Allele Report for 3DL2*008


3DL2*008
Previous Designations & Local Names: r3k17
IPD Acc No: KIR00072
Assigned: 28-JUN-2003 Sequence Last Modified: 17-JUL-2003
Source Entries: AF262967 , GU182349  
Cells Sequence Derived From: G085 , RR  
Known Ethnic Origin Of Source: Caucasoid
Publications
Gardiner CM et al. J Immunol 166:2992-3001 2001. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
Protein Sequence (455 aa)
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPQGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESF
IMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGTLLKSGETVILQCWSDVMFEHFFLHREGI
SEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPS
SSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ
LDHCVFIQRKISRPSQRPKTPPTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Nucleotide Sequence Data (1368 bps)
ATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACTCATGGGTGGTCAGGA
CAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCTCAAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTG
GGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTC
ATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTC
GGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGACCCTGC
TGAAATCAGGAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCTTTCTGCACAGAGAGGGGATC
TCTGAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCC
TGTCCTTGCAGGAACCTACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGG
ACATCGTGATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTG
ACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCG
TGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGT
GGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAACAAAAAGAATGCTGCTGTAATGG
ACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACGTACGCACAG
TTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGACACCCCCAACAGATACCAGCGT
GTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGG
TTTTCTAG
Genomic Sequence Data (16969 bps)
GTGTGAGAGGTTGGATCTGAGACATCTTTTGAGTCTGGTCATAGTGAAGGATGCAAGGTGGCAATTGTAGTCACAACAAT
TTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGC
GCGGCCTCCTGTCTGCACCGGCAGCACCATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGTGAGTCCTGGAAGGGAA
TAGAGGGAGGGAGAGTGGGGATGGAGATCTCGGCCTAGAGGTAAAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGT
GGAGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGGTGTAAATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGGG
AGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGTGGAGATACGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGA
TATGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATG
GGCCTAGAGGGGAGATCTGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATATGGGCCTGGAGTGGAGATATGGGCC
TGGAGTGGAGATAGGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATCTGGGCCAGGAAGTGTTGATCTGGGCCTGG
AGCCTGGGTCTCTCCACAGCTGAGAGCCCTGTTCTTGGCAGCAGGTAGCAGGGAGGCTAAGTTTACCTTCAGCCCAGCAA
GGGCCTGGCTGCCAAGACACACAGTGCAGTGGGGGCAGCAGGGTGCCCTGGTTTGCCTGCAGTTGGATCGTCTATCATGA
TCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACTCATGGGTGAGTCCTTCCCCAAACCTTAGGGTGTCAT
CTCCCCACATAAGAGGATTTTTCTGAAACAGGAGGGAAGTCCTGTCGGGGAGTCTCTCATAAACTAGGAAGAGGGGACCC
TTGGATACTCGGCCCACATTTCTGACCTCGCCCTCCCCGGCCTTTCTTTCCCTTTCCTGAGTCAAGCTCTGTGAAGACTG
GGGTGAGACTGGGGTGCTCCAAGCTGGGGTGTGCAGGGAGGAAGTGGTGTCAGCAGCAGAGAAAGAGAGGGAAGCAGTGC
TAGGAACAGCAGGTCCTCTGAGGACAAAGGTATAACTGACACCCTCCAGCGTTTCCGTGACGGTAGGGGCTGCAGTGTGG
CTGCGGTCTTTCTACCAGAAGAGGGGGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGAGGGGGCTCAGTTCA
TGAATTGGCTGATATTCCATTCACATAGGACATGCCCTCCATGCCGTGTCTACTTTGTGTTATTTTATGTGAGTAATTTT
GCAGTATTAAAATCTAGTAAGAGTCACTTATTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTGTTGTAGGGAGACGCC
ATGTCTATGTGGGGTGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAGAAAGCGGAAATGGGAGAA
TCTTCTGAGCACAGGGAGGGAGGGGTGGCTCCACATCCTCCTCTCTAAGGCAGTGCCTCCTTCTCCCCCAGGTGGTCAGG
ACAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCTCAAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGT
GGGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTT
CATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGT
CGGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGTCAGAGGCTTTCTGTCTGGGCTTCTCACTGTCCCACCTCCTGA
ATCCCAGAGCTTCTGGTGGGGGTGTCCATCAGGGTCCCATCACCCAGGCCCCAACTGTATTTGGGGTCAAGGGGGATTGA
ATACAGGGGAAATGGGCGCTGTGGTGGGAAGAATCACTGTCGCCAATGATGGCTACATTGTAAACCCTGGAGCCTGTGAC
TATTTATGTTATAGGGCAGGGGACTGAAGGGGAAGGTGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACA
GCCTGGACTGTCCTGCTGGGCTCAGTGTAATCACAAGGGTCCGCGTGAGAGGTGGAGGAAGAGGGGAGTGGGGATTAGAG
CAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGTGGGCTTTGAAGGTGGAGGAAGGCCACTAGTCACAGAATGCAGGTG
GCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTCGCTGAGTCTCCAGAGGGAACGCAGCCCTGCAGATGCCTTGATTT
CAGCACAGGGAGAACTGGATCCAATTTCTGTCCCCAGAAGTGGAAGGGGTCAGTGTGTTCTCTCCTGCTGCCATGTTTGT
GATAATTTTCTGCAGCAGCAACAGGAAACCGACACAGGAACCCAGGTCAAGGACAAGCTAGGAAACCAAACAAGGATAGC
CAGGTGTGGTGGTGGGCACGAGTAATCCAACGACTGGGGAGGCTGAGGCAAGAGAATCACTTGAACCAGGGAGGCAGAGG
TTGCAGTGAGCCAAGACAACACCACTGCACTCCAGCCTGGGTGAAAAAGTGACTGTCTCAAAAATAAATTAATTAATCAA
TTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACCGTGGGATCAGCAAGGGTGGGATGCTGATGCCACCACCAGGCT
CCATCCACATAGGAAGGGGTTGATGCTCCTGGAACCAGCACCAGGGACCACCCTATGGAAGCTGGGGCCATGGAGAAGGC
ACAGACATGGCAGGAGAGGCTCCCAATCCCCATCAGGAACAGGGTGTGTGGACACTGATGTCTGCCTTACTGATGAGTTG
ATACCTCTGCCAGAGACTCCAATTTGTTCAAAAGAGATTGATTCAGGCTGCTGAGAGCCTGGACATGCAGCCTGTCCTCT
TCCACCCCCACATAGACAGCAGGAAAGAGACTAGTGGGAAAGAGATACAACAGCCCAAGAGATGAGGCTCTCTTCACAGT
GGGAAGGGAGTCAGGGGCTACTGGAGACAGAGGGACAGAGAAGAGGGAGGAAGACAAATGGAGGGACCTGCACCAGGGGA
TATGGGCACAGAAAAGACACGGAGACACAGAGAGGGAGGAGAGAGACAGACCTCTGGGAGGGGAACCCTCACTCATTCCA
GGTGCCATGGATGGGATGATAAAGAGAGATGCCTTCTAAACTCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCC
CTCCTGGCCCACCCAGGGACCCTGCTGAAATCAGGAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCA
CTTCTTTCTGCACAGAGAGGGGATCTCTGAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCA
ACTTCTCCATCGGTCCCTTGATGCCTGTCCTTGCAGGAACCTACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAG
TTGTCAGCTCCCAGTGACCCCCTGGACATCGTGATCACAGGTGAGAGTGTCCAGACATTCTTCTCGTTGTCATTGGGACA
CAGAGTGAATGATCCAGGACTTGGAACCCCCAGGTGGTCATGAGGAAGATAAGCGTGGGATTCTTATGGAGAGAGACTGA
CTCGGTGAGGTCTGTACCAACAGAGACAGGGAAACAGGAGACATAAGTACAGACCAGGTGTCATAACAGAGGACAGACAC
AGGGGCCATACGGGGAAGTAGAAAAGAGAGAAAGAGGTAAAGGAGACACTCAGACAGACAGACATGTGCCAGAGAGAAGT
GTCCTTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTGTCTCCACAAAGTGCTTCT
ACGAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCATCTACAGATGC
CATGTTTATTCTGACACCTCTGCCTTCCATGCAGTGGAGCCATAATTATCCCAGGATATCATGGCCCCAGAACACCAACC
CCTAAATACTGTGTGTACTTGGTGTCCCCAGACTAGATTCTGAGGCTCATATTCCAAATAATCCTACATATAATAGGATC
ACTGAGAGACACAGAGATAAATCAGGGACTTCAAAAAGCAAAGGCATAAACACACAGAGAATGAGCCAGAGGAAGGGGAT
TGAGAGACTCACAGACACACAAAAAGAAAGAAAAGAGGGCAGAGGAGTGGAGAGAATGCTGGAAGGGAGGAGAGAAAAGC
CCCAAAATCAGAACCCTGAGGGAGGGGCACAAAGACAGAGAAAGATAAAGATGTGGGGATGGATTGCAGAGATTCCAAAT
AGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGATGGAGAGAGACAGATGATAGATGGATAGATAGATATAGATA
GATGATAAATAGGTAGATGATAGATAATGGATAGGTTATAGATACATAGATGATGATTGATAGATGATACATAGAGATGA
TGATGATGATGATGATGAAGATAGATAGATAGAAGACACATATATAAATATATAGATACATAGATGATACATAGAGACTG
ACAGGCAGACAGAGAGGTAATAGAGAGAGAGAGAGATGATACATAGATACAGATAATACATAGATGATTGATGGATAGAC
AGATAGACAATTGATAGATAAATGATACATAGATATAGATGACAGATAATTTGTAGATAGACACAAAATAGATAGATAGA
TAATAGATAGAAATATGCAGAAAGTTATGAACAAGACAGAAAGTGAGAGACTCAGAATTATAGAAAAAGGAAGATCAAGT
CAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAATCCAAAAAGGGAAAGCATACCCAGGGGTGGGGAAGTGAGGTCAG
AGACCTAGAGAGACAGAGAAGGCAGAAGGAGGAAATAGACATGAAGAGAGTTGGGGTGGAGGGTGAGAGAGAGAGAGAGC
ATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTATGAGGGGAGCTGTGACAAGGAAGAACCTCCCTGAGGAAA
CTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAA
CGTGACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGC
TCCGTGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGA
TGCTTCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGA
AAACCCGTGTCTGTCCCATGTCTTATGATCCTAGAGCCATAGCTGAGGAGCTTCCTGCCGATGATGGGGAGAAGCATGGA
CAGATGCAGAGAGAACACGAAGACTGGGTGTGAGGGGGGGGGTCAGGGTGCAGGATGGCAGACAGGGCACCTCCAAACCC
TCTTGCATGGCCTGCATGGAGGCCCATGGTCAGGGCTCCAGGCACCCAGGCAGATGGAGAAAGCGGTCAGGACAGACCCA
GAGAAGGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTCCCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCA
TCCTGGCCTCTCACCCACACAGAGAGATGTCATCACCAGCAACCCCTACACTCTTTTCTTTTCATTTTCAAAAATATTTA
TTGAGGTTAAATGTAACTATATAATTTACCAACTTTACCATTTTTAAAAGTAAAATCTAGTGGTCATAAATACCTTTATA
TGCTGGGTGTGGTGGTTCACGGTTGTAATCTTGGCGCTTTGAGAGGCCAAGAAAGGTGGATCATTTAAGATCAGGGACTC
GAGATCAGCCTGGCCAACATGCGGGAAATTCATCTTTACTAAACAGACAAGAAAAATTAGCCAAGCATGCCGGCATGCAC
CTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCACTTAAAGCCAGGAGGCAGAGGTTGCACTGAGCCGAGATC
ATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGTTTCTAAATAAATAAATACATCTATATTCTTTTTTTTGT
TACCCTCCACCCTTCCCTTCCTGGCCTCTGGTATCCACCATTCTATTCTCTACCTTCATGAGATCCACCTTTTATCTCCT
GCATGTGGTGAGAAATGGGAATCTTTGTAATGACCTCCAGTTCCATCCATGTGGCTGCAAATGACAGGATGTTATTGTTT
CTATGGATGAGTAGTCTCCACCGTGTGTGTGTACTACAGTTCTCTATCCATTCACCCACTGATAGGCAGGTAGGTTGACT
CCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATTTGAGTGCAGATATCACTTCGATACACTGATGTCCTTTCCT
TTGGATATAAACCCAGTAGTGAAATTGCTGGACACTATGAAAGTTCTCTTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTT
CCCTCCTTAGTCCAAGCTGGAGTCAAAGTGGTGCGATCTTGGCTCATTGCAACCTCTGCTTCCTAGGTTCAAACGATTCT
CCTGACTCAGCCTCCCTAATAGCTGTGATTACAGGTGCACGCCACCATGCCTGACTAATTCTTGTATTTTTTAGCACAGA
CGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGACCTCAAGTGAGGTGCCTGCCTCGGTTTCCCAAAGTGCT
GAAGTTACAGGCATAAGCCACTATGCCCAGCCTCCTTTTAGTTTTTTAAAGTTTTTCCATACTTTTCTCCATAATAGTTG
TACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCTTTCTCTACCATCTTGCCAGCATTTGTTTTGCCTGTCTT
GCAGATAAAAGCCATTTTACTTTACTTTATTTATTTATTTATTTATGTTGAGATGGAGTTTCACTCATAGTCGCCCAGGC
TGGAGTGCAAGGGTGTGATCTCGGCTCACTGCAACCTCTGCCTCCCGCGTTCAACTGATTCTCCTGCCTCAGCCTCCAAA
GTAGCTGGGATTACAGGCATGTGCCACCACGCCTAGCTAATTTTTGTATGTTTAGTAGAGAGGGAGTTTCTCCATGTTGG
TCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGCCTCCCAAAGTGCTGGAATTACAGGCGTGAGCCACCGGC
CTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGATTGTAATTTACATTTCTGTGATGATGAGTGATGCTGAG
CACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTGTGGAGAAATGTCTCCTCATGTCTTTTGCTCGTTTTTTA
ATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCCAGTTATTAATCCCATCTCAGATGAATAGTTTGCAAATA
TTTGCTCCTATTTTGTGGGTTGTCTCTTCACTTTGTTGGTTTATCTTTGGTGGTGCAGAAGTTGCTTGGTTTGATGTAAT
CCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAGGTTTTAAACAAAATGTCTTTCGTCAGACAAATGTCTTC
CCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAGACTCATGTTTTTAATCCATTTTCATTTGATTTTTGTGT
AAGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAGATATCCAGTTTTCCCCACACCATTTATTGAAGACTGTC
CTTTCTTGATTGTAAGTTCTCGGCACCTTTGTCAAAGTCCATTAAATGGGCTGGGCATGGTGGCTCACACCTGCAATTCC
AGCACTTTGGGAGGCCGAGGCGGGTGGATCACCTAAAGCCAGGAGTTCAAGACCAGGCTGGCCAACAGAGTGAAACCTCG
TCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGATCAGTGCCTGTAATACCACTACTCAGGAGTTTGAAGCAAGAG
AATTTCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGATTGCACCTCTACACTCCAGCCTGCATGACAGAGCAAGA
TTCCATCACACACACACAAAAGAAAGCCATTGGATGTAAATGCATGGATTATATCTGTGTTCTCCATTCTGTTCCATTTT
TTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTACTACAGCTCTGTAACATATTTCTAAGTCAGGTAGTGTG
ATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGTGGGCATCGCACACAAAAATTATGGAGAAAAGGATCCCA
AGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCATGAACCAACCTCAAAGATTTCCATTGAGTAGAGGACAAG
CACCCTCATTTCCTCACATCTCTCCTGTCCCGTGTTCTAGGAAACCCTTCAAGTAGTTGGCCTTCACCCACAGAACCAAG
CTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTTTGGAAACCTGGGGAGGTGGAAGCCTTGGATGCAAGTGT
TGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCCACCATCTCTGAACTCCAGACACTCCAACAGTGAAAGGG
ATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTTACCTTTAATTTCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAA
TAATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAGTGTTTTTTCTGCCTGCATTCCTAACTGGAGGATAAATTCCCG
GGGGCTTGAGAGAGGGAAGGGAAGGGAAGGGAACATCTGATGAGGGTGGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAA
TGAATTACTGTTGGTCATCAGGCAACCCTGGCTGACTCAGCAGAGCAAGAGCCTTGCCGTAACAGAGAACAGAGCTCATG
CACGCACACTTCGACTCACTGACTCATTCAGCCACAGCCCCATGCTCAGGCTGTGCAGTGTGGAAGCTTTTCCTATTGTT
GCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTATTTAATTATCTTACAGTGCTGTAGCTCAAAGCA
TGACGTGCATGTCACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTCTGAGGGTTCCAGGCAAGAATCTGCTT
CTCACTTTTCTCAGCTTCTAGAGGCTCCCATGTTCCTTGGCTCCTGGTACCCTTCCTCCTTCCTCAAAGCCCACAAAGAC
TGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTGCTCTCCCTTCTTCC
CCTTCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCATCATAATCTCCCGGAAATCATCCAGGAT
ACCCTCCTTTTAAGTTCAGCTGACTAGCAACCATAATTCCATCTGCAATCTTCATTCCTCCTTTCATGTAAAATAACATA
TTCACAAGCTATGGAGGCTAGGACATGGACATTTTTGGGGTGGGACAACATTCTCCTGCCTTCCACAAACAGTGAACAAG
ATGCATTTGGCCTCTGTTCTTGGGACACTGATCTTGCAGATGGTTAAATGGGAGGGCAGAAAATGTAGGCACAAGGGGAC
CAATAAATGAATGATCTATTGAGAAGCATCTGTGCATGAAATCTATTTATTTATGTATTTACCTACTTGTTTATTGAGAC
GGAGCCTTGCTCTGTCGTCCAGGCTAGAGTGCGGTGGCATGATCTCGGCTCACTGCAACCTCCACCTCCTGGGCTGAACT
GATCTCCTCCCTCAGCCTCTCCAGTAGCTGGGATTACAGACCACAACCACCACGCCCGGCTAACTCTTTTTGCATATTTT
CTGTAGAGAGGATGTTTCACCATGTTGGCCAGGCTGGTCTCAAATTCCCAACCTCAGGTGATCCAATAGCCTCTGCCTCC
CAACACGCTGGGATAAGAGGCATGAGCCACGGGGCCAAGCCAAATTTTCAAATCAATAATAGATAATGCTGAGTGTATGA
TTTCAGGTGACAGAGAAGTTCTCACTAATCAGATATTTGTGACATTAATGAAAAACACGGATTGAACCCCTGGAAGATTG
GCAGAAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCACAAAGGTGAAAACAATCTGATGTGGAAGGAAGAGGCTCT
TCCTCAAATGCTGGGAATGAAGTGGGGAGAATGACAAGACGACTGTGGAGAGACGGAGAGCACACTGGGTACACAGGAAA
CTAAGGAGGAACAAGGAGCGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAGCCAGGAATCCCTACATGAT
TAATATGACTGACATGAAAATAAGGGAGGCTCAGTTGCATAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTGCCGCC
CCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGATATAAGATATGTTTGTGAGGTAGAATC
ATTGGCTGGAAAGGCTTGCTGGGTTTAATTTTTCCTGGTAGTTTAATCCTCGCTTCACTAACTTATTTCTGAGATTTATT
TCTCCTGCATCTAAATCAATACCTGGCAGAGGAGGGAGAGCTAGATGAGGGGTGGTGCAAATGAAGGGACCTAGTATAGC
ATAATATACAAGGCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTTCAGGAGGCCAACGCGGGTGGATCACATGAAG
TCAGGAGTTCGAGACCAGCCTGGCCAACATGGAGAAACCCTATCTCTACTAAAAATACAAAAATTAAACAGGCATGATGG
TGGTGCATGACTGTAATCCCAGCTACTCTGGAGGAGGAAGCAGGAGAATGACTTCAGCCCTGGAGGCAGAGGTTGCAGTG
AGTGGAGATCGCATCACTGCACACCAGCCTGGGCTACACAGGGATACTCTGTCTCAAAAAATAAAAATAAAAAATACATA
AATATAATAATATACACAAATGATGCAGGCACCTGAATTCCAATCATCATTTTTCTATTCCTCTATAATTACTTCTTTGA
TCCTTTATCTTATCCATTAGAAAATCAGCCTAAAACCTCTTCCATATTTGGCTTTCTGTGAACATGAGATCATATGGAAA
ATATGAAAGCCCCCTGAACCCACCAGCACAGGCCCTGAAATAGGGAAAGTGCTCTGTTCATCACAAGAAACTTTCCCCCT
CACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATACAGATAGATCATGGGGAGGTAAACGCTAATAC
TCCTTGGAGTGAGTTCAGATCTTGGAATCAGAGATCAGCACCAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAG
GAGGACAGGTGGTTTTGAAGCAATAGATGGTGGAGGGGGTGGTCTTTCCCCCAGCCTCTCAGGTGGAACAGCAGCCTAAC
ATGTGTCTCGCGAGATCACAAAGAGTAGCACGTTTCACATGGGCTTCATCATTATTTCCTGGCTGTTTGACATAAGAGAA
TTCTACTTTGCTTTTTTGATCTTGATTTCACTTTTGTGTCCTTTTCTTGGAGAATGTAATTTGAGTCAAGAGGGTTGTGG
ATGTAGAAACTGTAAAGCACATTCACTGTGTATCAATCCCAGTCCAGTCTTTCCAGAGAAGACTCTAAACACCTGCTGTA
CTGCACCTGGGCCTATGCCAATTTCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACGTTACATAGG
CAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGA
AAAGCTGCTCGGGACATATGGAGTGACCTCATTTGCAGTGTATCTGGGGGAAGCCAGAAAATAGCCCAGCCCGGGTTTTG
TACCCTGAAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCTGTTCT
GAGACGTTCCTCCTGATCTCAGGACGTTGCTGTCTTAGTCCATTTTTGTTGCTATAAAAGAACACTTGAGCCTGGGTTAC
TTCTTTTTTTTTTTTTTTTTTTTTTTGTATAGTGCTTCTGATGAGCTTTTTTTTTAAATTTTTATTATTATTATACTTTA
AGTTTTAGGGTACATGTGCACAATGTGCAGGTTAGTTACATATGTATACATGTGCCATGCTGGTGTGCTGCACCCATCAA
CTCGTCATTTAGCATTAGGTATATCTCCTAATGCTATCCCTCCCCCCTCCCCCCACCCCACAACAGTCCCCAGAGTGTGA
TGTTCCCCTTCCTGTGTCCATGTGTTCTCATTGTTCAATTCCCACCTATAAGTGAGAACATGCGGTGTTTGGATTTTTGT
CCTTGTGATAGTTTACTGAGAATGATGATTTCCAATTTCATCCATGTCCCTGCAAAGGACATGAACTCATCATTTTTTAT
GGCTGCATAGTATTCCATGGTGTATATGTGCCACATTTTCTTCATCCAGTCTATCATTGTTGGACATTTGGGTTGGTTCC
AAGTCTTTGCTATTGTGAATAGTGCCACAATAAACATACGTGTCCATGTGTCTTTATAGCAGCATGATTTATAGTCCTTT
GGGTTTATACCCAGTAATGGGATGGCTGGGTCAAATGGTATTTCAAGCTCTAGATCCCTGAGGAATCGCCACACTGACTT
CCACAATGGTTGAACTAGTTTACAGTCCCACTAACAGTGTAAAAGTGTTCCTATTTCTCCACATCCTCTCCAGCACCTGT
TGTTTCCCGACTTTTTAATGATCGCCATTCTAACTGGTGTGAGATGGTATCTCATTGTGGTTTTGATTTGCATTTCTCTG
TTGGCCAGTCATGGTGAACATTTTTTCATGTGTTTTTTGGCTGCATAAATGTCTTCTTTTGAGAAGTGTCTGTTCATGTC
CTTTGCCCACTTTTTGATAGGGTTGTTTGTTTTTTTCTTGTAAATTTGTTTGAGTTCATTGTAGATTCTGGATATTAGCC
CTTTGTCAGATGAGTAGGTTGCAAAAATTTTCTCCCATTTTGTAGGTTGTCTGTTCACTCTGATGGTAGTTTCTTTTGCT
GTGCAGAAGCTCTTTAGTTTAATTAGATCCCGTTTGTCAATTTTGGCTTTTGTTGCCATTGCTCTTGGTGTTTTAGACAT
GAAGTCCTTGTCCATGCCTATGTCCTGAATGGTAATGCCTAGGTTTTCTTCTAGGGTTTTTATGGTTTTAGGTCTAACGT
TTAAGTCTTTAATCCATCTCAAATTATTTTTGTATAAGGTGTAAGGAAGGGATCCAGTTTCAGCTTTCTACCTATGGCTA
GCCAGTTTTCCCAGCACCATTTATTAAATAGGGAATCCTTTCCCCATTGCTTGTTTTTCTCAGGTTTGTCAAAGATCAGA
TAGTTGTAGATATGTGGCATTATTTCTGAGGGCTCTATTCTGTTCCATTGATCTATATCTCTGTTTTGGTACCAGTACCA
TGCTGTTTTGGTTACTGTAGCCTTGTAGTATAGTTTGAAGTCAGGCAGCATGATGCCTCCAGCTTTGTTCTTTTGGCTTA
GGATTGATTTGGCAATGCAGGCTCTTTTTTGATTCCATATGAACTTTAAGGTAGTTTTTTCCAATTCTGTGAAGAAAGTC
ATTGGTAGCTTGATGGGGATGGCATTGAATCTATAAATTACCTTGGGCAGTATGGCCATTTTCACGATCTTGATTCTTCC
TACCCATGAGCATGGAATGTTCTTCCATTTCTTTGTATCCTCTTTTATTTCATTGAGCAGTGGTTTGTAGTTCTCCTTGA
AGAGGTCCTTCATATCCCTTGTAAGTTGGATTCCTAGGTATTTTATTCTCTTTGAAGCAATTGTGAATGGGAGTTCACTC
ATGATTTGGCTCTCTGTTTGTCTGTTATTGGTGTATAAGAATGCTTGTGATTTTTGTACATTGATTCTGTATCCTGAGAC
TTTGTAGAAGCTGCTTATCAGCTTAAGGAGATTTTGGGCTGAGACAATGGGGTTTTCTAGATATACAATCATGTCATCTG
CAAACAGGGACAATTTGACTTCCTCTTTTCCTAATTGAATACCCTTTATTTCCTTCTCCTGCCTAATTGCCCTGGCCAGA
ACTTCCAACACTATGTTGAATAGGAGTGGTGAAAGAGGGCATCCCTGTCTTGTGCCAGTTTTCAAAGGGAATGCTTCCAG
TTTTTGCCCATTCAGTATGATACTGGCTGTGGGTTTGTTATAGATGGCTCTTATTATTTTGAGATACGTCCCATCAATAC
CTAATTTATTGAGAGTTTTTAGCATGAAGCGTTGTTGAATTTTGTCAAAGGCCTTTTCTGCATCTATTGAGATAATCGTC
CGGTTTTTGTCTTTGGTTCTGTTTATATGATGGATTACATTTATTGATTTGCATATATTGAACCAGCCTTGCATCCCAGA
GCCTGGGCAACTTCTAGAGAAAACAGATTTGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCT
GTTTCCTGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCA
CATGGCAAGAGAGGGAGCAAGGGGGAGGGCGAGCGATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTCTCCGGGAACTA
ATAGAGGGGGAACTTGCTAACCCCATCATGTGGGGCAGCATTAATCTATTCATGATGGATCCACCTCCATGACTCAAACA
CCTTCCCATAGGCCCAAACTTCCACACTGGGGGTTAAATTTCAATATTTCAGTGTGAGGTTTCAAAGGGTCAAACATCTA
AACTAAAGCAGCTGTATCCTCAGCACATTCTATGGTTTCTATGAGAGCTGTAACTGAGAAAGCAGGAGAAAGCTGGGTCT
CCCGCCATCAGGCTGCTTGTCCTAAGGAGATGTTCCATGTGGTTACCTGTCAATCAAGAAATGAGACAATCCATAAGGAG
GAACTGCTATGATTAGCTTCTTATTGGATTCCCATCTTCCTCCAGGTATCTGCAGACACCTGCATGTTCTGATTGGGACC
TCAGTGGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAACAAAAAGAGTAAGTCTCA
CGAAGCAGAGGCCAGAGAGCTCAGGGCCGTGTGGGGAAGCAGGATGGGAGCACGCAGGTGTGTGTTCCTCACTGGCAGGA
TGGTCCCTGGCCCAAGGGAGGAACCACAGAGGCAGGGCTTTCTAGAGAGAGCACCAGACAACCTGCCCCTGCCTTCAGCT
CACAGACCATTGCCTGGTTCTGAACTGTATCCTCACATCCCCTGCAGCCACTGACATCCAGAAGGTTCCATGACAGGCAG
AAAGTGGGAGACAGAATCAATGGGATGCCAATTGAGAACACTTCATGGGATGGGGTCTTGAACTCAGAGAGATAGAATGT
CTGAGTCTGGATGTTGGCAGCTGAAGAGCCTCAGGCACCTACAGCCTCCCCCTGTGGGTTGGTGTCTGCCCATGAAATGA
GGACCCAGAAGGGCCCTCCAAGCGGTTTTGATGACTTCTGTCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCGG
GGGACAGAACAGTGAATAGGCAGGTAGGTCCTCCTCGGCCCAGCCTCACGGATACAGTCTTATCCCTAATAGTCCTGAAA
AATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACGTACGC
ACAGTTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGACACCCCCAACAGATACCA
GCGTGTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAG
GGGGTTTTCTAGGGAGACAACAGCCCTGTCTCAAAACCAGGTTGCCAGCTCCCATGAACCAGCAGCTGGAATCTGAAGGC
GTCAGTCTTCATCTTAGGGCATTGCTCTTCCTCACACCACTAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAG
GTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCCATTTCACTTGACCCCTGCCCACCT
CTCCAACCTAACTGGCTTACTTCCTAGTCCTACTTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAACATGCAAG
AGGCTCCCTCTTAACACGGCACTTACACACTTGCTGTTCCACCTTCCCTCATGCTGTTCCACCTCCCCTCAGACTATCTT
TCAGCCTTCTGCCATCAGTAAAATTTATAAATTTTTTTTATAACTTTAGTGTAGCTCTCTCCTCTTCAAATAAACATGTC
TCCCCTCAT

IPD-KIR