGGGAGAATCTTCTGAGCACAGGGAGGGAGGGGCGGCTCCACATCCTCCTCTCTAAGGTA
GTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAGCCCTTCCTCTCTGCCTGGCCCGGCACTGTGGTGTCTGAAGGACAACA
TGTGACTCTTCAGTGTCGCTCTCGTCTTGGGTTTAACGAATTCAGTCTGTCCAAAGAAGACGGGATGCCTGTCCCTGAGC
TCTACAACAGAATATTCCGGAACAGCTTTCTCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTTGCAGT
TCACACCCACACTCCCCCACTGGGTGGTCGGCACCCAGCAACCCTGTGGTGATCATGGTCACAGGTCAGAGGCTTTCTGT
CTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCATCAGGGTCCAATCATCCAGGCCCA
GACTGTATTTGGGGTAAAGGGGGATTCAGTACAGAGAAATAGTTGCTGTGGTGGGAAGAATAATTGTCCCCAGTGATGGC
TACATGGTAATCCATGAACCCTGTGACTATTTATGTCATAGGGCAGGGGACTGAAGGGGAAGATGGAGCTCAGGTTGTTG
ATGGGTTGACCTTGCGATGGGGAGACAGCCTGGACTGTCCTGCTGTGCTCAGAGTAATCACAAGGGTCCTCATGAGAGGA
GGAGGAAGAGGAAAGTGGGGTTAGAGCAACGTCGTGGGAGGGAGACTCCATCAGCCACAGCGGGCTTTGAAGATGGGGGA
AGGCCATGAGCCACAAAGGCAGTTGGCCTCTAAGGGCTGGAGAAGTCAAGGGAACTGATTCTTCCCTGAGTCTCCAGAGG
AAACACAGCCCTGTAGATGCCTTGATTTTAGCCCAGAGAGAACTGGGTCCGATTTCTGTTCTCCAGAAGTGGAAGGGGTC
ATTGTATTCTCTCTTGCCCCATGTTTGTGACAATTTTCTCCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTGAAGC
ACAAGTTAAGAAACCAAACAAGGAGAAGGTTGGCTACACTGATTTTAGCATGGGTGGGATACTGATGCTACCACCAGGCT
CGATCCACATAGGGAGGGGTTGATGCTCCTGGAACCAGCACCAGGGGCCACCCTATGGAAGCTGGGGCCATGGAGAAGGC
ACAGACATGACAGGAGAGGCTCCCAATCCCCATCAGGAACAGGGACACTGATGCCTGCCTTACTGATGAGTTCGTACCTC
CTGCCAGCCTTTCCAATCTGTCCAAAAGAGATTGATTCAGGCTGCTAAGAGCCTGGACATGCAGCCTGTCGTGGTTCCTC
TTCCACCCCCACATAAACACCAGGAAAGAGATTAGTGGGAAACAGATACAACAGCATAAGAGGTGACACTGAGCACAGTG
GGAAGGGAATCAGGGCTACTAGAGACAGAGAGACAGGGAAGAGGGAGGGAGACAGATGGAGGGACCTGCAACAGGGGTTA
TGGGCACAAAAGAACACGGAGACACAGAGAGGAAGGAGAGAGATAGACACCATGGAGGGGAAGCCTCACTTATTTCAGGT
CCCATGAATGGGATGAGAAAGGGAGACGCCTTCTGAACTCACAACCTCTCTTCTTAGGAGTCCACAGAAAACCTTCCCTC
CTGGCCCACCCAGGTCCCCTGGTGAAATCGGGAGAGACGGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCGCTT
CCTTCTGCACAGAGAGGGGATCACTGAGGACCCCTTGCGCCTCATTGGACAGCTCCACGATGCGGGTTCCCAGGTCAACT
ATTCCATGGGTCCCATGACACCTGCCCTTGCAGGGACCTACAGATGCTTTGGTTCTGTCACTCACTTACCCTATGAGTTG
TCGGCTCCCAGTGACCCTCTGGACATCGTGGTCGTAGGTGAGAGAATACAGACCTGCCTCTCACCCTTGCTGGGAGATGG
AGTGAATGATCTAGGACTGGAAGCCCCAGGTGGTCATGAGGAAGATGAGTGTGGGGTTCCTATGGAGAGAAAGTGACTTG
GTGAGGTCTGTACCAACAAAGGCAGAGAAACAGGAGACACAAGTACAGACCTCATGTCATAACATAGAAGCCAGACACAG
GGGCCATACAAGGTGTTAGAAAAAGAGATAAAGAGGTAAAGAAGACACAGAGAGACAGATATATCCCAGAGAGAGGTGTC
CTTCTATGCTGACTTTGTTCAGAGACCAGGCACAGGTTAGAAGGTTCCATTCTGTTTTACCTCTACAAAGTGTTCTCTCC
CAGGAGAACCCAAAGAGACACATCTATCTGGCCTGAGTTGGGCCGTGTGGCCCCAGGCTGGTGGCACCTACAGATGCTGT
GTTTATTCTTAAACCTCTGCCTTCCGTGCAGTGGAGCTGTCGTCGTCGCAGGACACCATGGCCCCAGGTGAGGGAGCAGA
ACACCAACCCCTGTATGTTGTGAGTTCCTGGAGTCCCCATACTGGATTCTGAGGCTCATATTCAAATAGCACCACATGTT
ATAGGATTACTGAGAACAAAAGCCCACAGAGAGACACGGAGTGAAATCAGGGAAATCAAAAAGCAAAGACATGAACACAC
ACACAGAATGAGCCAGAAGAAGGGAATTGAGAGACTCACAGACACATAAAGAGATAGAAAAAGAGGGCAGAGAAGTGGAG
CGTATGATGGAAGGAAGCAGAGAAAAGCCCTAAAATCAGAGCCCTGAGGGAGGGGCACAAAGACAGGGAAAGATAAAGAT
GTGGGGATGGATTGCAGAGACTCCAAAAGGGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGATGGAGAGAGACA
GATGATAGATGGATAGATAGATATAGATAGATGAAAGATAAAAGGTAGATGATAGATAATAGAGAGACAGGTGATAGACA
AATAGATGATGAATGACTGATAGATGATATAGATAGACAAGTAGAAAGACAGACAGATGATATATAAATAGATATAGAGA
GATAGAAAGATAAACACATGATGATAGATGGATAGATGCATACATACATACATTGATTGATAGATGATAGATAACAGAGA
GATAGGTCATAGATACACAGATGATGATAGATGATAGATACATACATAGATAAATGATAGATCGATCAATAGATAGTAGA
TAGAAATATGCAGAAAGTTATGAGCAAGACAGAAAGTGAGAGACTCAGAATTAAAGAAAGAGGAAGATCAAGTCAACCAG
TCCAAGGAGGGTCAGAGAGAATAAAATGGTACAAAAAAAGAAAACATAGCTAGGGATGGAGAAGTGAGGTCAGAGACCTA
GAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGATGGGGGTGGAGGGTGAGAGAGAGAAAGAGAGCATTA
AGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGTGAGGAGAGCTGTGACAACGAAGAACCTCCCTGAGGAAACCAC
CTCTTCTCCTTCCAGGTCTATATGGGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTG
ACCTTGTCCTGCAGCTCCCGGAGCTTGTTTGACATTTACCATCTATCCAGGGAGGCAGAGGCCGGTGAACTTAGGCTCAC
TGCGGTGCTGAGGGTCAATGGAACATTCCAGGCCAACTTCCCTCTGGGCCCTGTGACCCACGGAGGGAACTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCCACGCGTGGTCAGACCCGAGTGACCCACTGCCCGTTTCTGTCACAGGTGAGAAAACA
CCATGCCTGTCCCATGTCTTGTGATCCTAGAGCCATAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGA
TGCCGAGACAGAACACACAGCATGGGTGTAAGGGCGGGGTCAGGGGGCAGGATGGCAGACAGGGCACCTCCAAACCCTCC
TGTATGGCCTGCAAGGAGGCCCTTGATCAGGGTTCCAGGCACCCAGGCAGATGGAGAAAGAGGTCAGAACAGACCCAGAG
GAGGGAGACTGGGCTCTGCCTGGGGAGATCAGAGGTTCTCTCAGCCCCTCAACCTTACCCACTTCCCAGAAGCCCATCCT
GGCCTGTCACCCACAGAGAGATGTCATCACCAGCAACGCCTACACCCTTTTCTTTTTGTTTGAAGAAATATTTATTGAGG
TGAAATATACCTATGTAATTTACCACCTTTACCATTTTTAAGTGTGAAGTCTACTGTTCATAAATACATTTATAGGCTGG
GCACGGTGGCTCACTGTTGTAATCCCAACACTTTGAGAGGCCAAGGCAGGTGGATCATTTGAGATCAGGGGCTCAAGACC
ACCCTGGCCAACATGGGGAAAATCCATCTGTACTAAAAATACAAAATAATAATAATAATGATAATAATTAGCCGAGCATG
GTGGCACATGCCTGTAGTCCCAGCTACTTGGGAGGGTTGGGCAGGAGTTGCACTTAATTGCAGGAGGCGGAGGTTGCAGT
GAGCTGAGATCATGCCACTGCACTGCAGCCTGGGCAACAGAGAGAGACACTCTCTCAAAATTAATTAATTAATTAATTAG
TATTCTTTTTTTTTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTAGCCACCATTCTACTCTCTACCTTTGTGAGATCC
ACCTTTTAGCTCCTGCATATGAGTGAGAAATGGAAATACTTGTAATGACCTCCAGTTCCATTCATGTGGCTGTAAATGAC
AGGATGTTACTCTTTCTATGGATGAGTTGTCCCTATTGTGTGTGTGTACCACATTCTCTCCATCCATTCACCCACTGATG
GGCAGGTAGGTTGATCCACATCTTGGCTACTGTGAACACTGCTGGAACAGTCATGGGAGTGCAGATGTCACTTCGATACG
CTGATGTCCTTTCCTTTGGGTTTACACCCAGTCATGGAATTGCTAGATCCTCTGGAAGTGTCTTTTTACATTTTGTTTTA
TGGTTTTTGTTTTTGTTTTTGTTTTTTTTAGACAGTTTCACTCTTGTTGCCCAGGCTGGAGTGCAGTGGTGCCATCTGGG
CTCACTGCAACCTCCACCTCCAGGATTCAAGAGATTCCCCAGCCTCAGCCTCCCAAGTAGCTGGGTTACTGGCTCCCACC
ACCACACTCGGCTAATTTTTATATTTTTAGTAGAGACAGAGTTTCGCTATATTGGCCAGGCTGCTCTTCAACTCCTGACC
TCAAGTGACCTACCCACCTCGGCCTCCCAATGTGCTGGGATTACAGGCATGAACCACTGTGCCCGACCTCATTTTATTTT
TTGAGGAACTTCCATACTCTTCTCCTCTGTAATGGCTGTACTAATTTGCATTCGTATCAGCAGTGTACCAGATGCAACCC
TGGTTGACTCAGCAGAGCAAGAGACGTGCAGTAAGAGAGAATTTAGCTTATTTATGCACACGACACTTCCACTCACTCAC
TCGTTCAGCCAATGCCCCATGCTCTGGCTGTGCAGTGTGGAATCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGCT
TCGTGGATGAAAACATGTTTTTCTTAATTATCTCACAGTGCTGTAACTCAGAAGTATGAACTGCATTTCACTGGGCTGAT
ATCAAAGGGACAGTAAGGCTGGATTTCTTTTTAAGGTTCCAAGCAAGAATCTGCTCCTTAACGTTTCCCAGCTCCTAGAG
GCTCCCACGTTCCTGGGCCCCTGGTCCCCTTCCTCCTTCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACGTCTCACAT
GGCATCATTCAGACTCTTCTTCTTTACCCATACCTTTTTCTCTGAATCCTGCTCTGCCTTCTTCCTCATCTTTTAAGGAC
TTTGGGATTCTATTGGGGTCACCAAGATAATCCATCTCAATCTCCCTAAAATCATCCAGCGTACCCTCTTTTTAAGTTCA
GCTGATTAGCAACCGTAATGCCATCTGCAATCTTCATTCCTCCTTTCCTGTAAAATAACATATTCACAAGCTATGGAGGC
TAAGACAGGGACATTTTGGGGGTGGGGCAGCATTCTCCTGCCTTCCACAAATGGTAAACAGGATGCATTTGGCCTCTGCT
CTTGGGACGCTGATATTGCAGATGGGTAAATGCGAGGGCAGAGAATGAATGCACAAGGGTACCAATAAATGAATGATCCA
TTGGGAAGCATCTGTGCACCAAATCTGGGGTTTTTTGTGTGTGTGTGTGTTTTTTGTTTTCTTTTTTTTTTTTGAGTAGA
GTCTCTCTCTGTTCCACAGGCTGGAGTGCAGTAGCACAATCTCAGCTCATTGCAACCTCTGCCTCCTGGGTTCATGCAAT
TCTCCTGCCTCAGCCTACCGAGTAGCTGGGATTACAGCTGTGCGCCACCACACTCGGCTAATTTTTTTGGTATATTTTTT
AGTAGAAATGAGGTTTCACCATGTTGTGCAGGCTGTCTCAAACTCCCAATCTCAAGTGATCCCACCGCCTTAGCGTCCCT
AAGTGCAAAGATTACAGGCGAGAGCTACTGCGCCCAGCCAGGATTTAAAATAAGTAATAGATAATGCTGAGTATATAATT
TCAGGTGACAGAGAAGGTCTCACTGATCAGATAATATTTGTGACCTTAATGGAAAAAATGGATTCAACCCTTGGAAGATT
GGCGGAAGGATTTTCCACACTGAGCTCTCAGCCGTGAAGGCACAAAGGTGGAAACATTCTTAGTTCAAGGAAGAGGCTCT
GCCTCAAATGCTGGGAATGAGATGGGGAGAATGACAAGACAACTGTAGAGAGATGGAGAGCACACTGGGTACACAGGAAA
CTAAGGAGGAACAAGGAGCATGTTTTTGATACTCACAGCCCTTGGATTCAACTCAGAGCTAACTAGGAATCCCTACCTGA
TTAACAGTGACCGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTCCCG
CCCCACTGGTGAAACGTAGGGTTGATTTACACACTAAATGAATGAAAGATGGATATAAGCTATGCTTGTGAGGTAGAATC
ATTTGCAGGGAGGGCTTGCTGGGTTTGATTTTTCCTAGTAGTTTAATCCTTGTTTCATTAATTTCTTTCTGAGATGTGTT
TTTTTTCTACATCTAAATCAATACCTGGCAGAGGAGCGATAGACACATGAGGGGTGGTGCAAATGAAGGGACCTAGTATA
ATATAATATACAAGACTGTGGATGGGGGCTCACACCTGTAACCCAACACTTTGGGAGGCCAAGGCGGGTAGATCACTTAA
GGGTAGGAGTTTGAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTGTACTAAAAATACAAAAATTAGCCTGGTGCATT
GGCACCTGCCTGTAATCCCAGCGACTGGGGAGGCTGAAGCAGAAGAATGGCTTCAACCCTGGAGGCAGAGGTTGAACTGA
GATCGCATCACTGCACTCCAGCCTGACACAGGGGGACTCTGTCTCAAAAAATAAAAATAAAACATACATAATTATGACAC
ACAGAAATTACAAAGGCAACTGGATACCAACCATCATTTTTCTATTTCTCTGTGTTTAATTCTTTGACCCTTTATCTTAT
CCATTAAACAATCAGGTTAAACCTCTTCCTTATTTGGCTTTCTGTGAGCTTGGGATCATATGGAAAATGTGAAAGCCTCC
TGAACCCACCAGCACAGGTCCTGGAATAGAGAACATGCTCTGTTCATGGCATAAAACTTGCCCCTTCACCCAAATCCCCC
AATTCATCTCTACTTCCAATCACCTATGGAGATACAGATAGATCATGGGGAGGTAAACACTAATACTCTTTGGAGTGAGC
TCAGATCTTGGACTCAGAGACCAGTGCCAGCACTAGCCCCTGGTCACATTTCGTACTAACTCACAGAAGGACAGGCTGTA
TTGAAACAATAAACGACGGAGAGGGCGGTCCTTCCCCGTGCTTCTCGGGTGGAATAGCAGCCTAATATATGTCTCAGCAG
ATCACAAAAAGTAGCATGTTGTTCCTGGGCTACATCATTATTTCATGGCTGTTTGATTTAAGTCAGTTCTACTTCACTTT
TTTTATCTTGATTTCATTTTTTCTTTCTTTTCTTGGAGAATGTAATTTTTTTGAGTCAAGAGGGTTGTGGTGGTAGAAAC
TGTAAAGCACATTCGCTGTGTATCAATCCCAATCCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGAATGTACCTGG
GCCTATACCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAACACATTACACAGGCAGGTTCATT
ACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTC
GAGACATGTGGAGTCACCCCATATGCAGTGTATCTGGGGGAAATCAAAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAG
CCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGGGA
TGTTCCTCCTGATCTCAGGACTTTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCT
AAAGAAAAGAAATGTGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCTTGTGACGGC
CTCAGGCTGCTCCCGCTCTGGCAGAAGGGAAGGAGGGTCTATCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGG
AGCAAGGGGGAGGGGGAGCGATGGAGCTTCCAAGTTCTTTTTAACAACCAGCTCTCCAGGAACTAATAGAGGGGGAACTT
GCTAACCCCATCTCCTTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCCCAAGAGGCC
CAACCTCCCACCCTGGGGGTTACATTTCAATGTGAGGTTTGAAGTGGTCAAACATCTAAACTAAAGCAGTTGTATCCTCA
GCACGTTCTATGGTTACTACAACTGAGAAAGCAGGAGGAAGCTAGGTCTCCCGCCATCTGGGTGCTTGTCCTAAAGAGAC
GTTGTATGTGGTTACCTGTCAATCAAGAAATGTGAGACAATTCATATAGAGGAACTGCTATGATTAGCTTCTTATTGGTG
TCTTGTCTTCCTCCAGGTAACTCCAGATACCTGCACGCTCTGATTGGGACCTCAGTGGTCATCATCCCCTTTGCTATCCT
CCTCTTCTTTCTCCTTCATCGCTGGTGTGCCAACAAAAAGAGTAAGTCTCACGAAGCAGAAGCCAGAGAGCTCAGGGCCA
TGTGGGGAAGCAGGATGGGAGCACTCAGGTGTGTGTTCCTTACAGGCAGGATGGTCCCTGACCCAAGGCAGGAGCCACAG
AGGCAGGACTTTCTAGAGAGAGCACCAGACTCCCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACCATA
TCCTCACATCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGAT
GGGAACTCAGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGG
ACCTCAGGCACCTATGGCCTCCCCCTGCATGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTGTT
TTGACGACTTCCGTCTTCTACAGATGCTGTTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGGGAGGTAG
GTGCTCCTCAGCCCAGCCTCATGGCTAGTCTTATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCAT
TTCCCTCCCTCCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACATACGCACAGTTGAATCACTGCGTTTTCACACAG
AGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCAACAGATACCAGCGTGTAACACGGAACTTCCAAATGCTG
AGCGCAGATCCAAAGTTGTCTTCTGTCCACCAGCACCACAGTCAGGCCTTGATGGGATCTTCTAGGGAGACAATAGCCCT
GTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCGTGAGTCTGCATCTTAGGGCATCGCTC
TTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAAAC
ACAC

IPD-KIR