Allele Report for 3DL2*023


3DL2*023
Previous Designations & Local Names: KIR3DL2_r1
IPD Acc No: KIR00279
Assigned: 20-DEC-2007 Sequence Last Modified: 16-AUG-2010
Source Entries: EU272657 , GU182356 , GU944867  
Cells Sequence Derived From: 2-PAC , GM17118 , RSH  
Known Ethnic Origin Of Source: Black
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
Protein Sequence (455 aa)
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESF
IMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGI
SEDPSHLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPS
SSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ
LDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Nucleotide Sequence Data (1368 bps)
ATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACTCATGGGTGGTCAGGA
CAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCTCGAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTG
GGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTC
ATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTC
GGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGC
TGAAATCAGGAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCTTTCTGCACAGAGAGGGGATC
TCTGAGGACCCCTCACACCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCC
TGTCCTTGCAGGAACCTACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGG
ACATCGTGATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTG
ACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCG
TGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGT
GGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAACAAAAAGAATGCTGCTGTAATGG
ACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACGTACGCACAG
TTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGACACCCCTAACAGATACCAGCGT
GTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGG
TTTTCTAG
Genomic Sequence Data (17001 bps)
GTGTGAGAGGTTGGATCTGAGACGTCTTTTGAGTCTGGTCATAGTGAAGGATGCAAGGTGGCAATTGTAGTCACAACAAT
TTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGC
GCGGCCTCCTGTCTGCACCGGCAGCACCATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGTGAGTCCTGGAAGGGAA
TAGAGGGAGGGAGAGTGGGGATGGAGATCTCGGCCTAGAGGTAAAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGT
GGAGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGGTGTAAATATGGGCCTGGAGTGCAGATATGGGCCTGGAGGGG
AGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGTGGAGATACGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGA
TATGGGCCTGCAGGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATAT
GGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTAGAGGGGAGATCTGGGCCTGGAGTGGAGATATGGGT
CTGATGTGGAGATATGGGCCTGGAGTGGAGATAGGGGCCTGGAGTGGAGATAGGGGCCTGGAGTGGAGATATGGGCCTGG
AGTGGAGATCTGGGCCAGGAAGTGTTGATCTGGGCCTGGAGCCTGGGTCTCTCCACAGCTGAGAGCCCTGTTCTTGGCAG
CAGGTAGCAGGGAGGCTAAGTTTACCTTCAGCCCAGCAAGGGCCTGGCTGCCAAGACACACAGTGCAGTGGGGGCAGCAG
GGTGCCCTGGTTTGCCTGCAGTTGGATCGTCTATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCC
ACTCATGGGTGAGTCCTTCCCCAAACCTTAGGGTGTCATCTCCCCACATAAGAGGATTTTTCTGAAACAGGAGGGAAGTC
CTGTCGGGGAGTCTCTCATAAACTAGGAAGAGGGGACCCTTGGATACTCGGCCCACATTTCTGACCTCGCCCTCCCCGGC
CTTTCTTTCCCTTTCCTGAGTCAAGCTCTGTGAAGACTGGGGTGAGACTGGGGTGCTCCAAGCTGGGGTGTGCAGGGAGG
AAGTGGTGTCAGCAGCAGAGAAAGAGAGGGAAGCAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTATAACTGACA
CCCTCCAGCGTTTCCGTGACGGTAGGGGCTGCAGTGTGGCTGCGGTCTTTCTACCAGAAGAGGGGGGAAACCACAGCCAT
GGCCCTGACATTCCAAATCCTCTGAGGGGGCTCAGTTCATGAATTGGCTGATATTCCATTCACATAGGACATGCCCTCCA
TGCCGTGTCTACTTTGTGTTGTTTTATGTGAGTAATTTTGCAGTATTAAAATCTAGTAAGAGTCACTTATTCAGCACTTG
CTCAAAGTTCTCAGCTGACACTTGTTGTAGGGAGACGCCATGTCTATGTGGGGTGGGTCCTTCCTGTAGCCCTGGGCACC
CAGGTGTGGTAGGAGCCTTAGAAAGCGGAAATGGGAGAATCTTCTGAGCACAGGGAGGGAGGGGTGGCTCCACATCCTCC
TCTCTAAGGCAGTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCT
CGAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTGGGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCA
CGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTCATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACA
GATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTCGGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGTCAG
AGGCTTTCTGTCTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCATCAGGGTCCCATC
ACCCAGGCCCCAACTGTATTTGGGGTCAAGGGGGATTGAATACAGGGGAAATGGGCGCTGTGGTGGGAAGAATCACTGTC
GCCAATGATGGCTACATTGTAAACCCTGGAGCCTGTGACTATTTATGTTATAGGGCAGGGGACTGAAGGGGAAGGTGGAG
CTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCTGCTGGGCTCAGTGTAATCACAAGGGTC
CGCGTGAGAGGTGGAGGAAGAGGGGAGTGGGGATTAGAGCAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGTGGGCTT
TGAAGGTGGAGGAAGGCCACTAGTCACAGAATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTCGCTGA
GTCTCCAGAGGGAACGCAGCCCTGCAGATGCCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCCCCAGAAGT
GGAAGGGGTCAGTGTGTTCTCTCCTGCTGCCATGTTTGTGATAATTTTCTGCAGCAGCAACAGGAAACCGACACAGGAAC
CCAGGTCAAGGACAAGCTAGGAAACCAAACAAGGATAGCCAGGTGTGGTGGTGGGCACGAGTAATCCAACGACTGGGGAG
GCTGAGGCAAGAGAATCACTTGAACCGGGGAGGCAGAGGTTGCAGTGAGCCAAGACAACACCACTGCACTCCAGCCTGGG
TGAAAAAGTGACTGTCTCAAAAATAAATTAATTAATCAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACCGTG
GGATCAGCAAGGGTGGGATGCTGATGCCACCACCAGGCTCCATCCACATAGGAAGGGGTTGATGCTCCTGGAACCAGCAC
CAGGGACCACCCTATGGAAGCTGGGGCCATGGAGAAGGCACAGACATGGCAGGAGAGGCTCCCAATCCCCATCAGGAACA
GGGTGTGTGGACACTGATGTCTGCCTTACTGATGAGTTGATACCTCTGCCAGAGACTCCAATTTGTTCAAAAGAGATTGA
TTCAGGCTGCTGAGAGCCTGGACATGCAGCCTGTCCTCTTCCACCCCCACATAGACAGCAGGAAAGAGACTAGTGGGAAA
GAGATACAACAGCCCAAGAGATGAGGCTCTCTTCACAGTGGGAAGGGAGTCAGGGGCTACTGGAGACAGAGGGACAGAGA
AGAGGGAGGAAGACAAATGGAGGGACCTGCACCAGGGGATATGGGCACAGAAAAGACACGGAGACACAGAGAGGGAGGAG
AGAGACAGACCTCTGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATGATAAAGAGAGATGCCTTCTAAAC
TCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGCTGAAATCAGGAGAGAC
AGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCTTTCTGCACAGAGAGGGGATCTCTGAGGACCCCTCAC
ACCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCCTGTCCTTGCAGGAACC
TACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGGACATCGTGATCACAGG
TGAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGACACAGAGTGAATGATCCAGGACTTGGAACCCCCAGGTGGTCAT
GAGGAAGATAAGCGTGAGATTCTTATGGAGAGAGACTGACTCGGTGAGGTCTGTACCAACAGAGACAGGGAAACAGGAGA
CATAAGTACAGACCAGGTGTCATAACAGAGGACAGACACAGGGGCCATACGGGGAAGTAGAAAAGAGAGAAAGAGGTAAA
GGAGACACTCAGACAGACAGACATGTGCCAGAGAGAAGTGTCCTTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTT
AGAAGTTTCATTTCTGTTTTGTCTCCACAAAGTGCTTCTACGAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTT
GGGCCCTGTGGCCTCAGGCCTTGTGGCATCTACAGATGCCATGTTTATTCTGACACCTCTGCCTTCCATGCAGTGGAGCC
ATAATTATCCCAGGATATCATGGCCCCAGAACACCAACCCCTAAATACTGTGTGTACTTGGTGTCCCCAGACTAGATTCT
GAGGCTCATATTCCAAATAATCCTACATATAATAGGATCACTGAGAGACACAGAGATAAATCAGGGACTTCAAAAAGCAA
AGGCATAAACACACAGAGAATGAGCCAGAGGAAGGGGATTGAGAGACTCACAGACACACAAAAAGAAAGAAAAGAGGGCA
GAGGAGTGGAGAGAATGCTGGAAGGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGGAGGGGCACAAAGACAGAGA
AAGATAAAGATGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGATG
GAGAGAGACAGATGATAGATGGATAGATAGATATAGATAGATGATAAATAGGTAGATGATAGATAATGGATAGGTTATAG
ATACATAGATGATGATTGATAGATGATACATAGAGATGATGATGATGATGATGATGAAGATAGATAGATAGAAGACACAT
ATATAAATATATAGATACATAGATGATACATAGAGACTGACAGGCAGACAGAGAGGTAATAGAGAGAGAGAGAGATGATA
CATAGATACAGATAATACATAGATGATTGATGGATAGACAGATAGACAATTGATAGATAAATGATACATAGATATAGATG
ACAGATAATTTGTAGATAGACACAAAATAGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAAGACAGAAAGTG
AGAGACTCAGAATTATAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAATCCAAAAAG
GGAAAGCATACCCAGGGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGCGGAAGGAGGAAATAGACATGAA
GAGAGTTGGGGTGGAGGGTGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTATGAG
GGGAGCTGTGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCA
GCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTGACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCA
TCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCGTGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTC
CTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAACTCA
AGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAACCCGTGTCTGTCCCATGTCTTATGATCCTAGAGCCATAGCTG
AGGAGCTTCCTGCCGATGATGGGGAGAAGCATGGACAGATGCAGAGAGAACACGAAGACTGGGTGTGAGGGGGGGGTCAG
GGTGCAGGATGGCAGACAGGGCACCTCCAAACCCTCTTGCATGGCCTGCATGGAGGCCCATGGTCAGGGCTCCAGGCACC
CAGGCAGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTCCCTC
AGCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAGAGATGTCATCACCAGCAACCCC
TACACTCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCAACTTTACCATTTTTA
AAAGTAAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTTGTAATCTTGGCGCTTTGAGAGG
CCAAGAAAGGTGGATCATTTAAGATCAGGGACTCGAGATCAGCCTGGCCAACATGCGGGAAATTCATCTTTACTAAACAG
ACAAGAAAAATTAGCCAAGCATGCCGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCACTTAA
AGCCAGGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGTTTCT
AAATAAATAAATACATCTATATTCTTTTTTTTGTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTATCCACCATTCTAT
TCTCTACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGTGAGAAATGGGAATCTTTGTAATGACCTCCAGTTCCAT
CCATGTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACCGTGTGTGTGTACTACAGTTCTCTA
TCCATTCACCCACTGATAGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATATGAGTG
CAGATATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGACACTATGAAAGTTC
TCTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCAAAGTGGTGCGATCTTGGCTCAT
TGCAACCTCTGCTTCCTAGGTTCAAACGATTCTCCTGACTCAGCCTCCCTAATAGCTGTGATTACAGGTGCACGCCACCA
TGCCTGACTAATTCTTGTATTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGACCTCA
AGTGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTATGCCCAGCCTCCTTTTAGTTTTTT
AAAGTTTTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCTTTCTC
TACCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGATAAAAGCCATTTTACTTTATTTATTTATTTATTTATTTATGT
TGAGATGGAGTTTCACTCATAGTCGCCCAGGCTGGAGTGCAAGGGTGTGATCTCGGCTCACTGCAACCTCTGCCTCCCGC
GTTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCCACCACGCCTAGCTAATTTTTGTA
TGTTTAGTAGAGAGGGAGTTTCTCCATGTTGGTCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGCCTCCCA
AAGTGCTGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGATTGTAA
TTTACATTTCTGTGATGATGAGTGATGCTGAGCACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTGTGGAGA
AATGTCTCCTCATGTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCCAGTTAT
TAATCCCATCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTGGGTTGTCTCTTCACTTTGTTGGTTTATCTTT
GGTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAGGTTTTA
AACAAAATGTCTTTCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAGACTCAT
GTTTTTAATCCATTTTCATTTGATTTTTGTGTAAGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAGATATCC
AGTTTTCCCCACACCATTTATTGAAGACTGTCCTTTCTTGATTGTAAGTTCTCGGCACCTTTGTCAAAGTCCATTAAATG
GGCTGGGCATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGGTGGATCACCTAAAGCCAGGAGTTC
AAGACCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGATCAGTGCCTG
TAATACCACTACTCAGGAGTTTGAAGCAAGAGAATTTCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGATTGCAC
CTCTACACTCCAGCCTGCATGACAGAGCAAGATTCCATCACACACACACAAAAGAAAGCCATTGGATGTAAATGCATGGA
TTATATCTGTGTTCTCCATTCTGTTCCATTTTTTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTACTACAG
CTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGTGGGCAT
CGCACACAAAAATTATGGAGAAAAGGATCCCAAGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCATGAACCA
ACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCTGTCCCGTGTTCTAGGAAACCCT
TCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTTTGGAAA
CCTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCCACCATC
TCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTTACCTTTAATTTC
CTGCAGGTGAGACCTCCTACAAGCTAGAAGAATAATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAGTGTTTTTTCT
GCCTGCATTCCTAACTGGAGGATAAATTCCCGGGGGCTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGTGGGTGT
TTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATCAGGCAACCCTGGCTGACTCAGCAGAGCAAGAGCC
TTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACAGCCCCATGCTCAGGCTG
TGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTATTTAAT
TATCTTACAGTGCTGTAGCTCAAAGCATGACGTGCATGTCACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCT
CTGAGGGTTCCAGGCAAGAATCTGCTTCTCACTTTTCTCAGCTTCTAGAGGCTCCCATGTTCCTTGGCTCCTGGTACCCT
TCCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTT
TCTCTGAATGCTGCTCTCCCTTCTTCCCCTTCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCAT
CATAATCTCCCGGAAATCATCCAGGATACCCTCCTTTTAAGTTCAGCTGACTAGCAACCATAATTCCATCTGCAATCTTC
ATTCCTCCTTTCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACATGGACATTTTTGGGGTGGGACAACATTC
TCCTGCCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGTTCTTGGGACACTGATCTTGCAGATGGTTAAATGGGA
GGGCAGAAAATGTAGGCACAAGGGGACCAATAAATGAATGATCTATTGAGAAGCATCTGTGCATGAAATCTATTTATTTA
TGTATTTACCTACTTGTTTATTGAGACGGAGCCTTGCTCTGTCGTCCAGGCTAGAGTGCGGTGGCATGATCTCGGCTCAC
TGCAACCTCCACCTCCTGGGCTGAACTGATCTCCTCCCTCAGCCTCTCCAGTAGCTGGGATTACAGACCACAACCACCAC
GCCCGGCTAACTCTTTTTGCATATTTTCTGTAGAGAGGATGTTTCACCATGTTGGCCAGGCTGGTCTCAAATTCCCAACC
TCAGGTGATCCAATAGCCTCTGCCTCCCAACACGCTGGGATAAGAGGCATGAGCCACGGGGCCAAGCCAAATTTTCAAAT
CAATAATAGATAATGCTGAGTGTATGATTTCAGGTGACAGAGAAGTTCTCACTAATCAGATATTTGTGACATTAATGAAA
AACACGGATTGAACCCCTGAAAGATGGGCGGAAGGATTTTGCACACACAGCTGTCAGCCGTGAAGGCACAAAGGTGAAAA
TAATCTGATGTTGAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGACGTGGGGAGAATGACAAGACGACTGTAGAGAGA
CGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGACTCACCT
CGGGGTAACCAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAG
GAGACCGTGGAAAAGGCAATTCCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGG
TATAAGATATGTTTGTGAGGTAGAATCATTGGCTGGAAAGGCTTGCTGGGTTTGATTTTTTCCTGGTAGTTTAATCCTCG
CTTCACTAACTTATTTCTGAGATTTATTTCTCCTGCATCTAAATCAATACCTGGCAGAGGAGGGAGAGCTAGATGAGGGG
TGGTGCAAATGAAGGGACCTAGTATAGCATAATATACAAGGCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTTCAG
GAGGCCAACGCGGGTGGATCACATGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGAGAAACCCTATCTCTACTAA
AAATACAAAAATTAAACAGGCATGATGGTGGTGCATGACTGTAATCCCAGCTACTCTGGAGGAGGAAGCAGGAGAATGAC
TTCAGCCCTGGAGGCAGAGGTTGCAGTGAGTGGAGATCGCGTCACTGCACACCAGCCTGGGCTACACAGGGATACTCTGG
CTCAAAAAATAAAAATAAAAAATACATAAATATAATAATATACACAAATGATGCAGGCACCTGAATTCCAATCATCATTT
TTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGAAAATCAGCCTAAAACCTCTTCCATATTTGGC
TTTCTGTGAACATGAGATCATATGGAAAATATGAAAGCCCCCTGAACCCACCAGCACAGGCCCTGAAATAGGGAAAGTGC
TCTGTTCATCACAAGAAACTTGCCCCCTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATACAGA
TAGATCATGGGGAGGTAAACGCTAATACTCCTTGGAGTGAGTTCAGATCTTGGAATCAGAGATCAGCACCAGCACTAGCT
CCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATGGTGGAGGGGGTGGTCTTTCCCCC
AGCCTCTCAGGTGGAACAGCAGCCTAACATGTGTCTCGCGAGATCACAAAGAGTAGCACGTTTCACATGGGCTTCATCAT
TATTTCCTGGCTGTTTGACATAAGAGAATTCTACTTTGCTTTTTTGATCTTGATTTCACTTTTGTGTCCTTTTCTTGGAG
AATGTAATTTGAGTCAAGAGGGTTGTGGATGTAGAAACTGTAAAGCACATTCACTGTGTATCAATCCCAGTTCAGTCTTT
CCAGAGAAGACTCTAAACACCTGCTGTACTGCACCTGGGCCTATGCAAATTTCTATCACTCACCGTCACTCCAGGGAGAC
AGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACATTTC
AATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTTCTCGGGACATATGGAGTCACCTCATTTGCAGTGTATCTGGGGGAA
GCCAGAAAATAGCCCAGCCTGGGTTTTGTACCCTGAAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCT
CCAGGAAGAACAGGAAGACAGCACAGGCTGTTCTGAGACGTTCCTCCTGATCTCAGGACGTTGCTGTCTTAGTCCATTTT
TGTTGCTATAAAAGAACACTTGAGCCTGGGTTACTTCTTTTTTTTTTTTTTTTTTTTGTATAGTGCTTCTGATGAGCTTT
TTTTTTAAATTTTTATTATTATTATACTTTAAGTTTTAGGGTACATGTGCACAATGTGCAGGTTAGTTACATATGTATAC
ATGTGCCATGCTGGTGTGCTGCACCCATCAACTCGTCATTTAGCATTAGGTATATCTCCTAATGCTATCCCTCCCCCCTC
CCCCCACCCCACAACAGTCCCCAGAGTGTGATGTTCCCCTTCCTGTGTCCATGTGTTCTCATTGTTCAATTCCCACCTAT
AAGTGAGAACATGCAGTGTTTGGATTTTTGTCCTTGTGATAGTCTACTGAGAATGATGATTTCCAATTTCATCCATGTCC
CTGCAAAGGACATGAACTCATCATTTTTTATGGCTGCATAGTATTCCATGGTGTATATGTGCCACATTTTCTTCATCCAG
TCTATCATTGTTGGACATTTGGGTTGGTTCCAAGTCTTTGCTATTGTGAATAGTGCCACAATAAACATACGTGTCCATGT
GTCTTTATAGCAGCATGATTTATAGTCCTTTGGGTTTATACCCAGTAATGGGATGGCTGGGTCAAATGGTATTTCAAGCT
CTAGATCCCTGAGGAATCGCCACACTGACTTCCACAATGGTTGAACTAGTTTACAGTCCCACCAACAGTGTAAAAGTGTT
CCTATTTCTCCACATCCTCTCCAGCACCTGTTGTTTCCCGACTTTTTAATGATCGCCATTCTAACTGGTGTGAGATGGTA
TCTCATTGTGGTTTTGATTTGCATTTCTCTGATGGCCAGTCATGGTGAGCATTTTTTCATGTGTTTTTTGGCTGCATAAA
TGTCTTCTTTTGAGAAGTGTCTGTTCATGTCCTTTGCCCACTTTTTGATAGGATTGTTTGTTTTTTTCTTGTAAATTTGT
TTGAGTTCATTGTAGATTCTGGATATTAGCCCTTTGTCAGATGAGTAGGTTGCGAAAATTTTCTCCCATTTTGTAGGTTG
TCTGTTCACTCTGATGGTAGTTTCTTTTGCTGTGCAGAAGCTCTTTAGTTTAATTAGATCCCGTTTGTCAATTTTGGCTT
TTGTTGCCGTTGCTTTTGGTGTTTTAGACATGAAGTCCTTGTCCATGCCTATGTCCTGAATGGTAATGCCTAGGTTTTCT
TCTAGGGTTTTTATGGTTTTAGGTCTAACGTTTAAGTCTTTAATCCATCTCAAATTAATTTTTGTATAAGGTGTAAGGAA
GGGATCCAGTTTCAGCTTTCTACCTATGGCTAGCCAGTTTTCCCAGCACCATTTATTAAATAGGGAATCCTTTCCCCATT
GCTTGTTTTTCTCAGGTGTGTCAAAGATCACATAGTTGTAGATATGTGGCATTATTTCTGAGGGCTCTATTCTGTTCCAT
TGATCTATATCTCTGTTTTGGTACCAGTACCATGCTGTTTTGGTTACTGTAGCCTTGTAGTATAGTTTGAAGTCAGGCAG
CATGATGCCTCCAGCTTTGTTCTTTTGGCTTAGGATTGACTTGGCAATGCAGGCTCTTTTTTGATTCCATATGAACTTTA
AGGTAGTTTTTTCCAATTCTGTGAAGAAAGTCATTGGTAGCTTGATGGGGATGGCATTGAATCTATAAATTACCTTGGGC
AGTATGGCCATTTTCACGATCTTGATTCTTCCTACCCATGAGCATGGAATGTTCTTCCATTTGTTTGTATCCTCTTTTAT
TTCATTGAGCAGTGGTTTGTAGTTCTCCTTGAAGAGGTCCTTCATATCCCTTGTAAGTTGGATTCCTAGGTATTTTATTC
TCTTTGAAGCAATTGTGAATGGGAGTTCACTCATGATTTGGCTCTCTGTTTGTCTGTTATTGGTGTATAAGAATGCTTGT
GATTTTTGTACATTGATTCTGTATCCTGAGACTTTGTAGAAGCTGCTTATCAGCTTAAGGAGATTTTGGGCTGAGACAAT
GGGGTTTTCTAGATATACAATCATGTCATCTGCAAACAGGGACAATTTGACTTCCTCTTTTCCTAATTGAATACCCTTTA
TTTCCTTCTCCTGCCTAATTGCCCTGGCCAGAACTTCCAACACTATGTTGAATAGGAGTGGTGAAAGAGGGCATCCCTGT
CTTGTGCCAGTTTTCAAAGGGAATGCTTCCAGTTTTTGCCCATTCAGTATGATACTGGCTGTGGGTTTGTTATAGATGGC
TCTTATTATTTTGAGATACGTCCCATCAATGCCTAATTTATTGAGAGTTTTTAGCATGAAGCGTTGTTGAATTTTGTCAA
AGGCCTTTTCTGCATCTATTGAGATAATCGTCCGGTTTTTGTCTTTGGTTCTGTTTATATGATGGATTACATTTATTGAT
TTGCATATATTGAACCAGCCTTGCATCCCAGAGCCTGGGCAACTTCTAGAGAAAACAGATTTGTTTGCCTCACAGTTCTG
CAGGCTGTACTGGAAGCATGGCACCAGCATCTGTTTCCTGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGG
AGGGTCTGTCTGTGCAGAGACCACAGAGATCACATGGCAAGAGAGGGAGCAAGGGGGAGGGCGAGCGATGGAGCTTCCAA
GCTCTTTTTAACAACCAGCCCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCATCATGTGGGGCAGCATTAATCTA
TTCATGATGGATCCACCTCCATGACTCAAACACCTTCCCATAGGCCCAAACTTCCACACTGGGGGTTAAATTTCAATATT
TCAGTGTGAGGTTTCAAAGGGTCAAACATCTAAACTAAAGCAGCTGTATCCTCAGCATGTTCTATGGTTTCTATGAGAGC
TGTAACTGAGAAAGCAGGAGAAAGCTGGGTCTCCCGCCATCAGGCTGCTTGTCCTAAGGAGATGTTCCATGTGGTTACCT
GTCAATCAAGAAATGAGACAATCCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGATTCCCATCTTCCTCCAGGTA
TCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTAT
CGCTGGTGCTCCAACAAAAAGAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGG
AGCACGCGGGTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGGGAGGAGCCACAGAGGCAGGGCTTTCTAGAGA
GAGCACCAGACAACCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGGTTCTGAACTGTATCCTCACATCCCCTGCAGC
CACTGACATCCAGAAGCTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGCCAATTGAGAGCACTTCATGG
GATGGGGTCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGGATGTTGGCAGCTGAAGAGCCTCAGGCACCTACAGCCTC
CCCCTGTGGGTTGGTGTCTGCCCATGAAATGAGGACCCAGAAGGGCCCTCCAAGCGGTTTTGATGACTTCCGTCTCCTAC
AGATGCTGCTGTAATGGACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGTAGGTCCTCCTCGGCCCAGCCTCA
CGGATACAGTCTTATCCCTAATAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGACTCT
GATGAACAAGACCCTCAGGAGGTGACGTACGCACAGTTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTC
TCAGAGGCCCAAGACACCCCTAACAGATACCAGCGTGTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCT
CCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGGTTTTCTAGGGAGACAACAGCCCTGTCTCAAAACCAGGTTGCCAG
ATCCAATGAACCAGCAGCTGGAATCTGAAGGCATCAGTCTGCATCTTAGGGGATCGCTCTTCCTCACACCACGAATCTGA
ACATGCCTCTCTCTTGCTTACAAATGCCTAAGGTCGCCACTGCCTGCTGCAGAGAAAACACACTCCTTTGCTTAGCCCAC
AAGTATCTATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCCTACTTGAGGCTGCAATCA
CACTGAGGAACTCACAATTCCAAACATGCAAGAGGCTCCCTCTTAACACGGCACTTACACACTTGCTGTTCCACCTTCCC
TCATGCTGTTCCACCTCCCCTCAGACTATCTTTCAGCCTTCTGTCATCAGTAAAATTTATAAATTTTTTTTATAACTTCA
GTGTAGCTCTCTCCTCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR