Allele Report for 3DL2*0070101


3DL2*0070101
Previous Designations & Local Names: b3DL2a
IPD Acc No: KIR00071
Assigned: 28-JUN-2003 Sequence Last Modified: 24-JAN-2005
Source Entries: AF262965 , AY320039 , EF103911  
Cells Sequence Derived From: BS , RDP37 , RDP65 , WT47  
Known Ethnic Origin Of Source: Caucasoid
Publications
Gedil MA et al. Tissue Antigens 70:228-32 2007. abstract
Gardiner CM et al. J Immunol 166:2992-3001 2001. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 4 Laboratories: 3
Protein Sequence (455 aa)
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESF
IMGPVTPAHAGTYRCRGSRPHSLTGWSTPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGI
SEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPS
SSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVMYAQ
LDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Nucleotide Sequence Data (1368 bps)
ATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACTCATGGGTGGTCAGGA
CAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCTCGAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTG
GGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTC
ATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTC
GACACCCAGCAACCCCCTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGC
TGAAATCAGGAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCTTTCTGCACAGAGAGGGGATC
TCTGAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCC
TGTCCTTGCAGGAACCTACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGG
ACATCGTGATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTG
ACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCG
TGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGT
GGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAACAAAAAGAATGCTGCTGTAATGG
ACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGACTCTGATGAACAAGACCCTCAGGAGGTGATGTACGCACAG
TTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGACACCCCTAACAGATACCAGCGT
GTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGG
TTTTCTAG
Genomic Sequence Data (17030 bps)
GTGTGAGAGGTTGGATCTGAGACGTCTTTTGAGTCTGGTCATAGTGAAGGATGCAAGGTGGCAATTGTAGTCACAACAAT
TTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGC
GCGGCCTCCTGTCTGCACCGGCAGCACCATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGTGAGTCCTGGAAGGGAA
TAGAGGGAGGGAGAGTGGGGATGGAGATCTCGGCCTAGAGGTAAAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGT
GGAGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGGTGTAAATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGGG
AGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGTGGAGATACGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGA
TATGGGCCTGCAGGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATAT
GGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTAGAGGGGAGATCTGGGCCTGGAGTGGAGATATGGGT
CTGATGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATATGGGCCTGGAGTGGAGATAGGGGCCTGG
AGTGGAGATATGGGCCTGGAGTGGAGATCTGGGCCAGGAAGTGTTGATCTGGGCCTGGAGCCTGGGTCTCTCCACAGCTG
AGAGCCCTGTTCTTGGCAGCAGGTAGCAGGGAGGCTAAGTTTACCTTCAGCCCAGCAAGGGCCTGGCTGCCAAGACACAC
AGTGCAGTGGGGGCAGCAGGGTGCCCTGGTTTGCCTGCAGTTGGATCGTCTATCATGATCTTTCTTTCCAGGGTTCTTCT
TGCTGCAGGGGGCCTGGCCACTCATGGGTGAGTCCTTCCCCAAACCTTAGGGTGTCATCTCCCCACATAAGAGGATTTTT
CTGAAACAGGAGGGAAGTCCTGTCGGGGAGTCTCTCATAAACTAGGAAGAGGGGACCCTTGGATACTCGGCCCACATTTC
TGACCTCGCCCTCCCCGGCCTTTCTTTCCCTTTCCTGAGTCAAGCTCTGTGAAGACTGGGGTGAGACTGGGGTGCTCCAA
GCTGGGGTGTGCAGGGAGGAAGTGGTGTCAGCAGCAGAGAAAGAGAGGGAAGCAGTGCTAGGAACAGCAGGTCCTCTGAG
GACAAAGGTATAACTGACACCCTCCAGCGTTTCCGTGACGGTAGGGACTGCAGTGTGGCTGCGGTCTTTCTACCAGAAGA
GGGGGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGAGGGGGCTCAGTTCATGAATTGGCTGATATTCCATTC
ACATAGGACATGCCCTCCATGCCGTGTCTACTTTGTGTTGTTTTATGTGAGTAATTTTGCAGTATTAAAATCTAGTAAGA
GTCACTTATTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTGTTGTAGGGAGACGCCATGTCTATGTGGGGTGGGTCCT
TCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAGAAAGTGGAAATGGGAGAATCTTCTGAGCACAGGGAGGGAG
GGGTGGCTCCACATCCTCCTCTCTAAGGCAGTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAACCCTTCCTGTCTGCCCG
GCCCAGCACTGTGGTGCCTCGAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTGGGTTTAACAATTTCATGCTGT
ACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTCATCATGGGCCCTGTGACCCCA
GCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTCGACACCCAGCAACCCCCTGGT
GATCATGGTCACAGGTCAGAGGCTTTCTGTCTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGG
TGTCCATCAGGGTCCCATCACCCAGGCCCCAACTGTATTTGGGGTCAAGGGGGATTGAATACAGGGGAAATGGGCGCTGT
GGTGGGAAGAATAACTGTCGCCAATGATGGCTACATTGTAAACCCTGGAGCCTGTGACTATTTATGTTATAGGGCAGGGG
ACTGAAGGGGAAGGTGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCTGCTGGGCT
CAGTGTAATCACAAGGGTCCGCGTGAGAGGTGGAGGAAGAGGGGAGTGGGGATTAGAGCAGTGTAGTGGGAGGGAGACGC
TATCAGCCACTGTGGGCTTTGAAGGTGGAGGAAGGCCACTAGTCACAGAATGCAGGTGGCCTCTAAGGGCTGGAGAAGTC
AAGAGAACTGATTCGCTGAGTCTCCAGAGGGAACGCAGCCCTGCAGATGCCTTGATTTCAGCACAGGGAGAACTGGATCC
AATTTCTGTCCCCAGAAGTGGAAGGGGTCAGTGTGTTCTCTCCTGCTGCCATGTTTGTGATAATTTTCTGCAGCAGCAAC
AGGAAACCGACACAGGAACCCAGGTCAAGGACAAGCTAGGAAACCAAACAAGGATAGCCAGGTGTGGTGGTGGGCACGAG
TAATCCAACGACTGGGGAGGCTGAGGCAAGAGAATCACTTGAACCGGGGAGGCAGAGGTTGCAGTGAGCCAAGACAACAC
CACTGCACTCCAGCCTGGGTGAAAAAGTGACTGTCTCAAAAATAAATTAATTAATCAATTAATTAAAGAAACCAAACAAG
GAGAAGGTTGGCTACCGTGGGATCAGCAAGGGTGGGATGCTGATGCCACCACCAGGCTCCATCCACATAGGAAGGGGTTG
ATGCTCCTGGAACCAGCACCAGGGACCACCCTATGGAAGCTGGGGCCATGGAGAAGGCACAGACATGGCAGGAGAGGCTC
CCAATCCCCATCAGGAACAGGGTGTGTGGACACTGATGTCTGCCTTACTGATGAGTTGATACCTCTGCCAGAGACTCCAA
TTTGTTCAAAAGAGATTGATTCAGGCTGCTGAGAGCCTGGACATGCAGCCTGTCCTCTTCCACCCCCACATAGACAGCAG
GAAAGAGACTAGTGGGAAAGAGATACAACAGCCCAAGAGATGAGGCTCTCTTCACAGTGGGAAGGGAGTCAGGGGCTACT
GGAGACAGAGGGACAGAGAAGAGGGAGGAAGACAAATGGAGGGACCTGCACCAGGGGATATGGGCACAGAAAAGACACGG
AGACACAGAGAGGGAGGAGAGAGACAGACCTCTGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATGATAA
AGAGAGATGCCTTCTAAACTCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCC
TGCTGAAATCAGGAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCTTTCTGCACAGAGAGGGG
ATCTCTGAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGAT
GCCTGTCCTTGCAGGAACCTACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCC
TGGACATCGTGATCACAGGTGAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGACACAGAGTGAATGATCCAGGACTT
GGAACCCCCAGGTGGTCATGAGGAAGATAAGCGTGGGATTCTTATGGAGAGAGACTGACTCGGTGAGGTCTGTACCAACA
GAGACAGGGAAACAGGAGACATAAGTACAGACCAGGTGTCATAACAGAGGACAGACACAGGGGCCATACGGGGAAGTAGA
AAAGAGAGAAAGAGGTAAAGGAGACACTCAGACAGACAGACATGTGCCAGAGAGAAGTGTCCTTCCATGCTGACTTTGCT
CAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTGTCTCCACAAAGTGCTTCTACGAGGAGAACCCAAGGACACC
CATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCATCTACAGATGCCATGTTTATTCTGACACCTCTG
CCTTCCATGCAGTGGAGCCATAATTATCCCAGGATATCATGGCCCCAGAACACCAACCCCTAAATACTGTGTGTACTTGG
TGTCCCCAGACTAGATTCTGAGGCTCATATTCCAAATAATCCTACATATAATAGGATCACTGAGAGACACAGAGATAAAT
CAGGGACTTCAAAAAGCAAAGGCATAAACACACAGAGAATGAGCCAGAGGAAGGGGATTGAGAGACTCACAGACACACAA
AAAGAAAGAAAAGAGGGCAGAGGAGTGGAGAGAATGCTGGAAGGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGG
AGGGGCACAAAGACAGAGAAAGATAAAGATGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGC
AGAGAAAGACAAGGAGATGGAGAGAGACAGATGATAGATGGATAGATAGATATAGATAGATGATAAATAGGTAGATGATA
GATAATGGATAGGTTATAGATACATAGATGATGATTGATAGATGATACATAGAGATGATGATGATGATGATGATGAAGAT
AGATAGATAGAAGACACATATATAAATATATAGATACATAGATGATACATAGAGACTGACAGGCAGACAGAGAGGTAATA
GAGAGAGAGAGAGATGATACATAGATACAGATAATACATAGATGATTGATGGATAGACAGATAGACAATTGATAGATAAA
TGATACATAGATATAGATGACAGATAATTTGTAGATAGACACAAAATAGATAGATAGATAATAGATAGAAATATGCAGAA
AGTTATGAACAAGACAGAAAGTGAGAGACTCAGAATTATAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGAGTCAG
AGAGAATAAAACAATCCAAAAAGGGAAAGCATACCCAGGGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGG
CGGAAGGAGGAAATAGACATGAAGAGAGTTGGGGTGGAGGGTGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAG
TGAGTTCTCAGCTCAGGTATGAGGGGAGCTGTGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTC
TATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTGACCTTGTCCTGTAGCTCC
TGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCGTGCAGTGCCCAAGGTCAA
CAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGCCC
TGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAACCCGTGTCTGTCCCATGTC
TTATGATCCTAGAGCCATAGCTGAGGAGCTTCCTGCCGATGATGGGGAGAAGCATGGACAGATGCAGAGAGAACACGAAG
ACTGGGTGTGAAGGGGGGGTCAGGGTGCAGGATGGCAGACAGGGCACCTCCAAACCCTCTTGCATGGCCTGCATGGAGGC
CCATGGTCAGGGCTCCAGGCACCCAGGCAGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTCAGT
TTGGGGAGATCAGAGGTTCCCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGA
GAGATGTCATCACCAGCAACCCCTACACTCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATA
ATTTACCAACTTTACCATTTTTAAAAGTAAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGT
TGTAATCTTGGCGCTTTGAGAGGCCAAGAAAGGTGGATCATTTAAGATCAGGGACTCGAGATCAGCCTGGCCAACATGCG
GGAAATTCATCTTTACTAAACAGACAAGAAAAATTAGCCAAGCATGCCGGCATGCACCTGTAGTCCTAGCTACTTGGGAG
GCTGAGGCAGGAGAAGCACTTAAAGCCAGGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGG
AGACAGAGAGAGACTCTGTTTCTAAATAAATAAATACATCTATATTCTTTTTTTTGTTACCCTCCACCCTTCCCTTCCTG
GCCTCTGGTATCCACCATTCTATTCTCTACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGTGAGAAATGGGAATC
TTTGTAATGACCTCCAGTTCCATCCATGTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACCG
TGTGTGTGTACTACAGTTCTCTATCCATTCACCCACTGATAGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACA
GTGCTGGAACAGTCATATGAGTGCAGATATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAA
ATTGCTGGACACTATGAAAGTTCTCTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTC
AAAGTGGTGCGATCTTGGCTCATTGCAACCTCTGCTTCCTAGGTTCAAACGATTCTCCTGACTCAGCCTCCCTAATAGCT
GTGATTACAGGTGCACGCCACCATGCCTGACTAATTCTTGTATTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGG
CTGCTCTCAAACTCCTGACCTCAAGTGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTAT
GCCCAGCCTCCTTTTAGTTTTTTAAAGTTTTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACA
GGGTACCAGGGTTCTCCTTTCTCTACCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGATAAAAGCCATTTTACTTTA
TTTATTTATTTATTTATTTATGTTGAGATGGAGTTTCACTCATAGTCGCCCAGGCTGGAGTGCAAGGGTGTGATCTCGGC
TCACTGCAACCTCTGCCTCCCGCGTTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCC
ACCACGCCTAGCTAATTTTTGTATGTTTAGTAGAGAGGGAGTTTCTCCATGTTGGTCAGGCTGGTCTCCCGACCTCAGGT
GATCCGCCCACCTCCGCCTCCCAAAGTGCTGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAG
ATGAAAACTCATCGCGATTGTAATTTACATTTCTGTGATGATGAGTGATGCTGAGCACTTTTTCATATACGTGATCGCCA
TTTCTATGTTTTGTTTGTGGAGAAATGTCTCCTCATGTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTTT
GAGCTTCTTATATTTCCAGTTATTAATCCCATCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTGGGTTGTCT
CTTCACTTTGTTGGTTTATCTTTGGTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGA
TTACTTGTGTTTTGAAGGTTTTAAACAAAATGTCTTTCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTC
ATAGGTTCAGGCCTTAGACTCATGTTTTTAATCCATTTTCATTTGATTTTTGTGTAAGGTGACAGGTATAGATGCAGTTT
TATTCCTCTGCATGTAGATATCCAGTTTTCCCCACACCATTTATTGAAGACTGTCCTTTCTTGATTGTAAGTTCTCGGCA
CCTTTGTCAAAGTCCATTAAATGGGCTGGGCATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGGT
GGATCACCTAAAGCCAGGAGTTCAAGACCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAG
CTGAGCATGGTGATCAGTGCCTGTAATACCACTACTCAGGAGTTTGAAGCAAGAGAATTTCTTGAATCCAGGAAGTGGAG
GTTGCATTGAGCTGAGATTGCACCTCTACACTCCAGCCTGCATGACAGAGCAAGATTCCATCACACACACACAAAAGAAA
GCCATTGGATGTAAATGCATGGATTATATCTGTGTTCTCCATTCTGTTCCATTTTTTATGTGCCTTTCTTTATGCCAATG
TCATGCTGTTTTGCTTACTACAGCTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCT
TCAAGTCTCAAGACAGTGGGCATCGCACACAAAAATTATGGAGAAAAGGATCCCAAGACTCCCAGGGTCCAACATTAGAT
AACAGAGTGTTGGCCATGAACCAACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCC
TGTCCCGTGTTCTAGGAAACCCTTCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACC
CCTCTTATCTCTGCTTTTGGAAACCTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGA
ATGAGGGCCTGTCTTCCACCATCTCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGC
GAAGTCTCTTTACCTTTAATTTCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAATAATTGCCAATCTGACATCCTTCTC
AGGAAAAATGCAGTGTTTTTTCTGCCTGCATTCCTAACTGGAGGATAAATTCCCGGGGGCTTGAGAGAGGGAAGGGAAGG
GAACATCTGATGAGGGTGGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATCAGGCAACCCTG
GCTGACTCAGCAGAGCAAGAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCA
GCCACAGCCCCATGCTCAGGCTGTGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGG
TGAAAACAAAACGGTTATTTAATTATCTTACAGTGCTGTAGCTCAAAGCATGACGTGCATGTCACTGGGCTAAAATCAAG
GTGACAGCAAGGCTGCCTTCCCTCTGAGGGTTCCAGGCAAGAATCTGCTTCTCACTTTTCTCAGCTTCTAGAGGCTCCCA
TGTTCCTTGGCTCCTGGTACCCTTCCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGAC
CCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTGCTCTCCCTTCCTCCCCTTCTTTTGAAAACTTGGGGATTCTATTG
GGTTCACCAAGATGAAAATCCATCATAATCTCCCGGAAATCATCCAGGATACCCTCCTTTTAAGTTCAGCTGACTAGCAA
CCATAATTCCATCTGCAATCTTCATTCCTCCTTTCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACATGGAC
ATTTTTGGGGTGGGACAACATTCTCCTGCCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGTTCTTGGGACACTG
ATCTTGCAGATGGTTAAATGGGAGGGCAGAAAATGTAGGCACAAGGGGACCAATAAATGAATGATCTATTGAGAAGCATC
TGTGCATGAAATCTATTTATTTATGTATTTACCTACTTGTTTATTGAGACGGAGCCTTGCTCTGTCGTCCAGGCTAGAGT
GCGGTGGCATGATCTCGGCTCACTGCAACCTCCACCTCCTGGGCTGAACGGATCTCCTCCCTCAGCCTCTCCAGTAGCTG
GGATTACAGACCACAACCACCACGCCCGGCTAACTCTTTTTGCATATTTTCTGTAGAGAGGATGTTTCACCATGTTGGCC
AGGCTGGTCTCAAATTCCCAACCTCAGGTGATCCAATAGCCTCTGCCTCCCAACACGCTGGGATAAGAGGCATGAGCCAC
GGGGCCAAGCCAAATTTTCAAATCAATAATAGATAATGCTGAGTGTATGATTTCAGGTGACAGAGAAGTTCTCACTAATC
AGATATTTGTGACATTAATGAAAAACACGGATTGAACCCCTGAAAGATGGGCGGAAGGATTTTGCACACACAGCTGTCAG
CCGTGAAGGCACAAAGGTGAAAATAATCTGATGTTGAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGACGTGGGGAGA
ATGACAAGACGACTGTAGAGAGACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGAC
ACTCACAGCCATTGGACTCACCTCGGGGTAACCAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGC
CCAGGTGCGTAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTCCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGAC
ACTAAATGAATGAAGTAGATGGATATAAGATATGTTTGTGAGGTAGAATCATTGGCTGGAAAGGCTTGCTGGGTTTGATT
TTTTCCTGGTAGTTTAATCCTCGCTTCACTAACTTATTTCTGAGATTTATTTCTCCTGCATCTAAATCAATACCTGGCAG
AGGAGGGAGAGCTAGATGAGGGGTGGTGCAAATGAAGGGACCTAGTATAGCATAATATACAAGGCTGTGAACGGTGGCTC
ACGCCTGTAACCCAGCACTTCAGGAGGCCAACGCGGGTGGATCACATGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACA
TGGAGAAACCCTATCTCTACTAAAAATACAAAAATTAAACAGGCATGATGGTGGTGCATGACTGTAATCCCAGCTACTCT
GGAGGAGGAAGCAGGAGAATGACTTCAGCCCTGGAGGCAGAGGTTGCAGTGAGTGGAGATCGCGTCACTGCACACCAGCC
TGGGCTACACAGGGATACTCTGGCTCAAAAAATAAAAATAAAAAATACATAAATATAATAATATACACAAATGATGCAGG
CACCTGAATTCCAATCATCATTTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGAAAATCAGC
CTAAAACCTCTTCCATATTTGGCTTTCTGTGAACATGAGATCATATGGAAAATATGAAAGCCCCCTGAACCCACCAGCAC
AGGCCCTGAAATAGGGAAAGTGCTCTGTTCATCACAAGAAACTTGCCCCCTCACCCAAATCCCCCACCTCACCCCTACTT
CCAATCACCTGTGGAGATACAGATAGATCATGGGGAGGTAAACGCTAATACTCCTTGGAGTGAGTTCAGATCTTGGAATC
AGAGATCAGCACCAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATG
GTGGAGGGGGTGGTCTTTCCCCCAGCCTCTCAGGTGGAACAGCAGCCTAACATGTGTCTCGCGAGATCACAAAGAGTAGC
ACGTTTCACATGGGCTTCATCATTATTTCCTGGCTGTTTGACATAAGAGAATTCTACTTTGCTTTTTTGATCTTGATTTC
ACTTTTGTGTCCTTTTCTTGGAGAATGTAATTTGAGTCAAGAGGGTTGTGGATGTAGAAACTGTAAAGCACATTCACTGT
GTATCAATCCCAGTTCAGTCTTTCCAGAGAAGACTCTAAACACCTGCTGTACTGCACCTGGGCCTATGCAAATTTCTATC
ACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGA
GTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTTCTCGGGACATATGGAGTCACCT
CATTTGCAGTGTATCTGGGGGAAGCCAGAAAATAGCCCAGCCTGGGTTTTGTACCCTGAAGCCACAGGAAGCACTCAGCT
AAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCACAGGCTGTTCTGAGACGTTCCTCCTGATCTCAGG
ACGTTGCTGTCTTAGTCCATTTTTGTTGCTATAAAAGAACACTTGAGCCTGGGTTACTTCTTTTTTTTTTTTTTTTTTGT
ATAGTGCTTCTGATGAGCTTTTTTTTAAAATTTTTATTATTATTATACTTTAAGTTTTAGGGTACATGTGCACAATGTGC
AGGTTAGTTACATATGTATACATGTGCCATGCTGGTGTGCTGCACCCATCAACTCGTCATTTAGCATTAGGTATATCTCC
TAATGCTATCCCTCCCCCCTCCCCCCACCCAACAACAGTCCCCAGAGTGTGATGTTCCCCTTCCTGTGTCCATGTGTTCT
CATTGTTCAATTCCCACCTATAAGTGAGAACATGCAGTGTTTGGATTTTTGTCCTTGTGATAGTCTACTGAGAATGATGA
TTTCCAATTTCATCCATGTCCCTGCAAAGGACATGAACTCATCATTTTTTATGGCTGCATAGTATTCCATGGTGTATATG
TGCCACATTTTCTTCATCCAGTCTATCATTGTTGGACATTTGGGTTGGTTCCAAGTCTTTGCTATTGTGAATAGTGCCAC
AATAAACATACGTGTCCATGTGTCTTTATAGCAGCATGATTTATAGTCCTTTGGGTTTATACCCAGTAATGGGATGGCTG
GGTCAAATGGTATTTCAAGCTCTAGATCCCTGAGGAATCGCCACACTGACTTCCACAATGGTTGAACTAGTTTACAGTCC
CACCAACAGTGTAAAAGTGTTCCTATTTCTCCACATCCTCTCCAGCACCTGTTGTTTCCCGACTTTTTAATGATCGCCAT
TCTAACTGGTGTGAGATGGTATCTCATTGTGGTTTTGATTTGCATTTCTCTGATGGCCAGTCATGGTGAGCATTTTTTCA
TGTGTTTTTTGGCTGCATAAATGTCTTCTTTTGAGAAGTGTCTGTTCATGTCCTTTGCCCACTTTTTGATAGGATTGTTT
GTTTTTTTCTTGTAAATTTGTTTGAGTTCATTGTAGATTCTGGATATTAGCCCTTTGTCAGATGAGTAGGTTGCGAAAAT
TTTCTCCCATTTTGTAGGTTGTCTGTTCACTCTGATGGTAGTTTCTTTTGCTGTGCAGAAGCTCTTTAGTTTAATTAGAT
CCCGTTTGTCAATTTTGGCTTTTGTTGCCGTTGCTTTTGGTGTTTTAGACATGAAGTCCTTGTCCATGCCTATGTCCTGA
ATGGTAATGCCTAGGTTTTCTTCTAGGGTTTTTATGGTTTTAGGTCTAACGTTTAAGTCTTTAATCCATCTCAAATTAAT
TTTTGTATAAGGTGTAAGGAAGGGATCCAGTTTCAGCTTTCTACCTATGGCTAGCCAGTTTTCCCAGCACCATTTATTAA
ATAGGGAATCCTTTCCCCATTGCTTGTTTTTCTCAGGTGTGTCAAAGATCACATAGTTGTAGATATGTGGCATTATTTCT
GAGGGCTCTATTCTGTTCCATTGATCTATATCTCTGTTTTGGTACCAGTACCATGCTGTTTTGGTTACTGTAGCCTTGTA
GTATAGTTTGAAGTCAGGCAGCATGATGCCTCCAGCTTTGTTCTTTTGGCTTAGGATTGACTTGGCAATGCAGGCTCTTT
TTTGATTCCATATGAACTTTAAGGTAGTTTTTTCCAATTCTGTGAAGAAAGTCATTGGTAGCTTGATGGGGATGGCATTG
AATCTATAAATTACCTTGGGCAGTATGGCCATTTTCACGATCTTGATTCTTCCTACCCATGAGCATGGAATGTTCTTCCA
TTTGTTTGTATCCTCTTTTATTTCATTGAGCAGTGGTTTGTAGTTCTCCTTGAAGAGGTCCTTCATATCCCTTGTAAGTT
GGATTCCTAGGTATTTTATTCTCTTTGAAGCAATTGTGAATGGGAGTTCACTCATGATTTGGCTCTCTGTTTGTCTGTTA
TTGGTGTATAAGAATGCTTGTGATTTTTGTACATTGATTCTGTATCCTGAGACTTTGTAGAAGCTGCTTATCAGCTTAAG
GAGATTTTGGGCTGAGACAATGGGGTTTTCTAGATATACAATCATGTCATCTGCAAACAGGGACAATTTGACTTCCTCTT
TTCCTAATTCAATACCCTTTATTTCCTTCTCCTGCCTAATTGCCCTGGCCAGAACTTCCAACACTATGTTGAATAGGAGT
GGTGAAAGAGGGCATCCCTGTCTTGTGCCAGTTTTCAAAGGGAATGCTTCCAGTTTTTGCCCATTCAGTATGATACTGGC
TGTGGGTTTGTTATAGATGGCTCTTATTATTTTGAGATACGTCCCATCAATGCCTAATTTATTGAGAGTTTTTAGCATGA
AGTGTTGTTGAATTTTGTCAAAGGCCTTTTCTGCATCTATTGAGATAATCGTCCGGTTTTTGTCTTTGGTTCTGTTTATA
TGATGGATTACATTTATTGATTTGCATATATTGAACCAGCCTTGCATCCCAGAGCCTGGGCAACTTCTAGAGAAAACAGA
TTTGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTGTTTCCTGTGACGGCCTCAGGCTGCTC
CCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACATGGCAAGAGAGGGAGCAAGGGGGAG
GGCGAGCGATGGAGCTTCCAAGCTCTTTTTAACAACCAGCCCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCATC
ATGTGGGGCAGCATTAATCTATTCATGATGGATCCACCTCCATGACTCAAACACCTTCCCATAGGCCCAAACTTCCACAC
TGGGGGTTAAATTTCAATATTTCAGTGTGAGGTTTCAAAGGGTCAAACATCTAAACTAAAGCAGCTGTATCCTCAGCATG
TTCTATGGTTTCTATGAGAGCTGTAACTGAGAAAGCAGGAGAAAGCTGGGTCTCCCGCCATCAGGCTGCTTGTCCTAAGG
AGATGTTCCATGTGGTTACCTGTCAATCAAGAAATGAGACAATCCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGG
ATTCCCATCTTCCTCCAGGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCATCTTCCTCTTCATCCTC
CTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAACAAAAAGAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGC
CATGTGGGGAAGCAGGATGGGAGCACGCGGGTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGGGAGGAGCCAC
AGAGGCAGGGCTTTCTAGAGAGAGCACCAGACAACCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGGTTCTGAACTG
TATCCTCACATCCCCTGCAGCCACTGACATCCAGAAGCTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATG
CCAATTGAGAGCACTTCATGGGATGGGGTCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGGATGTTGGCAGCTGAAGA
GCCTCAGGCACCTACAGCCTCCCCCTGTGGGTTGGTGTCTGCCCATGAAATGAGGACCCAGAAGGGCCCTCCAAGCGGTT
TTGATGACTTCCGTCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGTAG
GTCCTCCTCGGCCCAGCCTCACGGATACAGTCTTATCCCTAATAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCA
TTTCCCTCTCTCCAGGACTCTGATGAACAAGACCCTCAGGAGGTGATGTACGCACAGTTGGATCACTGCGTTTTCATACA
GAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGACACCCCTAACAGATACCAGCGTGTACACGGAACTTCCAAATGCTG
AGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGGTTTTCTAGGGAGACAACAGCCCT
GTCTCAAAACCAGGTTGCCAGATCCAATGAACCAGCAGCTGGAATCTGAAGGCATCAGTCTGCATCTTAGGGGATCGCTC
TTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGCCTAAGGTCGCCACTGCCTGCTGCAGAGAAAAC
ACACTCCTTTGCTTAGCCCACAAGTATCTATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAG
TCCTACTTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAACATGCAAGAGGCTCCCTCTTAACACGGCACTTACA
CACTTGCTGTTCCACCTTCCCTCATGCTGTTCCACCTCCCCTCAGACTATCTTTCAGCCTTCTGTCATCAGTAAAATTTA
TAAATTTTTTTTATAACTTCAGTGTAGCTCTCTCCTCTTCAAATAAACATGTCTGCCCTCATGGTTTCGA

IPD-KIR