Allele Report for 3DL2*056


3DL2*056
Previous Designations & Local Names: 3DL2_ABC08_ABhapTA
IPD Acc No: KIR00624
Assigned: 31-MAR-2010 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182361 , GU182362  
Cells Sequence Derived From: ABC08  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (455 aa)
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESF
IMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDIMFEHFFLHREGI
SEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPS
SSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ
LDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Nucleotide Sequence Data (1368 bps)
ATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACTCATGGGTGGTCAGGA
CAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCTCGAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTG
GGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTC
ATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTC
GGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGC
TGAAATCAGGAGAGACAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAGAGAGGGGATC
TCTGAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCC
TGTCCTTGCAGGAACCTACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGG
ACATCGTGATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTG
ACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCG
TGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGT
GGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAACAAAAAGAATGCTGCTGTAATGG
ACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACGTACGCACAG
TTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGACACCCCTAACAGATACCAGCGT
GTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGG
TTTTCTAG
Genomic Sequence Data (17025 bps)
GTGTGAGAGGTTGGATCTGAGACGTCTTTTGAGTCTGGTCATAGTGAAGGATGCAAGGTGGCAATTGTAGTCACAACAAT
TTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGC
GCGGCCTCCTGTCTGCACCGGCAGCACCATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGTGAGTCCTGGAAGGGAA
TAGAGGGAGGGAGAGTGGGGATGGAGATCTCGGCCTAGAGGTAAAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGT
GGAGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGGTGTAAATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGGG
AGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGTGGAGATACGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGA
TATGGGCCTGCAGGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATAT
GGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTAGAGGGGAGATCTGGGCCTGGAGTGGAGATATGGGT
CTGATGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATATGGGCCTGGAGTGGAGATAGGGGCCTGG
AGTGGAGATATGGGCCTGGAGTGGAGATCTGGGCCAGGAAGTGTTGATCTGGGCCTGGAGCCTGGGTCTCTCCACAGCTG
AGAGCCCTGTTCTTGGCAGCAGGTAGCAGGGAGGCTAAGTTTACCTTCAGCCCAGCAAGGGCCTGGCTGCCAAGACACAC
AGTGCAGTGGGGGCAGCAGGGTGCCCTGGTTTGCCTGCAGTTGGATCGTCTATCATGATCTTTCTTTCCAGGGTTCTTCT
TGCTGCAGGGGGCCTGGCCACTCATGGGTGAGTCCTTCCCCAAACCTTAGGGTGTCATCTCCCCACATAAGAGGATTTTT
CTGAAACAGGAGGGAAGTCCTGTCGGGGAGTCTCTCATAAACTAGGAAGAGGGGACCCTTGGATACTCGGCCCACATTTC
TGACCTCGCCCTCCCCGGCCTTTCTTTCCCTTTCCTGAGTCAAGCTCTGTGAAGACTGGGGTGAGACTGGGGTGCTCCAA
GCTGGGGTGTGCAGGGAGGAAGTGGTGTCAGCAGCAGAGAAAGAGAGGGAAGCAGTGCTAGGAACAGCAGGTCCTCTGAG
GACAAAGGTATAACTGACACCCTCCAGCGTTTCCGTGACGGTAGGGACTGCAGTGTGGCTGCGGTCTTTCTACCAGAAGA
GGGGGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGAGGGGGCTCAGTTCATGAATTGGCTGATATTCCATTC
ACATAGGACATGCCCTCCATGCCGTGTCTACTTTGTGTTGTTTTATGTGAGTAATTTTGCAGTATTAAAATCTAGTAAGA
GTCACTTATTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTGTTGTAGGGAGACGCCATGTCTATGTGGGGTGGGTCCT
TCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAGAAAGTGGAAATGGGAGAATCTTCTGAGCACAGGGAGGGAG
GGGTGGCTCCACATCCTCCTCTCTAAGGCAGTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAACCCTTCCTGTCTGCCCG
GCCCAGCACTGTGGTGCCTCGAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTGGGTTTAACAATTTCATGCTGT
ACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTCATCATGGGCCCTGTGACCCCA
GCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTCGGCACCCAGCAACCCCCTGGT
GATCATGGTCACAGGTCAGAGGCTTTCTGTCTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGG
TGTCCATCAGGGTCCCATCACCCAGGCCCCAACTGTATTTGGGGTCAAGGGAGATTGAATACAGGGGAAATGGGCGCTGT
GGTGGGAAGAATAACTGTCGCCAATGATGGCTACATTGTAAACCCTGGAGCCTGTGACTATTTATGTTATAGGGCAGGGG
ACTGAAGGGGAAGGTGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCTGCTGGGCT
CAGTGTAATCACAAGGGTCCGCGTGAGAGGTGGAGGAAGAGGGGAGTGGGGATTAGAGCAGTGTAGTGGGAGGGAGACGC
TATCAGCCACTGTGGGCTTTGAAGGTGGAGGAAGGCCACTAGTCACAGAATGCAGGTGGCCTCTAAGGGCTGGAGAAGTC
AAGAGAACTGATTTGCTGAGTCTCCAGAGGGAACGCAGCCCTGCAGATGCCTTGATTTCAGCACAGGGAGAACTGGATCC
AATTTCTGTCCCCAGAAGTGGAAGGGGTCAGTGTGTTCTCTCCTGCTGCCATGTTTGTGATAATTTTCTGCAGCAGCAAC
AGGAAACCGACACAGGAACCCAGGTCAAGGACAAGCTAGGAAACCAAACAAGGATAGCCAGGTGTGGTGGTGGGCACGAG
TAATCCAACGACTGGGGAGGCTGAGGCAAGATAATCACTTGAACCGGGGAGGCAGAGGTTGCAGTGAGCCAAGACAACAC
CACTGCACTCCAGCCTGGGTGAAAAAGTGACTGTCTCAAAAATAAATTAATTAATCAATTAATTAAAGAAACCAAACAAG
GAGAAGGTTGGCTACCGTGGGATCAGCAAGGGTGGGATGCTGATGCCACCACCAGGCTCCATCCACATAGGAAGGGGTTG
ATGCTCCTGGAACCAGCACCAGGGACCACCCTATGGAAGCTGGGGCCATGGAGAAGGCACAGACATGGCAGGAGAGGCTC
CCAATCCCCATCAGGAACAGGGTGTGTGGACACTGATGTCTGCCTTACTGATGAGTTGATACCTCTGCCAGAGACTCCAA
TTTGTTCAAAAGAGATTGATTCAGGCTGCTGAGAGCCTGGACATGCAGCCTGTCCTCTTCCACCCCCACATAGACAGCAG
GAAAGAGACTAGTGGGAAAGAGATACAACAGCCCAAGAGATGAGGCTCTCTTCACAGTGGGAAGGGAGTCAGGGGCTACT
GGAGACAGAGGGACAGAGAAGAGGGAGGAAGACAAATGGAGGGACCTGCACCAGGGGATATGGGCACAGAAAAGACACGG
AGACACAGAGAGGGAGGAGAGAGACAGACCTCTGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATGATAA
AGAGAGATGCCTTCTAAACTCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCC
TGCTGAAATCAGGAGAGACAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAGAGAGGGG
ATCTCTGAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGAT
GCCTGTCCTTGCAGGAACCTACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCC
TGGACATCGTGATCACAGGTGAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGACACAGAGTGAATGATCCAGGACTT
GGAACCCCCAGGTGGTCATGAGGAAGATAAGCGTGGGATTCTTATGGAGAGAGACTGACTCGGTGAGGTCTGTACCAACA
GAGACAGGGAAACAGGAGACATAAGTACAGACCAGGTGTCATAACAGAGGACAGACACAGGGGCCATACGGGGAAGTAGA
AAAGAGAGAAAGAGGTAAAGGAGACACTCAGACAGACAGACATGTGCCAGAGAGAAGTGTCCTTCCATGCTGACTTTGCT
CAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTGTCTCCACAAAGTGCTTCTACGAGGAGAACCCAAGGACACC
CATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCATCTACAGATGCCATGTTTATTCTGACACCTCTG
CCTTCCATGCAGTGGAGCCATAATTATCCCAGGATATCATGGCCCCAGAACACCAACCCCTAAATACTGTGTGTACTTGG
TGTCCCCAGACTAGATTCTGAGGCTCATATTCCAAATAATCCTACATATAATAGGATCACTGAGAGACACAGAGATAAAT
CAGGGACTTCAAAAAGCAAAGGCATAAACACACAGAGAATGAGCCAGAGGAAGGGGATTGAGAGACTCACAGACACACAA
AAAGAAAGAAAAGAGGGCAGAGGAGTGGAGAGAATGCTGGAAGGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGG
AGGGGCACAAAGACAGAGAAAGATAAAGATGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGC
AGAGAAAGACAAGGAGATGGAGAGAGACAGATGATAGATGGATAGATAGATATAGATAGATGATAAATAGGTAGATGATA
GATAATGGATAGGTTATAGATACATAGATGATGATTGATAGATGATACATAGAGATGATGATGATGATGATGATGAAGAT
AGATAGATAGAAGACACATATATAAATATATAGATACATAGATGATACATAGAGACTGACAGGCAGACAGAGAGGTAATA
GAGAGAGAGAGAGATGATACATAGATACAGATAATACATAGATGATTGATGGATAGACAGATAGACAATTGATAGATAAA
TGATACATAGATATAGATGACAGATAATTTGTAGATAGACACAAAATAGATAGATAGATAATAGATAGAAATATGCAGAA
AGTTATGAACAAGACAGAAAGTGAGAGACTCAGAATTATAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGAGTCAG
AGAGAATAAAACAATCCAAAAAGGGAAAGCATACCCAGGGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGG
CGGAAGGAGGAAATAGACATGAAGAGAGTTGGGGTGGAGGGTGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAG
TGAGTTCTCAGCTCAGGTATGAGGGGAGCTGTGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTC
TATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTGACCTTGTCCTGTAGCTCC
TGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCGTGCAGTGCCCAAGGTCAA
CAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGCCC
TGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAACCCGTGTCTGTCCCATGTC
TTATGATCCTAGAGCCATAGCTGAGGAGCTTCCTGCCGATGATGGGGAGAAGCATGGACAGATGCAGAGAGAACACGAAG
ACTGGGTGTGGGGGGGGGTCAGGGTGCAGGATGGCAGACAGGGCACCTCCAAACCCTCTTGCATGGCCTGCATGGAGGCC
CATGGTCAGGGCTCCAGGCACCCAGGCAGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTCAGTT
TGGGGAGATCAGAGGTTCCCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAG
AGATGTCATCACCAGCAACCCCTACACTCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAA
TTTACCAACTTTACCATTTTTAAAAGTAAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTT
GTAATCTTGGCGCTTTGAGAGGCCAAGAAAGGTGGATCATTTAAGATCAGGGACTCGAGATCAGCCTGGCCAACATGCGG
GAAATTCATCTTTACTAAACAGACAAGAAAAATTAGCCAAGCATGCCGGCATGCACCTGTAGTCCTAGCTACTTGGGAGG
CTGAGGCAGGAGAAGCACTTAAAGCCAGGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGA
GACAGAGAGAGACTCTGTTTCTAAATAAATAAATACATCTATATTCTTTTTTTTGTTACCTTCCACCCTTCCCTTCCTGG
CCTCTGGTATCCACCATTCTATTCTCTACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGTGAGAAATGGGAATCT
TTGTAATGACCTCCAGTTCCATCCATGTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACCGT
GTGTGTGTACTACAGTTCTCTATCCATTCACCCACTGATAGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAG
TGCTGGAACAGTCATATGAGTGCAGATATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAA
TTGCTGGACACTATGAAAGTTCTCTTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTC
AAAGTGGTGCGATCTTGGCTCATTGCAACCTCTGCTTCCTAGGTTCAAACGATTCTCCTGACTCAGCCTCCCTAATAGCT
GTGATTACAGGTGCACGCCACCATGCCTGACTAATTCTTGTATTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGG
CTGCTCTCAAACTCCTGACCTCAAGTGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTAT
GCCCAGCCTCCTTTTAGTTTTTTAAAGATTTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACA
GGGTACCAGGGTTCTCCTTTCTCTACCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGATAAAAGCCATTTTACTTTA
CTTTATTTATTTATTTATTTATGTTGAGATGGAGTTTCACTCATAGTCGCCCAGGCTGGAGTGCAAGGGTGTGATCTCGG
CTCACTGCAACCTCTGCCTCCCGCGTTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGC
CACCACGCCTAGCTAATTTTTGTATGTTTAGTAGAGAGGGAGTTTCTCCATGTTGGTCAGGCTGGTCTCCCGACCTCAGG
TGATCCGCCCACCTCCGCCTCCCAAAGTGCTGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGA
GATGAAAACTCATCGCGATTGTAATTTACATTTCTGTGATGATGAGTGATGCTGAGCACTTTTTCATATACGTGATCGCC
ATTTCTATGTTTTGTTTGTGGAGAAATGTCTCCTCATGTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTT
TGAGCTTCTTATATTTCCAGTTATTAATCCCATCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTGGGTTGTC
TCTTCACTTTGTTGGTTTATCTTTGGTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTG
ATTACTTGTGTTTTGAAGGTTTTAAACAAAATGTCTTTCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTT
CATAGGTTCAGGCCTTAGACTCATGTTTTTAATCCATTTTCATTTGATTTTTGTGTAAGGTGACAGGTATAGATGCAGTT
TTATTCCTCTGCATGTAGATATCCAGTTTTCCCCACACCATTTATTGAAGACTGTCCTTTCCTGATTGTAAGTTCTCGGC
ACCTTTGTCAAAGTCCATTAAATGGGCTGGGTATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGG
TGGATCACCTAAAGCCAGGAGTTCAAGACCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTA
GCTGAGCATGGTGATCAGTGCCTGTAATACCACTACTCAGGAGTTTGAAGCAAGAGAATTTCTTGAATCCAGGAAGTGGA
GGTTGCATTGAGCTGAGATTGCACCTCTACACTCCAGCCTGCATGACAGAGCAAGATTCTATCACACACACACAAAAGAA
AGCCATTGGATGTAAATGCATGGATTATATCTGTGTTCTTCATTCGGTTCCATTTTTTATGTGCCTTTCTTTATGCCAAT
GTCATGCTGTTTTGCTTACTACAGCTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACC
TTCAAGTCTCAAGACAGTGGGCATCGCACACAAAAATTATGGAGAAAAGGATCCCAAGACTCCCAGGGTCCAACATTAGA
TAACAGAGTGTTGGCCATGAACCAACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTC
CTGTCCCGTGTTCTAGGAAACCCTTCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGAC
CCCTCTTATCTCTGCTTTTGGAAACCTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTG
AATGAGGGCCTGTCTTCCACCATCTCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAG
CGAAGTCTCTTTACCTTTAATTTCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAATAATTGCCAATCTGACATCCTTCT
CAGGAAAAATGCAGTGTTTTTTCTGCCTGCATTCCTAACTGGAGGATAAATTCCCGGGGGCTTGAGAGAGGGAAGGGAAG
GGAACATCTGATGAGGGTGGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATCAGGCAACCCT
GGCTGACTCAGCAGAGCAAGAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCAGTGACTCATTC
AGCCACAGCCCCATGCTCAGGCTGTGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGT
GTGAAAACAAAACGGTTATTTAATTATCTTACAGTGCTGTAGCTCAAAGCATGACGTGCATGTCACTGGGCTAAAATCAA
GGTGACAGCAAGGCTGCCTTCCCTCTGAGGGTTCCAGGCAAGAATCTGCTTCTCACTTTTCTCAGCTTCTAGAGGCTCCC
ATGTTCCTTGGCTCCTGGTACCCTTCCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGA
CCCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTGCTCTCCCTTCTTGCCCTTCTTTTGAAAACTTGGGGATTCTATT
GGGTTCACCAAGATGAAAATCCATCATAATCTCCCGGAAATCATCCAGGATACCCTCCTTTTAAGTTCAGCTGACTAGCA
ACCATAATTCCATCTGCAATCTTCATTCCTCCTTTCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACATGGA
CATTTTTGGGGTGGGACAACATTCTCCTGCCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGTTCTTGGGACACT
GATCTTGCAGATGGTTAAATGGGAGGGCAGAAAATGTAGGCACAAGGGGACCAATAAATGAATGATCTATTGAGAAGCAT
CTGTGCATGAAATCTATTTATTTATGTATTTACCTACTTGTTTATTGAGACGGAGCCTTGCTCTGTCGTCCAGGCTAGAG
TGCGGTGGCATGATCTCGGCTCACTGCAACCTCCACCTCCTGGGCTGAACTGATCTCCTCCCTCAGCCTCTCCAGTAGCT
GGGATTACAGACCACAACCACCACGCCCGGCTAACTCTTTTTGCATATTTTCTGTAGAGAGGATGTTTCACCATGTTGGC
CAGGCTGGTCTCAAATTCCCAACCTCAGGTGATCCAATAGCCTCTGCCTCCCAACACGCTGGGATAAGAGGCATGAGCCA
CGGGGCCAAGCCAAATTTTCAAATCAATAATAGATAATGCTGAGTGTATTATTTCAGGTGACAGAGAAGTTCTCACTAAT
CAGATATTTGTGACATTAATGAAAAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTGCACACACAGCTGTCA
GCCGTGAAGGCACAAAGGTGAAAACAATCTGATGTGGAAGGAAGAGGCTCTGCCTGAAATGCTGGGAATGAGGTGGGGAG
AATGACAAGATGACTGTAGAGAGACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGCGTGTGTTTGA
CACTCACAGCCATTGGATTCACCTCGAGGTAACCAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGG
CTCAGTTGCATAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGA
CACTAAATGAATGAAGTAGATGGATATAAGATATGTTTGTGAGGTAGAATCATTGGCTGGAAAGGCTTGCTGGGTTTAAT
TTTTCCTGGTAGTTTAATCCTCGCTTCACTAACTTATTTCTGAGATTTATTTCTCCTGCATCTAAATCAATACCTGGCAG
AGGAGGGAGAGCTAGATGAGGGGTGGTGCAAATGAAGGGACCTAGTATAGCATAATATACAAGGCTGTGAACGGTGGCTC
ACGCCTGTAACCCAGCACTTCAGGAGGCCAACGCGGGTGGATCACATGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACA
TGGAGAAACCCTATCTCTACTAAAAATACAAAAATTAAACAGGCATGATGGTGGTGCATGACTGTAATCCCAGCTACTCT
GGAGGAGGAAGCAGGAGAATGACTTCAGCCCTGGAGGCAGAGGTTGCAGTGAGTGGAGATCGCATCACTGCACACCAGCC
TGGGCTACACAGGGATACTCTGTCTCAAAAAATAAAAATAAAAAATACATAAATATAATAATATACACAAATGATGCAGG
CACCTGAATTCCAATCATCATTTTTCTATTCCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGAAAATCAGC
CTAAAACCTCTTCCATATTTGGCTTTCTGTGAACATGAGATCATATGGAAAATATGAAAGCCCCCTGAACCCACCAGCAC
AGGCCCTGAAATAGGGAAAGTGCTCTGTTCATCACAAGAAACTTTCCCCCTCACCCAAATCCCCCACCTCACCCCTACTT
CCAATCACCTGTGGAGATACAGATAGATCATGGGGAGGTAAACGCTAATACTCCTTGGAGTGAGTTCAGATCTTGGAATC
AGAGATCAGCACCAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATG
GTGGAGGGGGTGGTCTTTCCCCCAGCCTCTCAGGTGGAACAGCAGCCTAACATGTGTCTCGCGAGATCACAAAGAGTAGC
ACGTTTCACATGGGCTTCATCATTATTTCCTGGCTGTTTGACATAAGAGAATTCTACTTTGCTTTTTTGATCTTGATTTC
ACTTTTGTGTCCTTTTCTTGGAGAATGTAATTTGAGTCAAGAGGGTTGTGGATGTAGAAACTGTAAAGCACATTCACTGT
GTATCAATCCCAGTCCAGTCTTTCCAGAGAAGACTCTAAACACCTGCTGTACTGCACCTGGGCCTATGCCAATTTCTATC
ACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGA
GTGACAACAGAAGCCTACATTTCAACGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCT
CATTTGCAGTGTATCTGGGGGAAGCCAGAAAATAGCCCAGCCTGGGTTTTGTACCCTGAAGCCACAGGAAGCACTCAGCT
AAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCACAGGCTGTTCTGAGACGTTCCTCCTGATCTCAGG
ACGTTGCTGTCTTAGTCCATTTTTGTTGCTATAAAAGAACACTTGAGCCTGGGTTACTTCTTTTTTTTTTTTTTTTTTTT
TGTATAGTGCTTCTGATGAGCTTTTTTTTAAAATTTTTATTATTATTATACTTTAAGTTTTAGGGTACATGTGCACAATG
TGCAGGTTAGTTACATATGTATACATGTGCCATGCTGGTGTGCTGCACCCATCAACTCGTCATTTAGCATTAGGTATATC
TCCTAATGCTATCCCTCCCCCCTCCCCCCACCCCACAACAGTCCCCAGAGTGTGATGTTCCCCTTCCTGTGTCCATGTGT
TCTCATTGTTCAATTCCCACCTATAAGTGAGAACATGCGGTGTTTGGATTTTTGTCCTTGTGATAGTCTACTGAGAATGA
TGATTTCCAATTTCATCCATGTCCCTGCAAAGGACATGAACTCATCATTTTTTATGGCTGCATAGTATTCCATGGTGTAT
ATGTGCCACATTTTCTTCATCCAGTCTATCATTGTTGGACATTTGGGTTGGTTCCAAGTCTTTGCTATTGTGAATAGTGC
CACAATAAACATACGTGTCCATGTGTCTTTATAGCAGCATGATTTATAGTCCTTTGGGTTTATACCCAGTAATGGGATGG
CTGGGTCAAATGGTATTTCAAGCTCTAGATCCCTGAGGAATCGCCACACTGACTTCCACAATGGTTGAACTAGTTTACAG
TCCCACCAACAGTGTAAAAGTGTTCCTATTTCTCCACATCCTCTCCAGCACCTGTTGTTTCCCGACTTTTTAATGATCGC
CATTCTAACTGGTGTGAGATGGTATCTCATTGTGGTTTTGATTTGCATTTCTCTGATGGCCAGTCATGGTGAGCATTTTT
TCATGTGTTTTTTGGCTGCATAAATGTCTTCTTTTGAGAAGTGTCTGTTCATGTCCTTTGCCCACTTTTTGATAGGATTG
TTTGTTTTTTTCTTGTAAATTTGTTTGAGTTCATTGTAGATTCTGGATATTAGCCCTTTGTCAGATGAGTAGGTTGCGAA
AATTTTCTCCCATTTTGTAGGTTGTCTGTTCACTCTGATGGTAGTTTCTTTTGCTGTGCAGAAGCTCTTTAGTTTAATTA
GATCCCGTTTGTCAATTTTGGCTTTTGTTGCCGTTGCTTTTGGTGTTTTAGACATGAAGTCCTTGTCCATGCCTATGTCC
TGAATGGTAATGCCTAGGTTTTCTTCTAGGGTTTTTATGGTTTTAGGTCTAACGTTTAAGTCTTTAATCCATCTCAAATT
AATTTTTGTATAAGGTGTAAGGAAGGGATCCAGTTTCAGCTTTCTACCTATGGCTAGCCAGTTTTCCCAGCACCATTTAT
TAAATAGGGAATCCTTTCCCCATTGCTTGTTTTTCTCAGGTTTGTCAAAGATCACATAGTTGTAGATATGTGGCATTATT
TCTGAGGGCTCTATTCTGTTCCATTGATCTATATCTCTGTTTTGGTACCAGTACCATGCTGTTTTGGTTACTGTAGCCTT
GTAGTATAGTTTGAAGTCAGGCAGCATGATGCCTCCAGCTTTGTTCTTTTGGCTTAGGATTGACTTGGCAATGCAGGCTC
TTTTTTGATTCCATATGAACTTTAAGGTAGTTTTTTCCAATTCTGTGAAGAAAGTCATTGGTAGCTTGATGGGGATGGCA
TTGAATCTATAAATTACCTTGGGCAGTAAGGCCATTTTCACGATCTTGATTCTTCCTACCCATGAGCATGGAATGTTCTT
CCATTTGTTTGTATCCTCTTTTATTTCATTGAGCAGTGGTTTGTAGTTCTCCTTGAAGAGGTCCTTCATATCCCTTGTAA
GTTGGATTCCTAGGTATTTTATTCTCTTTGAAGCAATTGTGAATGGGAGTTCACTCATGATTTGGCTCTCTGTTTGTCTG
TTATTGGTGTATAAGAATGCTTGTGATTTTTGTACATTGATTCTGTATCCTGAGACTTTGTAGAAGCTGCTTATCAGCTT
AAGGAGATTTTGGGCTGAGACAATGGGGTTTTCTATATATACAATCATGTCATCTGCAAACAGGGACAATTTGACTTCCT
CTTTTCCTAATTGAATACCCTTTATTTCCTTCTCCTGCCTAATTGCCCTGGCCAGAACTTCCAACACTATGTTGAATAGG
AGTGGTGAAAGAGGGCATCCCTGTCTTGTGCCAGTTTTCAAAGGGAATGCTTCCAGTTTTTGCCCATTCAGTATGATACT
GGCTGTGGGTTTGTTATAGATGGCTCTTATTATTTTGAGATACGTCCCATCAATGCCTAATTTATTGAGAGTTTTTAGCA
TGAAGCGTTGTTGAATTTTGTCAAAGGCCTTTTCTGCATCTATTGAGATAGTCGTCCGGTTTTTGTCTTTGGTTCTGTTT
ATATGATGGATTACATTTATTGATTTGCATATATTGAACCAGCCTTGCATCCCAGAGCCTGGGCAACTTCTAGAGAAAAC
AGATTTGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTGTTTCCTGTGACGGCCTCAGGCTG
CTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACATGGCAAGAGAGGGAGCAAGGGG
GAGGGCGAGCGATGGAGCTTCCAAGCTCTTTTTAACAACCAGCCCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCC
ATCATGTGGGGCAGCATTAATCTATTCATGATGGATCCACCTCCATGACTCAAACACCTTCCCATAGGCCCAAACTTCCA
CACTGGGGGTTAAATTTCAATATTTCAGTGTGAGGTTTCAAAGGGTCAAACATCTAAACTAAAGCAGCTGTATCCTCAGC
ATGTTCTATGGTTTCTATGAGAGCTGTAACTGAGAAAGCAGGAGAAAGCTGGGTCTCCCGCCATCAGGCTGCTTGTCCTA
AGGAGATGTTCCATGTGGTTACCTGTCAATCAAGAAATGAGACAATCCATAAAGAGGAACTGCTATGATTAGCTTCTTAT
TGGATTCCCATCTTCCTCCAGGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCATCTTCCTCTTCATC
CTCCTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAACAAAAAGAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAG
GGCCATGTGGGGAAGCAGGATGGGAGCACGCGGGTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGGGAGGAGC
CACAGAGGCAGGGCTTTCTAGAGAGAGCACCAGACAACCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGGTTCTGAA
CTGTATCCTCACATCCCCTGCAGCTACTGACATCCAGAAGCTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGG
ATGCCAATTGAGAGCACTTCATGGGATGGGGTCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGGATGTTGGCAGCTGA
AGAGCCTCAGGCACCTACAGCCTCCCCCTGTGGGTTGGTGTCTGCCCATGAAATGAGGACCCAGAAGGGCCCTCCAAGCG
GTTTTGATGACTTCCGTCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGG
TAGGTCCTCCTCGGCCCAGCCTCACGGATACAGTCTTATCCCTAATAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCA
GCATTTCCCTCTCTCCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACGTACGCACAGTTGGATCACTGCGTTTTCAT
ACAGAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGACACCCCTAACAGATACCAGCGTGTACACGGAACTTCCAAATG
CTGAGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGGTTTTCTAGGGAGACAACAGC
CCTGTCTCAAAACCAGGTTGCCAGATCCAATGAACCAGCAGCTGGAATCTGAAGGCATCAGTCTGCATCTTAGGGGATCG
CTCTTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGCCTAAGGTCGCCACTGCCTGCTGCAGAGAA
AACACACTCCTTTGCTTAGCCCACAAGTATCTATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCC
TAGTCCTACTTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAACATACAAGAGGCTCCCTCTTAACACGGCACTT
ACACACTTGCTGTTCCACCTTCCCTCATGCTGTTCCACCTCCCCTCAGACTATCTTTCAGCCTTCTGTCATCAGTAAAAT
TTATAAATTTTTTTTATAACTTCAGTGTAGCTCTCTCCTCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR