Allele Report for 3DL2*00903


3DL2*00903
Previous Designations & Local Names: FH05_A
IPD Acc No: KIR00457
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182338  
Cells Sequence Derived From: FH05  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (455 aa)
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESF
IMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGI
SEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFHALPCVWSNSSDPLLVSVTGNPS
SSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ
LDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Nucleotide Sequence Data (1368 bps)
ATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACTCATGGGTGGTCAGGA
CAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCTCGAGGAGGACATGTGGCTCTTCAGTGTCACTATCGTCGTG
GGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTC
ATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTC
GGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGC
TGAAATCAGGAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCATTTCTTTCTGCACAGAGAGGGGATC
TCTGAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCC
TGTCCTTGCAGGAACCTACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGG
ACATCGTGATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTG
ACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCG
TGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCATGCCCTGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGT
GGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAACAAAAAGAATGCTGCTGTAATGG
ACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACGTACGCACAG
TTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGACACCCCTAACAGATACCAGCGT
GTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGG
TTTTCTAG
Genomic Sequence Data (17007 bps)
GTGTGAGAGGTTGGATCTGAGACGTCTTTTGAGTCTGGTCATAGTGAAGGATGCAAGGTGGCAATTGTAGTCACAACAAT
TTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGC
GCGGCCTCCTGTCTGCACCGGCAGCACCATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGTGAGTCCTGGAAGGGAA
TAGAGGGAGGGAGAGTGGGGATGGAGATCTCGGCCTAGAGGTAAAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGT
GGAGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGGTGTAAATATGGGCCTGGAGTGCAGATATGGGCCTGGAGGGG
AGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGTGGAGATACGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGA
TATGGGCCTGCAGGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATAT
GGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTAGAGGGGAGATCTGGGCCTGGAGTGGAGATATGGGT
CTGATGTGGAGATATGGGCCTGGAGTGGAGATAGGGGCCTGGAGTGGAGATAGGGGCCTGGAGTGGAGATATGGGCCTGG
AGTGGAGATCTGGGCCAGGAAGTGTTGATCTGGGCCTGGAGCCTGGGTCTCTCCACAGCTGAGAGCCCTGTTCTTGGCAG
CAGGTAGCAGGGAGGCTAAGTTTACCTTCAGCCCAGCAAGGGCCTGGCTGCCAAGACACACAGTGCAGTGGGGGCAGCAG
GGTGCCCTGGTTTGCCTGCAGTTGGATCGTCTATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCC
ACTCATGGGTGAGTCCTTCCCCAAACCTTAGGGTGTCATCTCCCCACATAAGAGGATTTTTCTGAAACAGGAGGGAAGTC
CTGTCGGGGAGTCTCTCATAAACTAGGAAGAGGGGACCCTTGGATACTCGGCCCACATTTCTGACCTCGCCCTCCCCGGC
CTTTCTTTCCCTTTCCTGAGTCAAGCTCTGTGAAGACTGGGGTGAGACTGGGGTGCTCCAAGCTGGGGTGTGCAGGGAGG
AAGTGGTGTCAGCAGCAGAGAAAGAGAGGGAAGCAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTATAACTGACA
CCCTCCAGCGTTTCCGTGACGGTAGGGGCTGCAGTGTGGCTGCGGTCTTTCTACCAGAAGAGGGGGGAAACCACAGCCAT
GGCCCTGACATTCCAAATCCTCTGAGGGGGCTCAGTTCATGAATTGGCTGATATTCCATTCACATAGGACATGCCCTCCA
CGCCGTGTCTACTTTGTGTTGTTTTATGTGAGTAATTTTGCAGTATTAAAATCTAGTAAGAGTCACTTATTCAGCACTTG
CTCAAAGTTCTCAGCTGACACTTGTTGTAGGGAGACGCCATGTCTATGTGGGGTGGGTCCTTCCTGTAGCCCTGGGCACC
CAGGTGTGGTAGGAGCCTTAGAAAGCGGAAATGGGAGAATCTTCTGAGCACAGGGAGTGAGGGGTGGCTCCACATCCTCC
TCTCTAAGGCAGTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCT
CGAGGAGGACATGTGGCTCTTCAGTGTCACTATCGTCGTGGGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCA
CGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTCATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACA
GATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTCGGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGTCAG
AGGCTTTCTGTCTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCATCAGGGTCCCATC
ACCCAGGCCCCAACTGTATTTGGGGTCAAGGGGGATTGAATACAGGGGAAATGGGCGCTGTGGTGGGAAGAATAACTGTC
GCCAATGATGGCTACATTGTAAACCCTGGAGCCTGTGACTATTTATGTTATAGGGCAGGGGACTGAAGGGGAAGGTGGAG
CTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCTGCTGGGCTCAGTGTAATCACAAGGGTC
CGCGTGAGAGGTGGAGGAAGAGGGGAGTGGGGATTAGAGCAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGTGGGCTT
TGAAGGTGGAGGAAGGCCACTAGTCACAGAATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTCGCTGA
TTCTCCAGAGGGAACGCAGCCCTGCAGATGCCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCCCCAGAAGT
GGAAGGGGTCAGTGTGTTCTCTCCTGCTGCCATGTTTGTGATAATTTTCTGCAGCAGCAACAGGAAACCGACACAGGAAC
CCAGGTCAAGGACAAGCTAGGAAACCAAACAAGGATAGCCAGGTGTGGTGGTGGGCATGAGTAATCCAACGACTGGGGAG
GCTGAGGCAAGATAATCACTTGAACCGGGGAGGCAGAGGTTGCAGTGAGCCAAGACAACACCACTGCACTCCAGCCTGGG
TGAAAAAGTGACTGTCTCAAAAATAAATTAATTAATCAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACCGTG
GGATCAGCAAGGGTGGGATGCTGATGCCACCACCAGGCTCCATCCACATAGGAAGGGGTTGATGCTCCTGGAACCAGCAC
CAGGGACCACCCTATGGAAGCTGGGGCCATGGAGAAGGCACAGACATGGCAGGAGAGGCTCCCAATCCCCATCAGGAACA
GGGTGTGTGGACACTGATGTCTGCCTTACTGATGAGTTGATACCTCTGCCAGAGACTCCAATTTGTTCAAAAGAGATTGA
TTCAGGCTGCTGAGAGCCTGGACATGCAGCCTGTCCTCTTCCACCCCCACATAGACAGCAGGAAAGAGACTAGTGGGAAA
GAGATACAACAGCCCAAGAGATGAGGCTCTCTTCACAGTGGGAAGGGAGTCAGGGGCTACTGGAGACAGAGGGACAGAGA
AGAGGGAGGAAGACAAATGGAGGGACCTGCACCAGGGGATATGGGCACAGAAAAGACACGGAGACACAGAGAGGGAGGAG
AGAGACAGACCTCTGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATGATAAAGAGAGATGCCTTCTAAAC
TCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGCTGAAATCAGGAGAGAC
AGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCATTTCTTTCTGCACAGAGAGGGGATCTCTGAGGACCCCTCAC
GCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCCTGTCCTTGCAGGAACC
TACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGGACATCGTGATCACAGG
TGAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGACACAGAGTGAATGATCCAGGACTTGGAACCCCCAGGTGGTCAT
GAGGAAGATAAGCGTGGGATTCTTATGGAGAGAGACTGACTCGGTGAGGTCTGTACCAACAGAGACAGGGAAACAGGAGA
CATAAGTACAGACCAGGTGTCATAACAGAGGACAGACACAGGGGCCATACGGGGAAGTAGAAAAGAGAGAAAGAGGTAAA
GGAGACACTCAGACAGACAGACATGTGCCAGAGAGAAGTGTCCTTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTT
AGAAGTTTCATTTCTGTTTTGTCTCCACAAAGTGCTTCTACGAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTT
GGGCCCTGTGGCCTCAGGCCTTGTGGCATCTACAGATGCCATGTTTATTCTGACACCTCTGCCTTCCATGCAGTGGAGCC
ATAATTATCCCAGGATATCATGGCCCCAGAACACCAACCCCTAAATACTGTGTGTACTTGGTGTCCCCAGACTAGATTCT
GAGGCTCATATTCCAAATAATCCTACATATAATAGGATCACTGAGAGACACAGAGATAAATCAGGGACTTCAAAAAGCAA
AGGCATAAACACACAGAGAATGAGCCAGAGGAAGGGGATTGAGAGACTCACAGACACACAAAAAGAAAGAAAAGAGGGCA
GAGGAGTGGAGAGAATGCTGGAAGGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGGAGGGGCACAAAGACAGAGA
AAGATAAAGATGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGATG
GAGAGAGACAGATGATAGATGGATAGATAGATATAGATAGATGATAAATAGGTAGATGATAGATAATGGATAGGTTATAG
ATACATAGATGATGATTGATAGATGATACATAGAGATGATGATGATGATGATGATGAAGATAGATAGATAGAAGACACAT
ATATAAATATATAGATACATAGATGATACATAGAGACTGACAGGCAGACAGAGAGGTAATAGAGAGAGAGAGAGATGATA
CATAGATACAGATAATACATAGATGATTGATGGATAGACAGATAGACAATTGATAGATAAATGATACATAGATATAGATG
ACAGATAATTTGTAGATAGACACAAAATAGATAGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAAGACAGAA
AGTGAGAGACTCAGAATTATAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAATCCAA
AAAGGGAAAGCATACCCAGGGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGCGGAAGGAGGAAATAGACA
TGAAGAGAGTTGGGGTGGAGGGTGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTA
TGAGGGGAGCTGTGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCT
CTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTGACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCT
ACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCGTGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGAC
TTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCATGCCCTGCCCTGCGTGTGGTCAAA
CTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAACCCGTGTCTGTCCCATGTCTTATGATCCTAGAGCCATA
GCTGAGGAGCTTCCTGCCGATGATGGGGAGAAGCACGGACAGATGCAGAGAGAACACGAAGACTGGGTGTGAGGGGGGGG
TCAGGGTGCAGGATGGCAGACAGGGCACCTCCAAACCCTCTTGCATGGCCTGCATGGAGGCCCATGGTCAGGGCTCCAGG
CACCCAGGCAGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTC
CCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAGAGATGTCATCACCAGCAA
CCCCTACACTCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCAACTTTACCATT
TTTAAAAGTAAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTTGTAATCTTGGCGCTTTGA
GAGGCCAAGAAAGGTGGATCATTTAAGATCAGGGACTCGAGATCAGCCTGGCCAACATGCGGGAAATTCATCTTTACTAA
ACAGACAAGAAAAATTAGCCAAGCATGCCGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCAC
TTAAAGCCAGGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGT
TTCTAAATAAATAAATACATCTATATTCTTTTTTTTGTTACCTTCCACCCTTCCCTTCCTGGCCTCTGGTATCCACCATT
CTATTCTCTACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGTGAGAAATGGGAATCTTTGTAATGACCTCCAGTT
CCATCCATGTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACCGTGTGTGTGTACTACAGTTC
TCTATCCATTCACCCACTGATAGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATATG
AGTGCAGATATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGACACTATGAAA
GTTCTCTTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCAAAGTGGTGCGATCTTGG
CTCATTGCAACCTCTGCTTCCTAGGTTCAAACGATTCTCCTGACTCAGCCTCCCTAATAGCTGTGATTACAGGTGCACGC
CACCATGCCTGACTAATTCTTGTATTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGA
CCTCAAGTGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTATGCCCAGCCTCCTTTTAGT
TTTTTAAAGATTTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCT
TTCTCTACCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGATAAAAGCCATTTTACTTTACTTTATTTATTTATTTAT
TTATGTTGAGATGGAGTTTCACTCATAGTCGCCCAGGCTGGAGTGCAAGGGTGTGATCTCGGCTCACTGCAACCTCTGCC
TCCCGCGTTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCCACCACGCCTAGCTAATT
TTTGTATGTTTAGTAGAGAGGGAGTTTCTCCATGTTGGTCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGC
CTCCCAAAGTGCTGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGA
TTGTAATTTACATTTCTGTGATGATGAGTGATGCTGAGCACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTG
TGGAGAAATGTCTCCTCATGTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCC
AGTTATTAATCCCGTCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTGGGTTGTCTCTTCACTTTGTTGGTTT
ATCTTTGGTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAG
GTTTTAAACAAAATGTCTTTTGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAG
ACTCATGTTTTTAATCCATTTTCATTTGATTTTTGTGTAAGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAG
ATATCCAGTTTTCCCCACACCATTTATTGAAGACTGTCCTTTCCTGATTGTAAGTTCTCGGCACCTTTGTCAAAGTCCAT
TAAATGGGCTGGGTATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGGTGGATCACCTAAAGCCAG
GAGTTCAAGACCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGATCAG
TGCCTGTAATACCACTACTCAGGAGTTTGAAGCAAGAGAATTTCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGA
TTGCACCTCTACACTCCAGCCTGCATGACAGAGCAAGATTCTATCACACACACACAAAAGAAAGCCATTGGATGTAAATG
CATGGATTATATCTGTGTTCTCCATTCTGTTCCATTTTTTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTA
CTACAGCTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGT
GGGCATCGCACACAAAAATTATGGAGAAAAGGATCCCAAGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCAT
GAACCAACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCTGTCCCGTGTTCTAGGA
AACCCTTCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTT
TGGAAACCTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCC
ACCATCTCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTTACCTTT
AATTTCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAATAATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAGTGTT
TTTTCTGCCTGCATTCCTAACTGGAGGATAAATTCCCGGGGGCTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGT
GGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATCAGGCAACCCTGGCTGACTCAGCAGAGCA
AGAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCAGTGACTCATTCAGCCACAGCCCCATGCTC
AGGCTGTGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGTGTGAAAACAAAACGGTTA
TTTAATTATCTTACAGTGCTGTAGCTCAAAGCATGACGTGCATGTCACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCC
TTCCCTCTGAGGGTTCCAGGCAAGAATCTGCTTCTCACTTTTCTCAGCTTCTAGAGGCTCCCATGTTCCTTGGCTCCTGG
TACCCTTCCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACA
CCTCTTTCTCTGAATGCTGCTCTCCCTTCTTGCCCTTCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAA
ATCCATCATAATCTCCCGGAAATCATCCAGGATACCCTCCTTTTAAGTTCAGCTGACTAGCAACCATAATTCCATCTGCA
ATCTTCATTCCTCCTTTCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACATGGACATTTTTGGGGTGGGACA
ACATTCTCCTGCCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGTTCTTGGGACACTGATCTTGCAGATGGTTAA
ATGGGAGGGCAGAAAATGTAGGCACAAGGGGACCAATAAATGAATGATCTATTGAGAAGCATCTGTGCATGAAATCTATT
TATTTATGTATTTACCTACTTGTTTATTGAGACGGAGCCTTGCTCTGTCGTCCAGGCTAGAGTGCGGTGGCATGATCTCG
GCTCACTGCAACCTCCACCTCCTGGGCTGAACTGATCTCCTCCCTCAGCCTCTCCAGTAGCTGGGATTACAGACCACAAC
CACCACGCCCGGCTAACTCTTTTTGCATATTTTCTGTAGAGAGGATGTTTCACCATGTTGGCCAGGCTGGTCTCAAATTC
CCAACCTCAGGTGATCCAATAGCCTCTGCCTCCCAACACGCTGGGATAAGAGGCATGAGCCACGGGGCCAAGCCAAATTT
TCAAATCAATAATAGATAATGCTGAGTGTATTATTTCAGGTGACAGAGAAGTTCTCACTAATCAGATATTTGTGACATTA
ATGAAAAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTGCACACACAGCTGTCAGCCGTGAAGGCACAAAGG
TGAAAACAATCTGATGTGGAAGGAAGAGGCTCTGCCTGAAATGCTGGGAATGAGGTGGGGAGAATGACAAGATGACTGTA
GAGAGACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGCGTGTGTTTGACACTCACAGCCATTGGAT
TCACCTCGAGGTAACCAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGCTCAGTTGCATAACTGGA
ATCTAGGAGACCGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTA
GATGGATATAAGATATGTTTGTGAGGTAGAATCATTGGCTGGAAAGGCTTGCTGGGTTTAATTTTTCCTGGTAGTTTAAT
CCTCGCTTCACTAACTTATTTCTGAGATTTATTTCTCCTGCATCTAAATCAATACCTGGCAGAGGAGGGAGAGCTAGATG
AGGGGTGGTGCAAATGAAGGGACCTAGTATAGCATAATATACAAGGCTGTGAACGGTGGCTCACGCCTGTAACCCAGCAC
TTCAGGAGGCCAACGCGGGTGGATCACATGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGAGAAACCCTATCTCT
ACTAAAAATACAAAAATTAAACAGGCATGATGGTGGTGCATGACTGTAATCCCAGCTACTCTGGAGGAGGAAGCAGGAGA
ATGACTTCAGCCCTGGAGGCAGAGGTTGCAGTGAGTGGAGATCGCATCACTGCACACCAGCCTGGGCTACACAGGGATAC
TCTGTCTCAAAAAATAAAAATAAAAAATACATAAATATAATAATATACACAAATGATGCAGGCACCTGAATTCCAATCAT
CATTTTTCTATTCCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGAAAATCAGCCTAAAACCTCTTCCATAT
TTGGCTTTCTGTGAACATGAGATCATATGGAAAATATGAAAGCCCCCTGAACCCACCAGCACAGGCCCTGAAATAGGGAA
AGTGCTCTGTTCATCACAAGAAACTTTCCCCCTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGAT
ACAGATAGATCATGGGGAGGTAAACGCTAATACTCCTTGGAGTGAGTTCAGATCTTGGAATCAGAGATCAGCACCAGCAC
TAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATGGTGGAGGGGGTGGTCTTT
CCCCCAGCCTCTCAGGTGGAACAGCAGCCTAACATGTGTCTCGCGAGATCACAAAGAGTAGCACGTTTCACATGGGCTTC
ATCATTATTTCCTGGCTGTTTGACATAAGAGAATTCTACTTTGCTTTTTTGATCTTGATTTCACTTTTGTGTCCTTTTCT
TGGAGAATGTAATTTGAGTCAAGAGGGTTGTGGATGTAGAAACTGTAAAGCACATTCACTGTGTATCAATCCCAGTCCAG
TCTTTCCAGAGAAGACTCTAAACACCTGCTGTACTGCACCTGGGCCTATGCCAATTTCTATCACTCACCGTCACTCCAGG
GAGACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTAC
ATTTCAACGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCTCATTTGCAGTGTATCTGG
GGGAAGCCAGAAAATAGCCCAGCCTGGGTTTTGTACCCTGAAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTC
CTCCTCCAGGAAGAACAGGAAGACAGCACAGGCTGTTCTGAGACGTTCCTCCTGATCTCAGGACGTTGCTGTCTTAGTCC
ATTTTTGTTGCTATAAAAGAACACTTGAGCCTGGGTTACTTCTTTTTTTTTTTTTTTTTTTTTGTATAGTGCTTCTGATG
AGCTTTTTTTTAAAATTTTTATTATTATTATACTTTAAGTTTTAGGGTACATGTGCACAATGTGCAGGTTAGTTACATAT
GTATACATGTGCCATGCTGGTGTGCTGCACCCATCAACTCGTCATTTAGCATTAGGTATATCTCCTAATGCTATCCCTCC
CCCCTCCCCCCACCCCACAACAGTCCCCAGAGTGTGATGTTCCCCTTCCTGTGTCCATGTGTTCTCATTGTTCAATTCCC
ACCTATAAGTGAGAACATGCGGTGTTTGGATTTTTGTCCTTGTGATAGTCTACTGAGAATGATGATTTCCAATTTCATCC
ATGTCCCTGCAAAGGACATGAACTCATCATTTTTTATGGCTGCATAGTATTCCATGGTGTATATGTGCCACATTTTCTTC
ATCCAGTCTATCATTGTTGGACATTTGGGTTGGTTCCAAGTCTTTGCTATTGTGAATAGTGCCACAATAAACATACGTGT
CCATGTGTCTTTATAGCAGCATGATTTATAGTCCTTTGGGTTTATACCCAGTAATGGGATGGCTGGGTCAAATGGTATTT
CAAGCTCTAGATCCCTGAGGAATCGCCACACTGACTTCCACAATGGTTGAACTAGTTTACAGTCCCACCAACAGTGTAAA
AGTGTTCCTATTTCTCCACATCCTCTCCAGCACCTGTTGTTTCCCGACTTTTTAATGATCGCCATTCTAACTGGTGTGAG
ATGGTATCTCATTGTGGTTTTGATTTGCATTTCTCTGATGGCCAGTCATGGTGAGCATTTTTTCATGTGTTTTTTGGCTG
CATAAATGTCTTCTTTTGAGAAGTGTCTGTTCATGTCCTTTGCCCACTTTTTGATAGGATTGTTTGTTTTTTTCTTGTAA
ATTTGTTTGAGTTCATTGTAGATTCTGGATATTAGCCCTTTGTCAGATGAGTAGGTTGCGAAAATTTTCTCCCATTTTGT
AGGTTGTCTGTTCACTCTGATGGTAGTTTCTTTTGCTGTGCAGAAGCTCTTTAGTTTAATTAGATCCCGTTTGTCAATTT
TGGCTTTTGTTGCCGTTGCTTTTGGTGTTTTAGACATGAAGTCCTTGTCCATGCCTATGTCCTGAATGGTAATGCCTAGG
TTTTCTTCTAGGGTTTTTATGGTTTTAGGTCTAACGTTTAAGTCTTTAATCCATCTCAAATTAATTTTTGTATAAGGTGT
AAGGAAGGGATCCAGTTTCAGCTTTCTACCTATGGCTAGCCAGTTTTCCCAGCACCATTTATTAAATAGGGAATCCTTTC
CCCATTGCTTGTTTTTCTCAGGTTTGTCAAAGATCACATAGTTGTAGATATGTGGCATTATTTCTGAGGGCTCTATTCTG
TTCCATTGATCTATATCTCTGTTTTGGTACCAGTACCATGCTGTTTTGGTTACTGTAGCCTTGTAGTATAGTTTGAAGTC
AGGCAGCATGATGCCTCCAGCTTTGTTCTTTTGGCTTAGGATTGACTTGGCAATGCAGGCTCTTTTTTGATTCCATATGA
ACTTTAAGGTAGTTTTTTCCAATTCTGTGAAGAAAGTCATTGGTAGCTTGATGGGGATGGCATTGAATCTATAAATTACC
TTGGGCAGTATGGCCATTTTCACGATCTTGATTCTTCCTACCCATGAGCATGGAATGTTCTTCCATTTGTTTGTATCCTC
TTTTATTTCATTGAGCAGTGGTTTGTAGTTCTCCTTGAAGAGGTCCTTCATATCCCTTGTAAGTTGGATTCCTAGGTATT
TTATTCTCTTTGAAGCAATTGTGAATGGGAGTTCACTCATGATTTGGCTCTCTGTTTGTCTGTTATTGGTGTATAAGAAT
GCTTGTGATTTTTGTACATTGATTCTGTATCCTGAGACTTTGTAGAGGCTGCTTATCAGCTTAAGGAGATTTTGGGCTGA
GACAATGGGGTTTTCTATATATACAATCATGTCATCTGCAAACAGGGACAATTTGACTTCCTCTTTTCCTAATTGAATAC
CCTTTATTTCCTTCTCCTGCCTAATTGCCCTGGCCAGAACTTCCAACACTATGTTGAATAGGAGTGGTGAAAGAGGGCAT
CCCTGTCTTGTGCCAGTTTTCAAAGGGAATGCTTCCAGTTTTTGCCCATTCAGTATGATACTGGCTGTGGGTTTGTTATA
GATGGCTCTTATTATTTTGAGATACGTCCCATCAATGCCTAATTTATTGAGAGTTTTTAGCATGAAGCGTTGTTGAATTT
TGTCAAAGGCCTTTTCTGCATCTATTGAGATAGTCGTCCGGTTTTTGTCTTTGGTTCTGTTTATATGATGGATTACATTT
ATTGATTTGCATATATTGAACCAGCCTTGCATCCCAGAGCCTGGGCAACTTCTAGAGAAAACAGATTTGTTTGCCTCACA
GTTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTGTTTCCTGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAG
GGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACATGGCAAGAGAGGGAGCAAGGGGGAGGGCGAGCGATGGAGC
TTCCAAGCTCTTTTTAACAACCAGCCCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCATCATGTGGGGCAGCATT
AATCTATTCATGATGGATCCACCTCCATGACTCAAACACCTTCCCATAGGCCCAAACTTCCACACTGGGGGTTAAATTTC
AATATTTCAGTGTGAGGTTTCAAAGGGTCAAACATCTAAACTAAAGCAGCTGTATCCTCAGCATGTTCTATGGTTTCTAT
GAGAGCTGTAACTGAGAAAGCAGGAGAAAGCTGGGTCTCCCGCCATCAGGCTGCTTGTCCTAAGGAGATGTTCCATGTGG
TTACCTGTCAATCAAGAAATGAGACAATCCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGATTCCCATCTTCCTC
CAGGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTC
CTTTATCGCTGGTGCTCCAACAAAAAGAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAG
GATGGGAGCACGCGGGTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGGGAGGAGCCACAGAGGCAGGGCTTTC
TAGAGAGAGCACCAGACAACCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGGTTCTGAACTGTATCCTCACATCCCC
TGCAGCCACTGACATCCAGAAGCTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGCCAATTGAGAGCACT
TCATGGGATGGGGTCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGGATGTTGGCAGCTGAAGAGCCTCAGGCACCTAC
AGCCTCCCCCTGTGGGTTGGTGTCTGCCCATGAAATGAGGACCCAGAAGGGCCCTCCAAGCGGTTTTGATGACTTCCGTC
TCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGTAGGTCCTCCTCGGCCCA
GCCTCACGGATACAGTCTTATCCCTAATAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAG
GACTCTGATGAACAAGACCCTCAGGAGGTGACGTACGCACAGTTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCG
CCCTTCTCAGAGGCCCAAGACACCCCTAACAGATACCAGCGTGTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAG
TTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGGTTTTCTAGGGAGACAACAGCCCTGTCTCAAAACCAGGT
TGCCAGATCCAATGAACCAGCAGCTGGAATCTGAAGGCATCAGTCTGCATCTTAGGGGATCGCTCTTCCTCACACCACGA
ATCTGAACATGCCTCTCTCTTGCTTACAAATGCCTAAGGTCGCCACTGCCTGCTGCAGAGAAAACACACTCCTTTGCTTA
GCCCACAAGTATCTATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCCTACTTGAGGCTG
CAATCACACTGAGGAACTCACAATTCCAAACATACAAGAGGCTCCCTCTTAACACGGCACTTACACACTTGCTGTTCCAC
CTTCCCTCATGCTGTTCCACCTCCCCTCAGACTATCTTTCAGCCTTCTGTCATCAGTAAAATTTATAAATTTTTTTTATA
ACTTCAGTGTAGCTCTCTCCTCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR